TARGETED THERAPEUTICS BASED ON ENGINEERED PROTEINS FOR TYROSINE KINASES RECEPTORS, INCLUDING IGF-IR
The present invention provides innovative proteins that bind to insulin-like growth factor-I receptor (IGF-IR), as well as other important proteins. The invention also provides innovative proteins in pharmaceutical preparations and derivatives of such proteins and the uses of same in diagnostic, research and therapeutic applications. The invention further provides cells comprising such proteins, polynucleotide encoding such proteins or fragments thereof, and vectors comprising the polynucleotides encoding the innovative proteins.
This application is a continuation of U.S. patent application Ser. No. 13/892,418, filed May 13, 2013, which is a continuation of U.S. patent application Ser. No. 12/312,725, filed Jan. 20, 2010 (now U.S. Pat. No. 8,470,332), which is a U.S. national stage application filed under 35 U.S.C. §371 of International Application No. PCT/US2007/024316, filed Nov. 21, 2007, which claims the benefit of U.S. Provisional Patent Application No. 60/860,605, filed Nov. 22, 2006 and U.S. Provisional Patent Application No. 60/879,666, filed Jan. 9, 2007, the entire contents of which are incorporated herein by this reference.
FIELD OF THE INVENTIONThe present invention relates to innovative proteins that bind to insulin-like growth factor-I receptor (IGF-IR), as well as other important proteins. The invention also relates to innovative proteins in pharmaceutical preparations and derivatives of such proteins and the uses of same in diagnostic, research and therapeutic applications. The invention further relates to cells comprising such proteins, polynucleotide encoding such proteins or fragments thereof, and to vectors comprising the polynucleotides encoding the innovative proteins.
INTRODUCTIONInsulin-like growth factor-I receptor (IGF-IR) is a transmembrane heterotetrameric protein, which has two extracellular alpha chains and two membrane-spanning beta chains in a disulfide-linked beta-alpha-alpha-beta. configuration. The binding of the ligands, such as insulin-like growth-factor-I (IGF-I) and insulin-like growth factor-II (IGF-II), by the extracellular domain of IGF-IR receptor activates it and in many instances its intracellular tyrosine kinase domain resulting in autophosphorylation of the receptor and substrate phosphorylation.
IGF-IR is homologous to the insulin receptor, having a high sequence similarity of 84% in the beta chain tyrosine kinase domain and a low sequence similarity of 48% in the alpha chain extracellular cysteine rich domain (Ulrich, A. et al., 1986, EMBO, 5, 2503-2512; Fujita-Yamaguchi, Y. et al., 1986, J. Biol. Chem., 261, 16727-16731; LeRoith, D. et al., 1995, Endocrine Reviews, 16, 143-163). The IGF-IR and ligands (IGF-I and IGF-II) play important roles in numerous physiological processes including growth and development during embryogenesis, metabolism, cellular proliferation and cell differentiation in adults (LeRoith, D., 2000, Endocrinology, 141, 1287-1288; LeRoith, D., 1997, New England J. Med., 336, 633-640).
IGF-I and IGF-II ligands function both as endocrine hormones in the blood, where they are predominantly present in complexes with IGF-binding proteins, and as paracrine and autocrine growth factors that are produced locally (Humbel, R. E., 1990, Eur. J. Biochem., 190, 445-462; Cohick, W. S. and Clemmons, D. R., 1993, Annu. Rev. Physiol. 55, 131-153).
In vivo, serum levels of IGF-I are dependent upon the presence of pituitary growth hormone (GH). Although the liver is a major site of GH dependent IGF-I synthesis, a large number of extrahepatic tissues also produce IGF-I (Daughaday and Rotwein, Endocrine Rev. 10:68-91 (1989). A variety of neoplastic tissues may also produce IGF-I (Werner and LeRoith, Adv. Cancer Res. 68:183-223 (1996). Thus IGF-I may act as a regulator of normal and abnormal cellular proliferation via autocrine or paracrine, as well as endocrine mechanisms. IGF-I and IGF-II bind to IGF binding proteins (IGFBPs) in vivo. Upon binding to IGFs the IGFBPs either transport IGFs through the circulation or they may protect IGFs from proteolytic cleavage and inactivation. The availability of free IGF for interaction with the IGF-IR is modulated by the IGFBPs. For a review of IGFBPs and IGF-I, see Grimberg et al., J. Cell. Physiol. 183: 1-9, 2000.
At a molecular level IGF-IR has been implicated in promoting growth, transformation and survival of tumor cells (Baserga, R. et al., 1997, Biochem. Biophys. Acta, 1332, F105-F126; Blakesley, V. A. et al., 1997, Journal of Endocrinology, 152, 339-344; Kaleko, M., Rutter, W. J., and Miller, A. D. 1990, Mol. Cell. Biol., 10, 464-473). Several types of tumors are known to express higher than normal levels of IGF-IR, including breast cancer, colon cancer, ovarian carcinoma, synovial sarcoma and pancreatic cancer. See Khandwala, H. M. et al., 2000, Endocrine Reviews, 21, 215-244; Werner, H. and LeRoith, D., 1996, Adv. Cancer Res., 68, 183-223; Happerfield, L. C. et al., 1997, J. Pathol., 183, 412-417; Frier, S. et al., 1999, Gut, 44, 704-708; van Dam, P. A. et al., 1994, J. Clin. Pathol., 47, 914-919; Xie, Y. et al., 1999, Cancer Res., 59, 3588-3591; Bergmann, U. et al., 1995, Cancer Res., 55, 2007-2011.
In vitro, IGF-I and IGF-II have been shown to be potent mitogens for several human tumor cell lines such as lung cancer, breast cancer, colon cancer, osteosarcoma and cervical cancer (Ankrapp, D. P. and Bevan, D. R., 1993, Cancer Res., 53, 3399-3404; Cullen, K. J., 1990, Cancer Res., 50, 48-53; Hermanto, U. et al., 2000, Cell Growth & Differentiation, 11, 655-664; Guo, Y. S. et al., 1995, J. Am. Coll. Surg., 181, 145-154; Kappel, C. C. et al., 1994, Cancer Res., 54, 2803-2807; Steller, M. A. et al., 1996, Cancer Res., 56, 1761-1765). Several of these tumors and tumor cell lines also express high levels of IGF-I or IGF-II, which may stimulate their growth in an autocrine or paracrine manner (Quinn, K. A. et al., 1996, J. Biol. Chem., 271, 11477-11483).
Epidemiological studies have shown a correlation of elevated plasma level of IGF-I (and lower level of IGF-binding protein-3) with increased risk for prostate cancer, colon cancer, lung cancer and breast cancer (Chan, J. M. et al., 1998, Science, 279, 563-566; Wolk, A. et al., 1998, J. Natl. Cancer Inst., 90, 911-915; Ma, J. et al., 1999, J. Natl. Cancer Inst., 91, 620-625; Yu, H. et al., 1999, J. Natl. Cancer Inst., 91, 151-156; Hankinson, S. E. et al., 1998, Lancet, 351, 1393-1396). Strategies to lower the IGF-I level in plasma or to inhibit the function of IGF-IR have been suggested for cancer prevention (Wu, Y. et al., 2002, Cancer Res., 62, 1030-1035; Grimberg, A and Cohen P., 2000, J. Cell. Physiol., 183, 1-9).
IGF-IR can protect tumor cells from apoptosis caused by growth factor deprivation, anchorage independence or cytotoxic drug treatment (Navarro, M. and Baserga, R., 2001, Endocrinology, 142, 1073-1081; Baserga, R. et al., 1997, Biochem. Biophys. Acta, 1332, F105-F126). Domains of IGF-IR that are critical for its mitogenic, transforming and anti-apoptotic activities have been identified by mutational analysis. For example, the tyrosine 1251 residue of IGF-IR has been identified as critical for anti-apoptotic and transformation activities but not for its mitogenic activity (O'Connor, R. et al., 1997, Mol. Cell. Biol., 17, 427-435; Miura, M. et al., 1995, J. Biol. Chem., 270, 22639-22644).
Difficulty of Making a Therapeutic Based on IGF-IR Antagonism or InhibitionWhile IGF-IR has attractive biology as a therapeutic target, attempts to make antagonists or other types of inhibitors have been slow, largely due to one or more of the following factors depending on the therapeutic paradigm: difficulty or inability to antagonize the target without agonism; difficulty or inability to make selective antagonists or inhibitors due to undesired cross reactivity with other tyrosine kinase targets or receptors, such as the insulin receptor; difficulty in effective administration due to short half life of the potential therapeutic; difficulty in effective administration due to low solubility of the potential therapeutic; and difficulty in effective administration due to aggregation of the potential therapeutic. Therapeutics of the invention traverse one or more of these difficulties.
Tumor cells expressing an antisense to the IGF-IR mRNA undergo massive apoptosis when injected into animals in biodiffusion chambers. This observation makes the IGF-IR an attractive therapeutic target, based upon the hypothesis that tumor cells are more susceptible than normal cells to apoptosis by inhibition of IGF-IR (Resnicoff, M. et al., 1995, Cancer Res., 55, 2463-2469; Baserga, R., 1995, Cancer Res., 55, 249-252). However, both antisense and siRNA therapeutic strategies suffer from administration challenges and potential cost of goods obstacles.
Another strategy to inhibit the function of IGF-IR in tumor cells has been to use anti-IGF-IR antibodies that bind to the extracellular domain of IGF-IR and which may inhibit activation. Several attempts have been reported to develop mouse monoclonal antibodies against IGF-IR, of which two inhibitory antibodies—IR3 and 1H7—are available and their use has been reported in several IGF-IR studies.
The IR3 antibody was developed using a partially purified placental preparation of insulin receptor to immunize mice, which yielded an antibody, IR1, that was selective for binding insulin receptor, and two antibodies, IR2 and IR3, that showed preferential immunoprecipitation of IGF-IR (somatomedin-C receptor) but also weak immunoprecipitation of insulin receptor (Kull, F. C. et al., 1983, J. Biol. Chem., 258, 6561-6566).
Exemplary Deficiencies of AntibodiesIn some cases, antibodies activate IGF-IR. This has been shown a number of times in the literature. In addition, antibodies that are shown to “inhibit” may not have been carefully characterized and may actually activate IGF-IR under certain conditions, such as lower antibody concentrations. In a tumor where there is a likely diffusion gradient of antibody, activation of IGF-IR could occur with antibodies at lower concentrations of antibody in the tumor.
The 1H7 antibody was developed by immunizing mice with purified placental preparation of IGF-IR, which yielded an inhibitory antibody 1H7 in addition to three stimulatory antibodies (Li, S.-L. et al., 1993, Biochem. Biophys. Res. Commun., 196, 92-98; Xiong, L. et al., 1992, Proc. Natl. Acad. Sci. USA, 89, 5356-5360).
In another report, a panel of mouse monoclonal antibodies specific for human IGF-IR was obtained by immunization of mice with transfected 3T3 cells expressing high levels of IGF-IR, which were categorized into seven groups by binding competition studies and by their inhibition or stimulation of IGF-I binding to transfected 3T3 cells (Soos, M. A. et al., 1992, J. Biol. Chem., 267, 12955-12963).
Although IR3 antibody is the most commonly used inhibitory antibody for IGF-IR studies in vitro, it suffers from the drawback that it exhibits agonistic activity in transfected 3T3 and CHO cells expressing human IGF-IR (Kato, H. et al., 1993, J. Biol. Chem., 268, 2655-2661; Steele-Perkins, G. and Roth, R. A., 1990, Biochem. Biophys. Res. Commun., 171, 1244-1251). Similarly, among the panel of antibodies developed by Soos et al., the most inhibitory antibodies 24-57 and 24-60 also showed agonistic activities in the transfected 3T3 cells (Soos, M. A. et al., 1992, J. Biol. Chem., 267, 12955-12963). Although, IR3 antibody has been reported to inhibit the binding of IGF-I (but not IGF-II) to expressed receptors in intact cells and after solubilization, it has been shown to inhibit the ability of both IGF-I and IGF-II to stimulate DNA synthesis in cells in vitro (Steele-Perkins, G. and Roth, R. A., 1990, Biochem. Biophys. Res. Commun., 171, 1244-1251). The binding epitope of IR3 antibody has been inferred from chimeric insulin-IGF-IR constructs to be the 223-274 region of IGF-IR (Gustafson, T. A. and Rutter, W. J., 1990, J. Biol. Chem., 265, 18663-18667; Soos, M. A. et al., 1992, J. Biol. Chem., 267, 12955-12963).
The MCF-7 human breast cancer cell line is typically used as a model cell line to demonstrate the growth response of IGF-I and IGF-II in vitro (Dufourny, B. et al., 1997, J. Biol. Chem., 272, 31163-31171). In MCF-7 cells, the IR3 antibody incompletely blocks the stimulatory effect of exogenously added IGF-I and IGF-II in serum-free conditions by approximately 80%. Also, the IR3 antibody does not significantly inhibit (less than 25%) the growth of MCF-7 cells in 10% serum (Cullen, K. J. et al., 1990, Cancer Res., 50, 48-53). This weak inhibition of serum-stimulated growth of MCF-7 cells by IR3 antibody in vitro may be related to the results of an in vivo study in which IR3 antibody treatment did not significantly inhibit the growth of a MCF-7 xenograft in nude mice (Arteaga, C. L. et al., 1989, J. Clin. Invest., 84, 1418-1423).
Because of the weak agonistic activities of the IR3 and other reported antibodies, and their inability to significantly inhibit the growth of tumor cells such as MCF-7 cells in the more physiological condition of serum-stimulation (instead of stimulation by exogenously added IGF-I or IGF-II in serum-free condition), there is a need for new anti-IGF-IR modulators that could inhibit the serum-stimulated growth of tumor cells without significant agonistic activity by themselves. Although, in some instances, agonist activity will be desired, usually for applications outside of oncology or mis-controlled or undesired tissue expansion, proliferation, or growth.
Although anti-IGF-IR antibodies have been reported present in certain patients with autoimmune diseases, none of these antibodies has been purified and none has been shown to be suitable for inhibiting IGF-I activity for diagnostic or clinical procedures. See, e.g., Thompson et al., Pediat. Res. 32: 455 459, 1988; Tappy et al., Diabetes 37: 1708-1714, 1988; Weightman et al., Autoimmunity 16:251-257, 1993; Drexhage et al., Nether. J. of Med. 45:285-293, 1994. Additionally, monoclonal antibodies against the IGF-1R have been reported with can stimulate cell proliferation (Xiong et al., Proc. Natl. Acad. Sci. USA 89:5356-5360, 1992).
Additionally, it has been historically difficult to make antibodies and other therapeutics due to specificity, agonism, aggregation and solubility, as well as bi-specific therapeutics that include IGF-IR as a target, particularly with using antibodies.
Exemplary Deficiencies of Small Molecule InhibitorsSmall molecule chemistry programs have largely not been successful in creating a therapeutic to IGF-IR. The druggability of this target by proteins and small molecules has been difficult for a number of reasons including the ability to obtain selective chemistry for IGF-IR while not inhibiting or binding to related tyrosine kinases or receptors, such as the insulin receptor. In addition, the small molecules are often of low solubility making bioavailability, administration or formulation challenging.
Apoptosis and IGF-IROne of many aspects of the invention is for a polypeptide of the invention to selectively bind to IGF-IR to trigger apoptosis in the cells of a desired tissue, such as a tumor. IGF-IR biology, including activation, contributes to the regulation of apoptosis. It can slow or prevent apoptosis. Suppression of the apoptotic program by a variety of genetic lesions may contribute to the development and progression of malignancies.
Current potential therapeutic strategies, although capable of inducing apoptosis in vitro or for inhibiting in vitro cell proliferation associated with increased IGF-I, increased IGF-II, and/or increased IGF-IR receptor levels include suppressing IGF-I levels or IGF-II levels or preventing the binding of IGF-I to the IGF-IR, remain unsuitable for better therapeutics. For example, the long acting somatostatin analogue octreotide has been employed to reduce IGF synthesis and/or secretion. Soluble IGF-IR has been used to induce apoptosis in tumor cells in vivo and inhibit tumorigenesis in an experimental animal system (D'Ambrosio et al., Cancer Res. 56: 4013-20, 1996). In addition, IGF-IR antisense oligonucleotides, peptide analogues of IGF-I, and antibodies to IGF-IR have been used to decrease IGF-I or IGF-IR expression (see supra). However, none of these agents has been suitable for longer-term administration to human patients. In addition, although IGF-I has been administered to patients for treatment of short stature, osteoporosis, decreased muscle mass, neuropathy or diabetes, the binding of IGF-I to IGFBPs has often made treatment with IGF-I difficult or ineffective. In view of the roles that IGF-I, IGF-II and IGF-IR have in disorders, including cancer and proliferative disorders, such as when IGF-I or IGF-II and/or IGF-IR are over-expressed, and the deficiencies of other therapeutic approaches (e.g., small molecules, siRNA, antisense and antibodies), it would be desirable to generate therapeutics, such as polypeptides of the invention, to the IGF-IR pathway (or various isoforms or mutants of the receptor or its ligands) that could selectively modulate, inhibit or block IGF-IR.
In addition, it would be desirable for such a polypeptide to be expressed in a cost effective manner, possess desirable biophysical properties (e.g., Tm, substantially monomeric, or well folded), small size to penetrate tissues and proper half life or in vivo exposure time in blood over the binding affinity for IGF-IR or other targets.
SUMMARY OF THE INVENTIONOne aspect of the invention relates to novel polypeptides that bind IGF-IR with high affinity. In some embodiments, the polypeptides bind IGF-IR with a disassociation constant of about 1 μM or less, about 10 nM or less, or about 1 nM or less. In some embodiments, the polypeptides bind to the insulin receptor with a disassociation constant of about 1 μM or more. In some embodiments, the polypeptide of the invention inhibits the binding of IGF-I or IGF-II to IGF-IR and does not activate human IGF-IR at sub IC50 concentrations in a cell-based assay with an IC50 of less than about 1 nM or about 100 pM. In some embodiments, the polypeptide of the invention induces apoptosis in a cell based assay in a cell line dependent on IGF-IR activation. In some embodiments, IGF-IR binders block IGF-IR activities such as control of apoptosis, phosphorylation or dimerization.
It will be often desirable, particularly in in vivo applications, that proteins of the invention targeting IGF-IR either as a mono-specific therapeutic or multi-specific (including bi-specific or tri-specific) therapeutics are selective over IGF-IR compared to the insulin receptor. Such selectivity is preferably at least about 100 times, at least about 1000 times, at least about 10,000 times and at least about 100,000 times. In addition, it my be desirable, particularly for proteins with high affinity to IGF-IR to not detectably bind the insulin receptor at a defined concentration or lower of therapeutic or protein, such concentrations are about 100 nM, about 1 uM, or about 10 uM. Selectivity relationships of proteins that bind to IGF-IR over the insulin receptor may also be expressed by comparing Kd, IC50, and Ki's either as measured or calculated depending on the assay; or as a ratio of the same biochemical or biological parameters (e.g., Kd, IC50, and Ki's). Such ratios preferably include ratios of insulin receptor binding or other measurement to IGF-IR binding or other measurement of about 100, about 1,000, about 10,000 or about 100,000. Other proteins of the invention that bind to other targets, particularly tyrosine kinase receptors, preferably are selective for the desired target (e.g., EGFR or Her2) compared to the insulin receptor using the selectivity guidance provided herein.
In some embodiments, the polypeptide comprises a fibronectin-based scaffold protein. In some embodiments, the polypeptide comprising a tenth fibronectin type III (10Fn3) domain, wherein the 10Fn3 domain (i) comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop EF; and a loop FG; (ii) has at least one loop selected from loop BC, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10Fn3 domain, and (iii) binds human IGF-IR with a disassociation constant of about 1 μM or less. In some embodiments, at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids in at least one loop selected from loop BC, DE, and FG are substituted with an amino acid that differs from the wild-type sequence. In some embodiments, at least 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids are deleted or added to at least one loop selected from loop BC, DE, and FG. In some embodiments, loop BC and loop FG have an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10Fn3 domain. In some embodiments, the polypeptide comprises the amino acid sequence of any of one of SEQ ID NOS: 2-125, 184-203, or 226. Substantially monovalent binding to IGF-IR via fibronectin based scaffolds is helpful in reducing IGF-IR activation in this and other embodiments of the invention.
In some embodiments, the polypeptides of the invention further comprise one or more pharmacokinetic (PK) moieties. PK moieties improve one or more pharmacokinetic properties of the polypeptides, e.g., bioavailability, serum half-life, in vivo stability, and drug distribution. In some embodiments, the PK moiety is selected from: a polyoxyalkylene moiety, a human serum albumin binding protein, sialic acid, human serum albumin, transferrin, and Fc or an Fc fragment. In some embodiments, the PK moiety is polyethylene glycol (PEG). In some embodiments, the PEG moiety is covalently linked to the polypeptide of the invention via a Cys or Lys amino acid. In some embodiments, a polypeptide of the invention is linked by at least one peptide bond to a second protein that binds human serum albumin (HSA) with a binding affinity of about 300 nM or less.
In some embodiments, the polypeptides of the invention further comprise a second domain that binds to a human protein. In some embodiments the human protein is selected from EGFR, folate receptor, Her2, Her3, c-kit, c-Met, FGFRI, FGFR2, PDGFR, VEGFR1, VEGFR2, VEGF3, Tie2, Ang1, Ang2, FGF (fibroblast growth factor), EGF (epidermal growth factor), HGF (hepatocyte growth factor), VEGF-A (vascular endothelial growth factor-A), VEGF-C, and VEGF-D. In some embodiments the human protein is IGF-IR. In some embodiments, the human protein is a tyrosine receptor. In some embodiments, the second domain binds to a human protein with a disassociation constant of about μM or less, about 10 nM or less, or about 1 nM or less. In some embodiments, the second domain binds to VEGFR2 with a disassociation constant of about μM or less, about 10 nM or less, or about 1 nM or less and binds to VEGFR1 with a disassociation constant of about μM, 10 μM, or 10 μM, or more.
In some embodiments, the polypeptide comprises a first and second protein, wherein either or both proteins are a single chain antibody and the first and second proteins are linked via a PEG moiety. In some embodiments, the first protein binds IGF-IR.
In some embodiments, the second domain is selected from: an antibody moiety of less than about 50 kDa; a derivative of lipocalin; a derivative of tetranectin; an avimer; a derivative of ankyrin, and a second tenth fibronectin type III (10Fn3) domain, wherein the second 10Fn3 domain comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; and a loop FG; and has at least one loop selected from loop BC, DE, and FG with a randomized amino acid sequence relative to the sequence of the corresponding loop of the human 10Fn3 domain, and binds a human protein, which is not bound by the human 10Fn3 domain, with a disassociation constant of about 10 nM or less. In some embodiments the second domain is a 10Fn3 domain and comprises the amino acid sequence of any of one of SEQ ID NOS: 2-203, or 226. In some embodiments, the polypeptide of the invention and the second domain are operably linked via at least one disulfide bond, a peptide bond, a polypeptide, a polymeric sugar, or a polyethylene glycol (PEG) moiety. In some embodiments, the PEG is between about 0.5 kDa and about 100 kDa.
In some embodiments of the invention, polypeptides of the invention comprise a first and second protein linked via a polypeptide, wherein the first or second protein or polypeptide linker has a protease site that is cleavable by a protease in the blood or target tissue. Such embodiments can be used to release two or more therapeutic proteins for better delivery or therapeutic properties or more efficient production compared to separately producing such proteins.
In some embodiments, a first and second protein are linked using a biocompatible polymer such as a polymeric sugar. Such polymeric sugar can include an enzymatic cleavage site that is cleavable by an enzyme in the blood or target tissue. Such embodiments can be used to release two or more therapeutic proteins for better delivery or therapeutic properties or more efficient production compared to separately producing such proteins.
Another aspect of the invention is the operable linkage of one or more proteins of the invention, or other proteins described herein to make a protein therapeutic of the invention, via a polymer to create multi-functional proteins. For instance the polymer could be a polypeptide, polymeric sugar, carbon based polymer (e.g., aliphatic chain) or PEG. An additional aspect of the invention includes linking a protein of the invention that binds IGF-IR as described herein with PEG to another protein, such as: a Fab, a single chain Ab, domain antibodies, camel antibodies and their derivatives (particularly entities less than about 50 kDa), antibody moiety (e.g., less than about 50 kDa), an Adtein (e.g., a protein between 5 and 40 kDa the binds a target with a desired specificity while having one or more of pharmaceutical or biochemical properties described herein, particularly those related to tyrosine kinase receptors), a fibronectin based scaffold protein (e.g., an Adnectin), or antibody alternatives, such as Avimers, microbodies, Trans-bodies™, Affibodies™, Affilins™, or trinectins (e.g., tetranectins) and other derivatives of proteins like lipocalin, or ankyrin (DARPin). In some embodiments, the first and second linked proteins collectively have 1 or 0 disulfide bonds. This may be desirable to improve protein production in cell based systems. Preferably, said first protein is substantially a single domain that has substantially monovalent binding to IGF-IR. This may be desirable to improve protein production in cell based systems. Preferably, said first protein binds human IGF-IR with an binding affinity of about 100 pM or less and has at least two structural loops that participate in the binding of said first protein to human IGF-IR. Preferably, said second protein is a fibronectin based scaffold protein linked by at least one peptide bond to said first protein. In some embodiments, said first protein and second protein are linked by at least one disulfide bond. Though this can be accomplished in cells in may be desired to perform this linkage in vitro without cells. The polypeptide of the invention may include a first protein that binds human IGF-IR with an binding affinity of about 300 pM or less and has at least two structural loops that participate in the binding of said first protein to human IGF-IR. Preferably, said first protein binds human IGF-IR with an binding affinity of about 1 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater. Preferably, the polypeptide of the invention further comprises a PEG moiety operably linked either said first protein or said second protein. Preferably, said second protein binds a human tyrosine kinase receptor up-regulated in a human cancer, wherein said second protein binds the human tyrosine kinase receptor with an binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater.
In some embodiments, the polypeptide of the invention may comprise a first protein and said second protein that collectively have at least 6 disulfide bonds or, in another aspect, collectively have at least 8 disulfide bonds. Preferably, said first protein and said second protein are a single polypeptide expressed from a microbe. Preferably, said first protein binds human IGF-IR with a binding affinity of about 100 pM or less and has at least two structural loops that participate in the binding of said first protein to human IGF-IR. In some embodiments, at least one of said first protein and said second protein is an antibody moiety. Preferably, such antibody moiety is less than about 50 kDa or, in another aspect, is less than about 40 kDa. In some embodiments, the antibody moiety is a single chain antibody moiety. The protein therapeutic includes an embodiment wherein said second protein binds one of the following human proteins: EGFR, folate receptor, Her2, Her3, c-kit, c-Met, FGFRI, FGFR2, PDGFR, VEGFR1, VEGFR2, VEGF3, and Tie2; and ligands: Ang1, Ang2, FGF, EGF, HGF, stem cell factor (SCF), VEGF-A, VEGF-C, and VEGF-D. In some embodiments, the first protein and/or the second protein are a derivative of lipocalin. In some embodiments, least one of said first protein and said second protein is a derivative of a tetranectin. In some embodiments, at least one of said first protein moiety and said second protein moiety is a derivative of an avimer.
PEG may be used in many aspects of the invention and different sizes may be used as described herein for the desired therapeutic or other in vivo effect, such as imaging. Larger PEGs are preferred to increase half life in the body, blood, non-blood extracellular fluids or tissues. For in vivo cellular activity, PEGs of the range of about 10 to 60 kDa are preferred, as well as PEGs less than about 100 kDa and more preferably less than about 60 kDa, though sizes greater than about 100 kDa can be used as well. For in vivo imaging application, smaller PEGs, generally less than about 20 kDa, may be used that do not increase half life as much as larger PEGs so as to permit quicker distribution and less half life.
In some embodiments, polypeptides of the invention comprise a first protein and second protein operably linked to PEG through a single Cys or Lys. In some embodiments, at least the first or second protein has no more than a single Cys or Lys. In some embodiments, the single Cys or Lys is located in said first or second protein in a non-wildtype location in the amino acid sequence.
In some embodiments, the polypeptide of the invention comprises a first and second protein, wherein said first protein inhibits cell proliferation, has a Tm of at least 55° C., and a non-wildtype Cys or Lys in region of its amino acid sequence that does not substantially interfere with binding to human IGF-IR. In some embodiments, the first protein and second protein are a single polypeptide expressed from a microbe. In some embodiments, the first protein binds human IGF-IR with a binding affinity of about 50 pM or less and has at least two structural loops that participate in the binding of said first protein to human IGF-IR. In some embodiments, the polypeptide of the invention has a half life in in vivo of at least one day with IV administration. In some embodiments, the polypeptide of the invention has an exposure level at a concentration of at least about 10 times the binding affinity of said first protein to human IGF-IR for over 24 hours in a rodent after administration. In some embodiments, the polypeptide of the invention has an exposure level at a concentration of at least about 100 times the binding affinity of said first protein to human IGF-IR for over 24 hours in a rodent after subcutaneous administration. In some embodiments, the first or second protein is a fibronectin based scaffold protein.
A variety of affinities of the polypeptides of the invention to IGF-IR, other human proteins, or PK moieties can be can be used depending on diagnostic, therapeutic, in vitro or in vivo application. For instance, affinities with a disassociation constant similar or less than about 1 uM, about 100 nM, about 10 nM, about 1 nM, about 100 pM, about 10 pM, about 1 pM or about 100 fM are preferred, particularly for IGF-IR. In vivo testing of proteins of the invention with different affinity to the desired target aids in selecting the desired affinity for in vivo applications. In vitro testing depending on the presence of other proteins and amounts of IGF-IR may generally use proteins of the invention of different affinity compared to in vivo applications. Often less affinity or weaker binding can be used in in vitro.
In some embodiments, the polypeptide is an 10Fn3 domain selected by the method comprising the steps of a) producing a population of candidate RNA molecules, each comprising a candidate tenth fibronectin type III (10Fn3) domain sequence which differs from human 10Fn3 domain coding sequence, said RNA molecules each comprising a translation initiation sequence and a start codon operably linked to said candidate 10Fn3 domain coding sequence and each being operably linked to a nucleic acid-puromycin linker at the 3′ end; b) in vitro translating said candidate 10Fn3 domain coding sequences to produce a population of candidate RNA-10Fn3 fusions; c) contacting said population of candidate RNA-Fn3 fusions with IGF-IR; and d) selecting an RNA-10Fn3 fusion, the protein portion of which has a binding affinity or specificity for IGF-IR that is altered relative to the binding affinity or specificity of said human 10Fn3 for IGF-IR.
One aspect of the invention relates to polypeptides comprising fibronectin-based scaffold proteins that bind to a hu methods for the treatment of a subject having a cancer man target. In some embodiments, the polypeptides further comprise PK moieties as described herein. The PK moiety may be linked to the fibronectin-based scaffold protein by any suitable linker, such as those described herein.
An aspect of the invention provides for a polypeptide of the invention capable of inhibiting the growth of a cancer cell by greater than about 80% in the presence of a growth stimulant such as, for example, serum, insulin-like growth factor-I and insulin-like growth factor-II.
A further aspect of the invention provides for pharmaceutically acceptable compositions comprising the polypeptides of the invention, wherein the composition is essentially endotoxin free. Preferably, the composition is substantially free of microbial contamination making it suitable for in vivo administration. The composition may be formulated, for example, for IV, IP or subcutaneous administration.
A further aspect of the invention provides for a cell, comprising a polynucleotide encoding one or more polypeptides of the invention. Vectors containing polynucleotides for such proteins are included as well. Sequences are preferably optimized to maximize expression in the cell type used. Preferably, expression is in E. coli. Proteins of then invention can also be expressed, for example, in eukaryotic microbes, including yeast (e.g., pichia or cervaisea) or blue green algae. Yeast cells can be engineered to produce desired glycosylations on any of the proteins described herein. The cells of the invention can be a mammalian cell. In one aspect, the mammalian cell can be engineered to produce desired glycosylations on any of the proteins described herein. In one aspect, the cell expresses a fibronectin based scaffold protein. In one aspect, the polynucleotides encoding fibronectin based scaffold proteins are codon optimized for expression in the selected cell type.
An aspect of the invention provides by administering a novel polypeptide of the present invention, either alone or in combination with other cytotoxic or therapeutic agents. The cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, or other cancer yet to be determined in which IGF-IR levels are elevated, up-regulated, mutated or altered in physiology compared to non-oncogenic cells.
Another aspect of the invention provides methods for the treatment of a subject having a cancer by administering a polypeptide of the invention, either alone or in combination with other cytotoxic or therapeutic agents. In particular, preferred cytotoxic and therapeutic agents include docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab, capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab, 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab, idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab, tositumomab, interferon alpha-2b, melphalam, bortezomib, altretamine, asparaginase, gefitinib, erlonitib, anti-EGF receptor antibody (e.g., cetuximab or panitumumab), ixabepilone, and an epothilone or derivative thereof. More preferably, the therapeutic agent is a platinum agent (such as carboplatin, oxaliplatin, cisplatin), a taxane (such as paclitaxel, docetaxel), gemcitabine, or camptothecin.
In addition, it may be preferred to combine a polypeptide of the invention with a second therapeutic protein as a single molecule or perhaps as a single molecule with a third therapeutic protein. Such a therapeutic entity comprises a protein of the invention linked by PEG or other polymer (e.g., Cys-Cys disulfide or polypeptide) to one or more therapeutic proteins. Such therapeutic proteins include antibody derivatives (e.g., Fabs, camel antibodies and their derivatives, domain antibodies (e.g., less than about 50 kDa in size) and single chains (preferably less than about 50 kDa in size)), Adnectins™ and proteins preferably in the range of ˜5 to ˜40 kDa.
Targets of proteins of the invention include, particularly human versions, although in some instances model species such as mouse, rat, monkey and dog: IGF-IR, FGFR1, FGFR2, FGFR3, FGFR4, c-Kit, human p185 receptor-like tyrosine kinase (HER2 or Her2), Her3, c-Met, folate receptor, PDGFR, VEGFR1, VEGFR2, VEGFR3, human vascular endothelial growth factor (VEGF) A, VEGF C, VEGF D, human CD20, human CD18, human CD11a, human apoptosis receptor-2 (Apo-2), human .alpha.4.beta.7 integrin, human GPIIb-IIIa integrin, stem cell factor (SCF), human epidermal growth factor receptor (EGFR), and human CD3. In addition, aspects of the invention include multifunctional proteins that bind a first target and at least one other target. Preferably, such proteins are linked by the PEG related inventions described herein, although in many embodiments such proteins may be linked by polypeptides or other polymeric linkers or non-polymeric linkers.
Stably linked proteins of the invention may be of use for therapeutic treatment of cancer. Multispecific proteins of the invention have the advantage of modulating, blocking or inhibiting more than one therapeutic target when directed to 2, 3, 4 or more therapeutic targets or epitopes.
It is anticipated that any type of tumor and any type of tumor antigen may be targeted with the corresponding biology of the therapeutic. The cancer can be one or more of, for example, breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma, or other cancer yet to be determined in which IGF-IR levels are elevated, up-regulated, mutated or altered in physiology compared to non-oncogenic cells.
Other exemplary types of tumors that may be targeted include acute lymphoblastic leukemia, acute myelogenous leukemia, biliary cancer, breast cancer, cervical cancer, chronic lymphocytic leukemia, chronic myelogenous leukemia, colorectal cancer, endometrial cancer, esophageal, gastric, head and neck cancer, Hodgkin's lymphoma, lung cancer, medullary thyroid cancer, non-Hodgkin's lymphoma, multiple myeloma, renal cancer, ovarian cancer, pancreatic cancer, glioma, melanoma, liver cancer, prostate cancer, and urinary bladder cancer.
Additionally, tumor-associated targets may be targeted by polypeptides of the invention. In some embodiments antigen targeting will help localize the therapeutic in terms of tissue distribution or increased local concentration affect either in the tissue or desired cell type. Alternatively, it may provide an additional mechanism of action to combat cancer along with one of the targets described herein for which a therapeutic is made. Such antigens or targets include, but are not limited to, carbonic anhydrase IX, A3, antigen specific for A33 antibody, BrE3-antigen, CD1, CD1a, CD3, CD5, CD15, CD16, CD19, CD20, CD21, CD22, CD23, CD25, CD30, CD45, CD74, CD79a, CD80, HLA-DR, NCA 95, NCA90, HCG and its subunits, CEA (CEACAM-5), CEACAM-6, CSAp, EGFR, EGP-1, EGP-2, Ep-CAM, Ba 733, HER2/neu, hypoxia inducible factor (HIF), KC4-antigen, KS-1-antigen, KS1-4, Le-Y, macrophage inhibition factor (MIF), MAGE, MUC1, MUC2, MUC3, MUC4, PAM-4-antigen, PSA, PSMA, RS5, S100, TAG-72, p53, tenascin, IL-6, IL-8, insulin growth factor-I (IGF-I), insulin growth factor-II (IGF-II), Tn antigen, Thomson-Friedenreich antigens, tumor necrosis antigens, placenta growth factor (P1GF), 17-1A-antigen, an angiogenesis marker (e.g., ED-B fibronectin), an oncogene marker, an oncogene product, and other tumor-associated antigens. Recent reports on tumor associated antigens include Mizukami et al., (2005, Nature Med. 11:992-97); Hatfield et al., (2005, Curr. Cancer Drug Targets 5:229-48); Vallbohmer et al. (2005, J. Clin. Oncol. 23:3536-44); and Ren et al. (2005, Ann. Surg. 242:55-63), each incorporated herein by reference.
In other embodiments, an anti-angiogenic agent may form a portion of a therapeutic and may be operably linked to a protein of the invention. Exemplary anti-angiogenic agents of use include angiostatin, baculostatin, canstatin, maspin, anti-VEGF antibodies or peptides, anti-placental growth factor antibodies or peptides, anti-Flk-1 antibodies, anti-Flt-1 antibodies or peptides, laminin peptides, fibronectin peptides, plasminogen activator inhibitors, tissue metalloproteinase inhibitors, interferons, interleukin 12, IP-10, Gro-.beta., thrombospondin, 2-methoxyoestradiol, proliferin-related protein, carboxiamidotriazole, CM101, Marimastat, pentosan polysulphate, angiopoietin 2, interferon-alpha, herbimycin A, PNU145156E, 16K prolactin fragment, Linomide, thalidomide, pentoxifylline, genistein, TNP-470, endostatin, paclitaxel, accutin, angiostatin, cidofovir, vincristine, bleomycin, AGM-1470, platelet factor 4 or minocycline.
Another aspect of the invention provides kits comprising one or more of the elements described herein, and instructions for the use of those elements. In a preferred embodiment, a kit of the present invention includes a protein of the invention, alone or with a second therapeutic agent. The instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using a protein of the invention, alone or with a second therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the same.
Another aspect of the invention provides a protein based composition of matter, comprising a first protein that specifically binds human IGF-IR; wherein said first protein is between about 4 kD and about 40 kD in MW, has less than about 30 percent amino acid identity to human IGF I or IGF II and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the composition of matter further comprises a PK moiety, such as PEG or a protein that binds human serum albumin. In some embodiments, the first protein has a disassociation constant of about 1 nM or less for human IGF-IR. In some embodiments, the composition of matter blocks the binding of IGF-I or IGF-II to IGF-IR.
Another aspect of the invention provides a protein based composition of matter, comprising a first protein that binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater; wherein said first protein is substantially a single domain that has substantially monovalent binding with respect to human IGF-IR, and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the composition of matter further comprises a second protein linked by a peptide bond to said first protein, wherein said second protein binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater. In some embodiments, the composition of matter further comprises a second protein linked by at least one peptide bond to said first protein, wherein said second protein binds human serum albumin with a binding affinity of about 300 nM or less. In some embodiments, the composition of matter further comprises a second protein linked by PEG to said first protein, wherein said second protein binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater. In some embodiments, the first or second protein comprises a fibronectin-based scaffold protein.
Another aspect of the invention provides a PEG based composition of matter, comprising a first PEG linked to a first protein that binds human IGF-IR with a binding affinity of about 100 nM and a second protein that binds a human protein; wherein said PEG is between about 0.5 kD and about 100 kD, and said composition of matter is substantially free of free PEG and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the second protein binds at least one human tyrosine receptor or at least one human tyrosine receptor ligand with an binding affinity of about 1 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater. In some embodiments, one or both proteins is a fibronectin-based scaffold protein.
Another aspect of the invention provides a protein based composition of matter, comprising a first protein that binds human IGF-IR operably linked to a second protein that binds a human protein; wherein said first protein binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the protein based composition of matter, further comprising a PEG moiety operably linked either said first protein or said second protein. In some embodiments, the second protein binds a human tyrosine kinase receptor up-regulated in a human cancer, wherein said second protein binds the human tyrosine kinase receptor with an binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater.
Another aspect of the invention provides a protein therapeutic, comprising a first protein moiety that binds human IGF-IR operably linked to a second protein moiety that binds a human therapeutic target; wherein said first protein binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration; and further wherein said second protein binds the human therapeutic target with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the first protein and second protein are a single polypeptide expressed from a microbe.
Another aspect of the invention provides a protein therapeutic, comprising a first protein moiety that binds human IGF-IR operably linked to a PEG that is operable linked to a second protein moiety that binds a human therapeutic target; wherein said first protein moiety binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration; and further wherein said second protein moiety binds the human therapeutic target with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the first protein moiety and second protein moiety collectively have at least 6 disulfide bonds.
Another aspect of the invention provides a protein therapeutic, comprising a first protein moiety that binds human IGF-IR operably linked to a PEG that is operable linked to a second protein moiety that binds a human therapeutic target; wherein said first protein moiety binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater and binding with respect to human IGF-IR is substantially monovalent, and is substantially free of microbial contamination making it suitable for in vivo administration; and further wherein said second protein moiety binds the human therapeutic target with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater and binding with respect to human IGF-IR, and is substantially free of microbial contamination making it suitable for in vivo administration.
Another aspect of the invention provides a protein therapeutic, comprising a first protein moiety that binds human IGF-IR operably linked to a biocompatible polymer that is operable linked to a second protein moiety that binds a human therapeutic target; wherein said first protein moiety binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration; further wherein said second protein moiety binds the human therapeutic target with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration; and further wherein said first protein moiety and second protein moiety have affinities for their respective targets that are optimized to minimize non-therapeutic affects and to maximize therapeutic benefit of binding to more than one therapeutic target. In some embodiments, the polypeptide has a protease site that is cleavable by a protease in the blood or target tissue.
Another aspect of the invention provides a protein therapeutic, comprising a first protein that binds human IGF-IR operably linked to a PEG that is operable linked to a second protein that binds a human protein; wherein said first protein binds human IGF-IR with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater and is antagonist of human IGF-IR, and is substantially free of microbial contamination making it suitable for in vivo administration; and further wherein said second protein binds the human therapeutic target with a binding affinity of about 10 nM or less and binds human insulin receptor with a binding affinity of about 1 uM or greater, and is substantially free of microbial contamination making it suitable for in vivo administration. In some embodiments, the first protein inhibits cell proliferation, has a Tm of at least 55C, and non-wildtype cys or lys in region of its amino acid sequence that does not substantially interfere with binding to human IGF-IR. In some embodiments, the protein therapeutic has a half life in in vivo of at least one day with IV administration. In some embodiments, the protein therapeutic has an exposure level at a concentration of at least about 10 times the binding affinity of said first protein to human IGF-IR for over 24 hours in a rodent after administration. In some embodiments, the first and/or second protein is a fibronectin based scaffold.
Another aspect of the invention provides a cell, comprising a polynucleotide encoding one or more protein described herein. In some embodiments, the cell is a yeast engineered to produce desired glycosylations on any of the proteins described herein. In some embodiments, the cell is blue green algae. In some embodiments, the cell is a mammalian cell engineered to produce desired glycosylations on any of the proteins described herein. In some embodiments, the protein is a fibronectin based scaffold and optionally has a polynucleotide codon optimized for expression in a cell.
The methodology described herein has been successfully used to develop proteins of the invention, that include but are not limited to, single domain IGF-IR binding polypeptides derived from at least two related groups of protein structures: those proteins having an immunoglobulin fold and those proteins having an immunoglobulin-like fold.
By a “polypeptide” is meant any sequence of two or more amino acids, regardless of length, post-translation modification, or function. “Polypeptide,” “peptide,” and “protein” are used interchangeably herein. Polypeptides can include natural amino acids and non-natural amino acids such as those described in U.S. Pat. No. 6,559,126, incorporated herein by reference. Polypeptides can also be modified in any of a variety of standard chemical ways (e.g., an amino acid can be modified with a protecting group; the carboxy-terminal amino acid can be made into a terminal amide group; the amino-terminal residue can be modified with groups to, e.g., enhance lipophilicity; or the polypeptide can be chemically glycosylated or otherwise modified to increase stability or in vivo half-life). Polypeptide modifications can include the attachment of another structure such as a cyclic compound or other molecule to the polypeptide and can also include polypeptides that contain one or more amino acids in an altered configuration (i.e., R or S; or, L or D). The term “single domain polypeptide” is used to indicate that the target binding activity (e.g., IGF-IR binding activity) of the subject polypeptide is situated within a single structural domain, as differentiated from, for example, antibodies and single chain antibodies, where antigen binding activity is generally contributed by both a heavy chain variable domain and a light chain variable domain. It is contemplated that a plurality of single domain polypeptides of the sort disclosed herein could be connected to create a composite molecule with increased avidity. Likewise, a single domain polypeptide may be attached (e.g., as a fusion protein) to any number of other polypeptides, such as fluorescent polypeptides, targeting polypeptides and polypeptides having a distinct therapeutic effect.
The term “PK” is an acronym for “pharmokinetic” and encompasses properties of a compound including, by way of example, absorption, distribution, metabolism, and elimination by a subject. A “PK modulation protein” or “PK moiety” refers to any protein, peptide, or moiety that affects the pharmokinetic properties of a biologically active molecule when fused to or administered together with the biologically active molecule. Examples of a PK modulation protein or PK moiety include PEG, human serum albumin (HSA) binders (as disclosed in U.S. Publication Nos. 20050287153 and 20070003549), human serum albumin, Fc or Fc fragments, and sugars (e.g., sialic acid).
Single domain polypeptides of either the immunoglobulin or immunoglobulin-like scaffold will tend to share certain structural features. For example, the polypeptide may comprise between about 80 and about 150 amino acids, which amino acids are structurally organized into a set of beta or beta-like strands, forming beta sheets, where the beta or beta-like strands are connected by intervening loop portions. Examples of the structural organization for the heavy chain variable domain and the 10Fn3 domain are shown in
Scaffolds for formation of a single domain polypeptides should be highly soluble and stable in physiological conditions. Examples of immunoglobulin scaffolds are the single domain VH or VL scaffold, as well as a single domain camelid VHH domain (a form of variable heavy domain found in camelids) or other immunoglobulin variable domains found in nature or engineered in the laboratory. In the single domain format disclosed herein, an immunoglobulin polypeptide need not form a dimer with a second polypeptide in order to achieve binding activity. Accordingly, any such polypeptides that naturally contain a cysteine which mediates disulfide cross-linking to a second protein can be altered to eliminate the cysteine. Alternatively, the cysteine may be retained for use in conjugating additional moieties, such as PEG, to the single domain polypeptide.
Other scaffolds may be non-antibody scaffold proteins. By “non-antibody scaffold protein or domain” is meant a non-antibody polypeptide having an immunoglobulin-like fold. By “immunoglobulin-like fold” is meant a protein domain of between about 80-150 amino acid residues that includes two layers of antiparallel beta-sheets, and in which the flat, hydrophobic faces of the two beta-sheets are packed against each other. An example of such a scaffold is the “fibronectin-based scaffold protein”, by which is meant a polypeptide based on a fibronectin type III domain (Fn3). An example of fibronectin-based scaffold proteins are Adnectins™ (Adnexus Therapeutics, Inc.). Fibronectin is a large protein which plays essential roles in the formation of extracellular matrix and cell-cell interactions; it consists of many repeats of three types (types I, II, and III) of small domains (Baron et al., 1991). Fn3 itself is the paradigm of a large subfamily which includes portions of cell adhesion molecules, cell surface hormone and cytokine receptors, chaperoning, and carbohydrate-binding domains. For reviews see Bork & Doolittle, Proc Natl Acad Sci USA. 1992 Oct. 1; 89(19):8990-4; Bork et al., J Mol Biol. 1994 Sep. 30; 242(4):309-20; Campbell & Spitzfaden, Structure. 1994 May 15; 2(5):333-7; Harpez & Chothia, J Mol Biol. 1994 May 13; 238(4):528-39).
Preferably, the fibronectin-based scaffold protein is a “10Fn3” scaffold, by which is meant a polypeptide variant based on the tenth module of the human fibronectin type III protein in which one or more of the solvent accessible loops has been randomized or mutated, particularly one or more of the three loops identified as the BC loop (amino acids 23-30), DE loop (amino acids 52-56) and FG loop (amino acids 77-87) (the numbering scheme is based on the sequence on the wild-type tenth module of the human fibronectin type III domain: VSDVPRDLEVVAATPTSLLISWDAPAVTVRYYRITYGETGGNSPVQEFTVPGSKSTAT ISGLKPGVDYTITVYAVTGRGDSPASSKPISINYRT (SEQ ID NO:1). Preferably, fibronectin-based scaffold proteins are based on SEQ ID NO:1.
A variety of mutant 10Fn3 scaffolds have been reported. In one aspect, one or more of Asp 7, Glu 9, and Asp 23 is replaced by another amino acid, such as, for example, a non-negatively charged amino acid residue (e.g., Asn, Lys, etc.). These mutations have been reported to have the effect of promoting greater stability of the mutant 10Fn3 at neutral pH as compared to the wild-type form (See, PCT Publication No. WO02/04523). A variety of additional alterations in the 10Fn3 scaffold that are either beneficial or neutral have been disclosed. See, for example, Batori et al., Protein Eng. 2002 December; 15(12):1015-20; Koide et al., Biochemistry 2001 Aug. 28; 40(34):10326-33.
Both variant and wild-type 10Fn3 proteins are characterized by the same structure, namely seven beta-strand domain sequences designated A through G and six loop regions (AB loop, BC loop, CD loop, DE loop, EF loop, and FG loop) which connect the seven beta-strand domain sequences. The beta strands positioned closest to the N- and C-termini may adopt a beta-like conformation in solution. In SEQ ID NO:1, the AB loop corresponds to residues 15-16, the BC loop corresponds to residues 22-30, the CD loop corresponds to residues 39-45, the DE loop corresponds to residues 51-55, the EF loop corresponds to residues 60-66, and the FG loop corresponds to residues 76-87. As shown in
A single domain polypeptide disclosed herein may have at least five to seven beta or beta-like strands distributed between at least two beta sheets, and at least one loop portion connecting two beta or beta-like strands, which loop portion participates in binding to IGF-IR, with the binding characterized by a dissociation constant that is less than 1×10−6M, and preferably less than 1×10−8M. As described herein, polypeptides having a dissociation constant of less than 5×10−9M are particularly desirable for therapeutic use in vivo to inhibit ligand signaling. Polypeptides having a dissociation constant of between 1×10−6M and 5×10−9M may be desirable for use in detecting or labeling, ex vivo or in vivo, IGF-IR proteins.
Optionally, the “IGF-IR binding protein” will bind specifically to IGF-IR relative to other related proteins from the same species. By “specifically binds” is meant a polypeptide that recognizes and interacts with a target protein (e.g., IGF-IR) but that does not substantially recognize and interact with other molecules in a sample, for example, a biological sample. In preferred embodiments a polypeptide of the invention will specifically bind a IGF-IR with a KD at least as tight as 500 nM. Preferably, the polypeptide will specifically bind a IGF-IR with a KD of 1 pM to 500 nM, more preferably 1 pM to 100 nM, more preferably 1 pM to 10 nM, and most preferably 1 pM to 1 nM or lower.
A “functional Fc region” possesses at least one “effector function” of a native sequence Fc region. Exemplary “effector functions” include C1q binding; complement dependent cytotoxicity (CDC); Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; down regulation of cell surface receptors (e.g., B cell receptor; BCR), etc. Such effector functions generally require the Fc region to be combined with a binding domain (e.g., an antibody variable domain) and can be assessed using various assays known in the art for evaluating such antibody effector functions.
A “native sequence Fc region” comprises an amino acid sequence identical to the amino acid sequence of an Fc region found in nature.
A “variant Fc region” comprises an amino acid sequence which differs from that of a native sequence Fc region by virtue of at least one amino acid modification. Preferably, the variant Fc region has at least one amino acid substitution compared to a native sequence Fc region or to the Fc region of a parent polypeptide, e.g., from about one to about ten amino acid substitutions, and preferably from about one to about five amino acid substitutions in a native sequence Fc region or in the Fc region of the parent polypeptide. The variant Fc region herein will preferably possess at least about 80% sequence identity with a native sequence Fc region and/or with an Fc region of a parent polypeptide, and most preferably at least about 90% sequence identity therewith, more preferably at least about 95% sequence identity therewith.
“Antibody-dependent cell-mediated cytotoxicity” and “ADCC” refer to a cell-mediated reaction in which nonspecific cytotoxic cells that express Fc receptors (FcRs) (e.g., Natural Killer (NK) cells, neutrophils, and macrophages) recognize bound antibody on a target cell and subsequently cause lysis of the target cell. The primary cells for mediating ADCC, NK cells, express FcγRIII only, whereas monocytes express FcγRI, FcγRII and FcγRIII FcR expression on hematopoietic cells is summarized in Table 3 on page 464 of Ravetch and Kinet, Annu. Rev. Immunol 9:457-92 (1991). To assess ADCC activity of a molecule of interest, an in vitro ADCC assay, such as that described in U.S. Pat. Nos. 5,500,362 or 5,821,337 may be performed. Useful effector cells for such assays include peripheral blood mononuclear cells (PBMC) and Natural Killer (NK) cells. Alternatively, or additionally, ADCC activity of the molecule of interest may be assessed in vivo, e.g., in a animal model such as that disclosed in Clynes et al. PNAS (USA) 95:652-656 (1998).
“Percent (%) amino acid sequence identity” herein is defined as the percentage of amino acid residues in a candidate sequence that are identical with the amino acid residues in a selected sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, and not considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be achieved in various ways that are within the skill in the art, for instance, using publicly available computer software such as BLAST, BLAST-2, ALIGN, ALIGN-2 or Megalign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms needed to achieve maximal alignment over the full-length of the sequences being compared. For purposes herein, however, % amino acid sequence identity values are obtained as described below by using the sequence comparison computer program ALIGN-2. The ALIGN-2 sequence comparison computer program was authored by Genentech, Inc. has been filed with user documentation in the U.S. Copyright Office, Washington D.C., 20559, where it is registered under U.S. Copyright Registration No. TXU510087, and is publicly available through Genentech, Inc., South San Francisco, Calif. The ALIGN-2 program should be compiled for use on a UNIX operating system, preferably digital UNIX V4.0D. All sequence comparison parameters are set by the ALIGN-2 program and do not vary.
For purposes herein, the % amino acid sequence identity of a given amino acid sequence A to, with, or against a given amino acid sequence B (which can alternatively be phrased as a given amino acid sequence A that has or comprises a certain % amino acid sequence identity to, with, or against a given amino acid sequence B) is calculated as follows: 100 times the fraction X/Y where X is the number of amino acid residues scored as identical matches by the sequence alignment program ALIGN-2 in that program's alignment of A and B, and where Y is the total number of amino acid residues in B. It will be appreciated that where the length of amino acid sequence A is not equal to the length of amino acid sequence B, the % amino acid sequence identity of A to B will not equal the % amino acid sequence identity of B to A.
A “polypeptide chain” is a polypeptide wherein each of the domains thereof is joined to other domain(s) by peptide bond(s), as opposed to non-covalent interactions or disulfide bonds.
An “isolated” polypeptide is one that has been identified and separated and/or recovered from a component of its natural environment. Contaminant components of its natural environment are materials that would interfere with diagnostic or therapeutic uses for the polypeptide, and may include enzymes, hormones, and other proteinaceous or nonproteinaceous solutes. In preferred embodiments, the polypeptide will be purified (1) to greater than 95% by weight of polypeptide as determined by the Lowry method, and most preferably more than 99% by weight, (2) to a degree sufficient to obtain at least 15 residues of N-terminal or internal amino acid sequence by use of a spinning cup sequenator, or (3) to homogeneity by SDS-PAGE under reducing or nonreducing conditions using Coomassie blue or, preferably, silver stain. Isolated polypeptide includes the polypeptide in situ within recombinant cells since at least one component of the polypeptide's natural environment will not be present. Ordinarily, however, isolated polypeptide will be prepared by at least one purification step.
Targets may also be fragments of said targets. Thus a target is also a fragment of said target, capable of eliciting an immune response. A target is also a fragment of said target, capable of binding to a single domain antibody raised against the full length target.
A fragment as used herein refers to less than 100% of the sequence (e.g., 99%, 90%, 80%, 70%, 60%, 50%, 40%, 30%, 20%, 10% etc.), but comprising 5, 6, 7, 8, 9, 10, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25 or more amino acids. A fragment is of sufficient length such that the interaction of interest is maintained with affinity of 1.times.10.sup.-6M or better.
A fragment as used herein also refers to optional insertions, deletions and substitutions of one or more amino acids which do not substantially alter the ability of the target to bind to a single domain antibody raised against the wild-type target. The number of amino acid insertions deletions or substitutions is preferably up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, 60, 61, 62, 63, 64, 65, 66, 67, 68, 69 or 70 amino acids.
A protein of the invention that “induces cell death” is one which causes a viable cell to become nonviable. The cell is generally one which expresses the antigen to which the protein binds, especially where the cell overexpresses the antigen. Preferably, the cell is a cancer cell, e.g., a breast, ovarian, stomach, endometrial, salivary gland, lung, kidney, colon, thyroid, pancreatic or bladder cell. In vitro, the cell may be, for example, a SKBR3, BT474, Calu 3, MDA-MB453, MDA-MB-361 or SKOV3 cell. Cell death in vitro may be determined in the absence of complement and immune effector cells to distinguish cell death induced by antibody dependent cell-mediated cytotoxicity (ADCC) or complement dependent cytotoxicity (CDC). Thus, the assay for cell death may be performed using heat inactivated serum (i.e., in the absence of complement) and in the absence of immune effector cells. To determine whether the protein of the invention is able to induce cell death, loss of membrane integrity as evaluated by uptake of propidium iodide (PI), trypan blue (see Moore et al. Cytotechnology 17:1-11 (1995)) or 7AAD can be assessed relative to untreated cells.
A protein of the invention that “induces apoptosis” is one that induces programmed cell death as determined by binding of apoptosis related molecules or events, such as annexin V, fragmentation of DNA, cell shrinkage, dilation of endoplasmic reticulum, cell fragmentation, and/or formation of membrane vesicles (called apoptotic bodies). The cell is one which expresses the antigen to which the protein binds and may be one which overexpresses the antigen. The cell may be a tumor cell, e.g. a breast, ovarian, stomach, endometrial, salivary gland, lung, kidney, colon, thyroid, pancreatic or bladder cell. In vitro, the cell may be, for example, SKBR3, BT474, Calu 3 cell, MDA-MB453, MDA-MB-361 or SKOV3 cell. Various methods are available for evaluating the cellular events associated with apoptosis. For example, phosphatidyl serine (PS) translocation can be measured by annexin binding; DNA fragmentation can be evaluated through DNA laddering as disclosed in the example herein; and nuclear/chromatin condensation along with DNA fragmentation can be evaluated by any increase in hypodiploid cells. Preferably, the protein that induces apoptosis is one which results in about 2 to 50 fold, preferably about 5 to 50 fold, and most preferably about 10 to 50 fold, induction of annexin binding relative to untreated cell in an annexin binding assay using cells expressing the antigen to which the protein of the invention binds.
The term “therapeutically effective amount” refers to an amount of a drug effective to treat a disease or disorder in a mammal. In the case of cancer, the therapeutically effective amount of the drug may reduce the number of cancer cells; reduce the tumor size; inhibit (i.e., slow to some extent and preferably stop) cancer cell infiltration into peripheral organs; inhibit (i.e., slow to some extent and preferably stop) tumor metastasis; inhibit, to some extent, tumor growth; and/or relieve to some extent one or more of the symptoms associated with the disorder. To the extent the drug may prevent growth and/or kill existing cancer cells, it may be cytostatic and/or cytotoxic. For cancer therapy, efficacy in vivo can, for example, be measured by assessing the time to disease progression (TTP) and/or determining the response rates (RR).
OverviewThe present inventors have invented novel proteins of the invention that bind IGF-IR with advantageous properties, including, but not limited to: monovalent or multivalent binding modes (e.g., one or more than one domains that bind a particular target (including IGF-IR and other tyrosine kinase receptors); high selectivity for the desired target over other receptors, particularly with respect to proteins binding IGF-IR selectively over the insulin receptor; tunable affinity, including a range from about 100 nM to less than about 10 pM (including femtomolar affinity); specific antagonist activity while having minimal or undetectable agonist activity; blocking of IGF-I or IGF-II binding or activation; monospecific or multispecific binding to desired targets; single or multiple epitope binding; prolonged serum half life in rat; sub-cutaneous (SC) or intravenous (IV) dosing; small size (e.g. ˜5 kDa to ˜40 kDa); Tm's over about 55° C. or over about 60° C.; and substantially monomeric nature (e.g. single peak on size exclusion chromatography (SEC), such as about 90% of the area, about 95% of the area or about 98% of the area).
Making and Testing of Novel Proteins by the TrillionsAs one aspect of the invention, an estimated 1-5 trillion different protein variants were made, along with 1-5 trillion RNA and DNA variants corresponding to such proteins and encoding such proteins. The proteins that were made were tested for binding to human IGF-IR, and in some instances were further expressed and purified and subjected to a variety of biological, biochemical and biophysical assays and measurements to assist in identifying suitable useful proteins, particularly therapeutics.
In addition, over 5000 protein variants were expressed in E. coli, using examples of vectors and polynucleotides of the invention, and tested for expression levels and a variety of biological, biochemical and biophysical assays. Depending on the results of these measurements different, selected proteins were advanced to make further optimized variations with characteristics described herein. Many such proteins were also tested for selectivity with respect the insulin receptor.
The inventors were the first to apply this type of extensive assessment of protein and domain binding to IGF-IR. One way to rapidly make and test proteins of the invention for this type of assessment is the nucleic acid-protein fusion technology of Adnexus Therapeutics, Inc. This disclosure describes the use of such in vitro expression and tagging technology, termed PROfusion™, that exploits nucleic acid-protein fusions (RNA- and DNA-protein fusions) to identify novel single and multiple domain polypeptides and amino acid motifs that are important for binding to IGF-IR and other protein including tyrosine kinase receptors. Nucleic acid-protein fusion technology is a technology that covalently couples a protein to its encoding genetic information. PROfusion™ technology was used to screen collections of nucleic acids encoding single domain polypeptides constructed using a scaffold based on the human fibronectin type three domain (10Fn3) or constructed from the variable domains of antibody light chains. The expressed polypeptides, termed a “library” of scaffold proteins, were screened for polypeptides that could bind a target with high affinity. We isolated from this library of scaffold proteins novel single domain polypeptides that bind to IGF-IR and that inhibit IGF-IR biological activities. Furthermore, it was discovered that many independently randomized loops situated in immunoglobulin or immunoglobulin-like scaffolds tended to converge to a related set of consensus sequences that participated in IGF-IR binding. Therefore, it is expected that polypeptides having these consensus sequences will be useful as IGF-IR binding agents even when separated from the protein context in which they were identified. See, for example, examples and tables herein. Such polypeptides may be used as independent, small peptide IGF-IR binding agents or may be situated in other proteins, particularly proteins that share an immunoglobulin or immunoglobulin-like fold. (For a detailed description of the RNA-protein fusion technology and fibronectin-based scaffold protein library screening methods see Szostak et al., U.S. Pat. Nos. 6,258,558; 6,261,804; 6,214,553; 6,281,344; 6,207,446; 6,518,018; PCT Publication Nos. WO00/34784; WO01/64942; WO02/032925; and Roberts and Szostak, Proc Natl. Acad. Sci. 94:12297-12302, 1997, herein incorporated by reference.)
As discussed above, the present disclosure demonstrates that single domain polypeptides having certain desirable properties, such as high affinity binding to IGF-IR, antagonist effects with respect to one or more of ligands of such receptor and improved pharmacokinetics, can be used as effective anti-cancer agents. While it is expected that the effectiveness of such polypeptides as anti-cancer agents is related to the role of IGF ligand and receptors in cancer, we do not wish to be bound to any particular mechanism.
To our knowledge, the present disclosure represents the first successful effort to use an Fn3-based polypeptide designed to achieve a therapeutic effect in vitro and in vivo for IGF-IR. Many of the improvements and discoveries made in achieving in vivo effectiveness will be broadly applicable to other Fn3-based polypeptides to this and other targets and other protein moieties and domains, generally proteins less than about 50 kDa or about 40 kDa. In other words, although ligand binding properties of an Fn3-based polypeptide will generally be determined by a relatively small number of amino acids situated in solvent accessible loop regions, other features, such as pharmacokinetic features, of Fn3-based polypeptides will tend to be determined by the majority of the protein that is not directly involved in ligand binding and that is conserved from protein to protein regardless of the target protein. This has been the case with antibodies, where a few loops, called CDR regions, mediate antigen binding, while other features of in vivo antibody behavior are largely dictated by the conserved framework regions and constant domains.
Additional Protein EmbodimentsProteins of the invention include a single domain polypeptide described herein which is generally a polypeptide that binds to a target, such as IGF-IR, and where target binding activity situated within a single structural domain, as differentiated from, for example, antibodies and single chain antibodies, where antigen binding activity is generally contributed by both a heavy chain variable domain and a light chain variable domain. The disclosure also provides larger proteins that may comprise single domain polypeptides that bind to target. For example, a plurality of single domain polypeptides may be connected to create a composite molecule with increased avidity or multivalency. Likewise, a single domain polypeptide may be attached (e.g., as a fusion protein) to any number of other polypeptides. In certain aspects a single domain polypeptide may comprise at least five to seven beta or beta-like strands distributed among at least two beta sheets, as exemplified by immunoglobulin and immunoglobulin-like domains. A beta-like strand is a string of amino acids that participates in the stabilization of a single domain polypeptide but does not necessarily adopt a beta strand conformation. Whether a beta-like strand participates in the stabilization of the protein may be assessed by deleting the string or altering the sequence of the string and analyzing whether protein stability is diminished. Stability may be assessed by, for example, thermal denaturation and renaturation studies. Preferably, a single domain polypeptide will include no more than two beta-like strands. A beta-like strand will not usually adopt an alpha-helical conformation but may adopt a random coil structure. In the context of an immunoglobulin domain or an immunoglobulin-like domain, a beta-like strand will most often occur at the position in the structure that would otherwise be occupied by the most N-terminal beta strand or the most C-terminal beta strand. An amino acid string which, if situated in the interior of a protein sequence would normally form a beta strand, may, when situated at a position closer to an N- or C-terminus, adopt a conformation that is not clearly a beta strand and is referred to herein as a beta-like strand.
In certain embodiments, the disclosure provides single domain polypeptides that bind to IGF-IR. Preferably the single domain polypeptides bind to human IGF-IR and a model species IGF-IR. A single domain polypeptide may comprise between about 80 and about 150 amino acids that have a structural organization comprising: at least seven beta strands or beta-like strands distributed between at least two beta sheets, and at least one loop portion connecting two beta strands or beta-like strands, which loop portion participates in binding to IGF-IR. In other words a loop portion may link two beta strands, two beta-like strands or one beta strand and one beta-like strand. Typically, one or more of the loop portions will participate in IGF-IR binding, although it is possible that one or more of the beta or beta-like strand portions will also participate in IGF-IR binding, particularly those beta or beta-like strand portions that are situated closest to the loop portions. A single domain polypeptide may comprise a structural unit that is an immunoglobulin domain or an immunoglobulin-like domain. A single domain polypeptide may bind to any part of IGF-IR, although polypeptides that bind to an extracellular domain of a IGF-IR are preferred. Binding may be assessed in terms of equilibrium constants (e.g., dissociation, KD) and in terms of kinetic constants (e.g., on rate constant, kon and off rate constant, koff). A single domain polypeptide will typically be selected to bind to IGF-IR with a KD of less than about 10−6M, or less than about 10−7M, about 5×10−8M, about 10−8M or less than about 10−9M. IGF-IR binding polypeptides may compete for binding with one, or two or more members of the IGF family, particularly IGF-I and IGF-II, and may inhibit one or more IGF-IR-mediated biological events, such as proliferation of cancer cells and cancer metastasis. IGF-IR binding polypeptides may be used for therapeutic purposes as well as for any purpose involving the detection or binding of IGF-IR. Polypeptides for therapeutic use will generally have a KD of less than 5×10−8M, less than 10−8M or less than 10−9M, although higher KD values may be tolerated where the koff is sufficiently low or the kon is sufficiently high. In certain embodiments, a single domain polypeptide that binds to IGF-IR will comprise a consensus or one or more sequences of the IGF-IR binding sequences selected from the IGF-IR binding clones described herein. Preferably, such sequence will be situated in a loop, particularly the BC, DE, and FG loops as described in PCT Publication No. WO2005/056764A2 by Chen et al.
In certain embodiments, the single domain polypeptide comprises an immunoglobulin (Ig) variable domain. The Ig variable domain may, for example, be selected from the group consisting of: a human VL domain, a human VH domain and a camelid VHH domain. One, two, three or more loops of the Ig variable domain may participate in binding to IGF-IR, and typically any of the loops known as CDR1, CDR2 or CDR3 will participate in IGF-IR binding.
In certain embodiments, the single domain polypeptide comprises an immunoglobulin-like domain. One, two, three or more loops of the immunoglobulin-like domain may participate in binding to IGF-IR. A preferred immunoglobulin-like domain is a fibronectin type III (Fn3) domain. Such domain may comprise, in order from N-terminus to C-terminus, a beta or beta-like strand, A; a loop, AB; a beta or beta-like strand, B; a loop, BC; a beta or beta-like strand C; a loop CD; a beta or beta-like strand D; a loop DE; a beta or beta-like strand, E; a loop, EF; a beta or beta-like strand F; a loop FG; and a beta or beta-like strand G. See
In certain embodiments, the disclosure provides polypeptides comprising a tenth fibronectin type III (10Fn3) domain, wherein the 10Fn3 domain comprises a loop, AB; a loop, BC; a loop, CD; a loop, DE; a loop EF; and a loop FG; and has at least one loop selected from loop BC, DE, and FG with an altered amino acid sequence relative to the sequence of the corresponding loop of the human 10Fn3 domain. By “I” is meant one or more amino acid sequence alterations relative to a template sequence (corresponding human fibronectin domain) and includes amino acid additions, deletions, and substitutions. Altering an amino acid sequence may be accomplished through intentional, blind, or spontaneous sequence variation, generally of a nucleic acid coding sequence, and may occur by any technique, for example, PCR, error-prone PCR, or chemical DNA synthesis.
In some embodiments, one or more loops selected from BC, DE, and FG may be extended or shortened in length relative to the corresponding human fibronectin loop. In some embodiments, the length of the loop may be extended by from 2-25 amino acids. In some embodiments, the length of the loop may be decreased by from 1-11 amino acids. In particular, the FG loop of 10Fn3 is 12 residues long, whereas the corresponding loop in antibody heavy chains ranges from 4-28 residues. To optimize antigen binding, therefore, the length of the FG loop of 10Fn3 is preferably randomized in length as well as in sequence to cover the CDR3 range of 4-28 residues to obtain the greatest possible flexibility and affinity in antigen binding. In some embodiments, the integrin-binding motif may be replaced by an amino acid sequence in which a polar amino acid-neutral amino acid-acidic amino acid sequence (in the N-terminal to C-terminal direction).
In some embodiments, the polypeptide comprising a 10Fn3 domain comprises the amino acid sequence of any one of SEQ ID NOS: 2-125 or 184-202. Additional sequences may be added to the N- or C-terminus. For example, an additional MG sequence may be placed at the N-terminus. The M will usually be cleaved off, leaving a GVS . . . sequence at the N-terminus. In some embodiments, linker sequences may be placed at the C-terminus of the 10Fn3 domain, e.g., SEQ ID NOS: 203 and 226.
In certain embodiments, the disclosure provides a non-antibody polypeptide comprising a domain having an immunoglobulin-like fold that binds to IGF-IR. The non-antibody polypeptide may have a molecular weight of less than 20 kDa, or less than 15 kDa and will generally be derived (by, for example, alteration of the amino acid sequence) from a reference, or “scaffold”, protein, such as an Fn3 scaffold. The non-antibody polypeptide may bind IGF-IR with a KD less than 10−6M, or less than 10−7M, less than 5×10−8M, less than 10−8M or less than 10−9M. The unaltered reference protein either will not meaningfully bind to IGF-IR or will bind with a KD of greater than 10−6M. The non-antibody polypeptide may inhibit IGF-IR signaling, particularly where the non-antibody polypeptide has a KD of less than 5×10−8M, less than 10−8M or less than 10−9M, although higher KD values may be tolerated where the koff is sufficiently low (e.g., less than 5×10−4 s−1). The immunoglobulin-like fold may be a 10Fn3 polypeptide.
In certain embodiments, the disclosure provides a polypeptide comprising a single domain having an immunoglobulin fold that binds to IGF-IR. The polypeptide may have a molecular weight of less than 20 kDa, or less than 15 kDa and will generally be derived (by, for example, alteration of the amino acid sequence) from a variable domain of an immunoglobulin. The polypeptide may bind IGF-IR with a KD less than 10−6M, or less than 10−7M, less than 5×10−8M, less than 10−8M or less than 10−9M. The polypeptide may inhibit IGF-IR signaling, particularly where the polypeptide has a KD of less than 5×10−8M, less than 10−8M or less than 10−9M, although higher KD values may be tolerated where the koff is sufficiently low or where the kon is sufficiently high. In certain preferred embodiments, a single domain polypeptide having an immunoglobulin fold derived from an immunoglobulin light chain variable domain and capable of binding to IGF-IR may comprise an amino acid sequence selected from the IGF-IR binding clones described herein.
In certain preferred embodiments, the disclosure provides IGF-IR binding polypeptides comprising the amino acid sequence of any of the IGF-IR binding clones described herein with the most desirable biochemical features. In the case of a polypeptide comprising such amino acid sequences, a PEG moiety or other moiety of interest may be covalently bound to the cysteine at position from about 85 to 100 depending on the protein. The PEG moiety may also be covalently bonded to an amine moiety in the polypeptide. The amine moiety may be, for example, a primary amine found at the N-terminus of a polypeptide or an amine group present in an amino acid, such as lysine or arginine. In certain embodiments, the PEG moiety is attached at a position on the polypeptide selected from the group consisting of: a) the N-terminus; b) between the N-terminus and the most N-terminal beta strand or beta-like strand; c) a loop positioned on a face of the polypeptide opposite the target-binding site; d) between the C-terminus and the most C-terminal beta strand or beta-like strand; and e) at the C-terminus.
In certain aspects, the disclosure provides short peptide sequences that mediate IGF-IR binding. Such sequences may mediate IGF-IR binding in an isolated form or when inserted into a particular protein structure, such as an immunoglobulin or immunoglobulin-like domain. Examples of such sequences include those disclosed as in the tables and other sequences that are at least 85%, 90%, or 95% identical to SEQ ID 1 or any other sequence listed herein and retain IGF-IR binding activity. Accordingly, the disclosure provides substantially pure or isolated polypeptides comprising an amino acid sequence that is at least 85% identical to the sequence of any of such sequences, wherein said polypeptide binds to a IGF-IR and competes with an IGF species for binding to IGF-IR. Examples of such polypeptides include a polypeptide comprising an amino acid sequence that is at least 80%, 85%, 90%, 95% or 100% identical to an amino acid sequence at least 85% identical to the sequence of any in the tables. Preferably such polypeptides will inhibit a biological activity of an IGF and may bind to IGF-IR with a KD less than 10−6M, or less than 10−7M, less than 5×10−8M, less than 10−8M or less than 10−9M.
In certain embodiments, any of the IGF-IR binding polypeptides described herein may be bound to one or more additional moieties, including, for example, a moiety that also binds to IGF-IR (e.g., a second identical or different IGF-IR binding polypeptide), a moiety that binds to a different target (e.g., to create a dual-specificity binding agent), a labeling moiety, a moiety that facilitates protein purification or a moiety that provides improved pharmacokinetics. Improved pharmacokinetics may be assessed according to the perceived therapeutic need. Often it is desirable to increase bioavailability and/or increase the time between doses, possibly by increasing the time that a protein remains available in the serum after dosing. In some instances, it is desirable to improve the continuity of the serum concentration of the protein over time (e.g., decrease the difference in serum concentration of the protein shortly after administration and shortly before the next administration). Moieties that tend to slow clearance of a protein from the blood, herein referred to as “PK moieties”, include polyoxyalkylene moieties, e.g., polyethylene glycol, sugars (e.g., sialic acid), and well-tolerated protein moieties (e.g., Fc, Fc fragments or serum albumin). The polypeptides of the invention may be fused to albumin or a fragment (portion) or variant of albumin as described in U.S. Publication No. 20070048282. The single domain polypeptide may be attached to a moiety that reduces the clearance rate of the polypeptide in a mammal (e.g., mouse, rat, or human) by greater than three-fold relative to the unmodified polypeptide. Other measures of improved pharmacokinetics may include serum half-life, which is often divided into an alpha phase and a beta phase. Either or both phases may be improved significantly by addition of an appropriate moiety. Where polyethylene glycol is employed, one or more PEG molecules may be attached at different positions in the protein, and such attachment may be achieved by reaction with amines, thiols or other suitable reactive groups. Pegylation may be achieved by site-directed pegylation, wherein a suitable reactive group is introduced into the protein to create a site where pegylation preferentially occurs. In a preferred embodiment, the protein is modified so as to have a cysteine residue at a desired position, permitting site directed pegylation on the cysteine. PEG may vary widely in molecular weight and may be branched or linear. Notably, the present disclosure establishes that pegylation is compatible with target binding activity of 10Fn3 polypeptides and, further, that pegylation improves the pharmacokinetics of such polypeptides. Accordingly, in one embodiment, the disclosure provides pegylated forms of 10Fn3 polypeptides, regardless of the target that can be bound by such polypeptides.
In some embodiments, the polypeptide of the invention comprises a conjugate of a fibronectin-based scaffold protein and a PK moiety. The fibronectin-based scaffold protein may bind any human protein and is preferably derived from an 10Fn3 domain. The PK moiety may be any moiety that improves the pharmocokinetics of the fibronectin-based scaffold protein. In some embodiments, the PK moiety at least doubles the serum half-life of the scaffold protein. In some embodiments, the PK moiety is linked to the scaffold protein via a polypeptide linker. Exemplary polypeptide linkers include PSTSTST (SEQ ID NO: 244), EIDKPSQ (SEQ ID NO: 245), and GS linkers, such as GSGSGSGSGS (SEQ ID NO: 246) and multimers thereof. In some embodiments the PK moiety is human serum albumin. In some embodiments, the PK moiety is transferrin.
In certain aspects, the disclosure provides methods for using an IGF-IR binding protein to inhibit IGF biological activity in a cell or to inhibit a biological activity mediated by IGF-IR. The cell may be situated in vivo or ex vivo, and may be, for example, a cell of a living organism, a cultured cell or a cell in a tissue sample. The method may comprise contacting said cell with any of the IGF-IR-inhibiting polypeptides disclosed herein, in an amount and for a time sufficient to inhibit such biological activity.
In certain aspects, the disclosure provides methods for treating a subject having a condition which responds to the inhibition of IGF or IGF-IR. Such a method may comprise administering to said subject an effective amount of any of the IGF-IR inhibiting polypeptides described herein. A condition may be one that is characterized by inappropriate IGF-IR biology. Any of the IGF-IR inhibiting polypeptides described herein may be used for the preparation of a medicament for the treatment of a disorder, particularly a disorder selected from the group consisting of: an autoimmune disorder, a restenosis, and a cancer.
In certain aspects, the disclosure provides methods for detecting IGF-IR in a sample. A method may comprise contacting the sample with a IGF-IR binding polypeptide described herein, wherein said contacting is carried out under conditions that allow polypeptide-IGF-IR complex formation; and detecting said complex, thereby detecting said IGF-IR in said sample. Detection may be carried out using any technique known in the art, such as, for example, radiography, immunological assay, fluorescence detection, mass spectroscopy, or surface plasmon resonance. The sample will often by a biological sample, such as a biopsy, and particularly a biopsy of a tumor, a suspected tumor. The sample may be from a human or other mammal. The IGF-IR binding polypeptide may be labeled with a labeling moiety, such as a radioactive moiety, a fluorescent moiety, a chromogenic moiety, a chemiluminescent moiety, or a hapten moiety. The IGF-IR binding polypeptide may be immobilized on a solid support.
Another aspect of the disclosure relates to a nucleic acid comprising a nucleic acid sequence encoding a polypeptide disclosed herein. In certain embodiments, a nucleic acid may comprise a nucleic acid sequence encoding a polypeptide selected from the group consisting of any of the protein sequences in the tables disclosed herein.
A further aspect of the disclosure relates to an expression vector comprising a nucleic acid operably linked with a promoter, wherein the nucleic acid encodes a polypeptide disclosed herein. Another aspect of the disclosure relates to a cell comprising a nucleic acid disclosed herein. Also provided is a method of producing the polypeptide that binds IGF-IR comprising: expressing a nucleic acid encoding a polypeptide of the disclosure. In certain embodiments, the nucleic acid may comprise a sequence that encodes a polypeptide selected from the group consisting of any of the sequences in the tables disclosed herein and their corresponding proteins. In certain embodiments, the nucleic acid is expressed in a cell. Alternatively, the nucleic acid is expressed in a cell-free system.
In certain aspects, the disclosure provides discoveries that may be applicable to any 10Fn3 polypeptide, regardless of which target the polypeptide is engineered to bind. As noted above, the disclosure demonstrates that PEG can be used successfully to improve the pharmacokinetics of a 10Fn3 polypeptide, while not interfering meaningfully with target binding. Accordingly, the disclosure provides pegylated 10Fn3 polypeptides that bind to target and have improved pharmacokinetics relative to the non-pegylated polypeptide. In a further embodiment, the disclosure demonstrates that a deletion of the first eight amino acids of a 10Fn3 polypeptide can increase target binding affinity. Accordingly, the disclosure provides 10Fn3 polypeptides lacking the initial eight amino acids (amino acids numbered in reference to the sequence of SEQ ID NO:1). It is understood that one or two amino acids may be added back to the deleted form of the polypeptide so as to facilitate translation and proper processing. The disclosure demonstrates that subcutaneous administration of a 10Fn3 polypeptide results in a delayed release of polypeptide into the bloodstream and a decreased maximum serum concentration of the 10Fn3 polypeptide. Accordingly, the disclosure provides methods for administering a 10Fn3 polypeptide to a patient by a subcutaneous administration. This route of administration may be useful to achieve a delayed release relative to intravenous administration, and/or to decrease the maximum serum concentration of the 10Fn3 polypeptide by at least 25% or at least 50% relative to the maximum serum concentration achieved by intravenous administration of an equal dosage. The administered 10Fn3 polypeptide may be attached to a moiety that increases the serum half-life (or decreases clearance rate, or similarly affects another pharmacokinetic parameter) of the 10Fn3 polypeptide, such as a polyethylene glycol moiety. Preferably, the administered 10Fn3 polypeptide comprises an amino acid sequence that is at least 60%, 65%, 70%, 75%, 80%, 85%, 90% identical to SEQ ID NO:1.
In certain aspects, the disclosure provides single domain polypeptides that bind to a preselected target protein from a first mammal and to a homolog thereof from a second mammal. Such single domain polypeptides are particularly useful where the first mammal is a human and the second mammal is a desirable mammal in which to conduct preclinical testing, such as a mouse, rat, guinea pig, dog, or non-human primate. The disclosure demonstrates that single domain polypeptides can be engineered to have such dual specificity, and that the dual specificity simplifies drug development by allowing testing of the same polypeptide in human cells, human subjects and animal models. Preferably, the preselected target protein of the first mammal and the homolog thereof from the second mammal are sufficiently similar in amino acid sequence to allow generation of dual specificity polypeptides. For example, the preselected target protein and the homolog from the second mammal may share at least 80%, 90%, or 95% identity across a region of at least 50 amino acids, and optionally may share at least 80%, 90%, or 95% identity across the entire protein sequence or across the sequence of the extracellular domain, in the case of a membrane protein. A single domain polypeptide with this type of dual specificity binding characteristic may comprise an immunoglobulin or immunoglobulin-like domain, and will preferably bind to both the preselected human target protein and to the homolog thereof with a dissociation constant of less than 1×10−6M, 1×10−7M, 5×10−8M, 1×10−8M or 1×10−9M.
Additional Assays Inhibition of IGF-IR Via Tyrosine Phosphorylation IGF-IR Levels or Tumor Cell Growth In Vivo by IGF-IR Binding Proteins of the InventionIn a further embodiment, proteins of the invention provide for an IGF-IR binder that inhibits IGF-IR tyrosine phosphorylation or receptor levels in vivo or both. In one embodiment, administration of IGF-IR binder to an animal causes a reduction in IGF-IR phosphotyrosine signal in IGF-IR-expressing tumors. In a preferred embodiment, the IGF-IR binder causes a reduction in phosphotyrosine signal by at least 20%. In a more preferred embodiment, the IGF-IR binder causes a decrease in phosphotyrosine signal by at least 50%, more preferably 60%. In an even more preferred embodiment, the binder causes a decrease in phosphotyrosine signal of at least 70%, more preferably 80%, even more preferably 90%.
In another embodiment, administration of IGF-IR binder to an animal causes a reduction in IGF-IR levels in IGF-IR-expressing tumors. In a preferred embodiment, the IGF-IR binder causes a reduction in receptor levels by at least 20% compared to an untreated animal. In a more preferred embodiment, the IGF-IR binder causes a decrease in receptor levels to at least 50%, more preferably 60% of the receptor levels in an untreated animal. In an even more preferred embodiment, the binder causes a decrease in receptor levels by at least 70%, more preferably 80%.
In Vivo ModulationIn another embodiment of a protein of the invention, an IGF-IR binder inhibits tumor cell growth in vivo. The tumor cell may be derived from any cell type including, without limitation, epidermal, epithelial, endothelial, leukemia, sarcoma, multiple myeloma, or mesodermal cells. Examples of common tumor cell lines for use in xenograft tumor studies include A549 (non-small cell lung carcinoma) cells, DU-145 (prostate) cells, MCF-7 (breast) cells, Colo 205 (colon) cells, 3T3/]GF-IR (mouse fibroblast) cells, NCI H441 cells, HEP G2 (hepatoma) cells, MDA MB 231 (breast) cells, HT-29 (colon) cells, MDA-MB-435s (breast) cells, U266 cells, SH-SY5Y cells, Sk-Mel-2 cells, NCI-H929, RPM18226, and A431 cells. In a preferred embodiment, the binder inhibits tumor cell growth as compared to the growth of the tumor in an untreated animal. In a more preferred embodiment, the binder inhibits tumor cell growth by 50%. In an even more preferred embodiment, the binder inhibits tumor cell growth by 60%, 65%, 70%, or 75%. In one embodiment, the inhibition of tumor cell growth is measured at least 7 days after the animals have started treatment with the binder. In a more preferred embodiment, the inhibition of tumor cell growth is measured at least 14 days after the animals have started treatment with the binder. In another preferred embodiment, another antineoplastic agent is administered to the animal with the IGF-IR binder. In a preferred embodiment, the antineoplastic agent is able to further inhibit tumor cell growth. In an even more preferred embodiment, the antineoplastic agent is adriamycin, taxol, tamoxifen, 5-fluorodeoxyuridine (5-FU) or CP-358,774.
Additional Bispecific and Multi-Specific EmbodimentsIn many embodiments it will be desirable to make multi-specific compositions, e.g. compositions that bind more that more than one target or other protein of interest. In one aspect, proteins of the invention comprise a first protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to first desired target (e.g., IGF-IR) or less and binds an undesired, related target (e.g., human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and binding with respect to the desired target (e.g., human IGF-IR) and is preferably a single domain or substantially monovalent and is linked to attached to a second protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to a second desired target (e.g., EGFR, c-Met, c-kit, Her2, FGFR1, VEGFR2, VEGF-A, VEGF-B, VEGF-C, VEGF-D, folate receptor) or less and binds an undesired, related target (e.g., human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent. Such molecules with bispecific affinity can be further attached to other molecules, including other proteins described herein.
In one aspect, proteins of the invention comprise a first 10Fn3 domain that binds to IGF-IR and a second 10Fn3 domain that binds VEGFR2. VEGFR-2 binding polypeptides were generated as described in PCT Publication No. WO2005/056764, which is hereby incorporated by reference. Sequences of the preferred VEGFR-2 binding 10Fn3 polypeptides useful for the invention are shown in
In one aspect, proteins of the invention comprise a first protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to first desired target (e.g., EGFR) or less and binds an undesired, related target (e.g., human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent and is linked to attached to a second protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to a second desired target (e.g., Her2, folate receptor) or less and binds an undesired, related target (e.g., human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent. Such molecules with bispecific affinity can be further attached to other molecules, including other proteins described herein.
In one aspect, proteins of the invention comprise a first protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to first desired target (e.g., EGFR) or less and binds an undesired, related target (e.g. human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent and is linked to attached to a second protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to a second desired target (e.g., VEGFR2) or less and binds an undesired, related target (e.g., VEGFR1) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent. Such molecules with bispecific affinity can be further attached to other molecules, including other proteins described herein.
In one aspect, proteins of the invention comprise a first protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to first desired target (e.g., Her2) or less and binds an undesired, related target (e.g., Her4) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent and is linked to attached to a second protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to a second desired target (e.g., VEGFR2) or less and binds an undesired, related target (e.g., VEGFR1) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent. Such molecules with bispecific affinity can be further attached to other molecules, including other proteins described herein.
In one aspect, proteins of the invention comprise a first protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to first desired target (e.g., FGFR1, c-Met, c-kit) or less and binds an undesired, related target (e.g. human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent and is linked to attached to a second protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to a second desired target (e.g., VEGFR2) or less and binds an undesired, related target (e.g., VEGFR1) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent. Such molecules with bispecific affinity can be further attached to other molecules, including other proteins described herein.
In one aspect, proteins of the invention comprise a first protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to first desired target (e.g., Her2) or less and binds an undesired, related target (e.g. human insulin receptor) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent and is linked to attached to a second protein with a binding affinity of about 10 nM (other appropriate affinity described herein) to a second desired target (e.g., Her3) or less and binds an undesired, related target (e.g., Her4) with a binding affinity of about 1 uM (other appropriate affinity described herein) or greater and is preferably a single domain or substantially monovalent. Such molecules with bispecific affinity can be further attached to other molecules, including other proteins described herein.
Additional PEG EmbodimentsThis is, to our knowledge, the first time that PEG (or functionally similar molecule) can be used to connect two proteins that are non-antibody moieties that bind a single target, particularly proteins wherein each binding protein is comprised of a single domain or multiple domains, usually wherein each domain is about 50 or about 60 or about 75 amino acids or more (as opposed to small peptides of 5 to 20 amino acids). Preferably fibronectin scaffold proteins can be used advantageously in such embodiments and more preferably with the proper engineering of Cys or Lys amino acids.
This is, to our knowledge, the first time that PEG (or functionally similar molecule) can be used to connect two proteins that are non-antibody moieties that bind a two or more different targets or protein of interest (e.g., a PK modulating protein), particularly proteins wherein each binding protein is comprised of a single domain or multiple domains, usually wherein each domain is about 50 or about 60 or about 75 amino acids or more (as opposed to small peptides of 5 to 20 amino acids). Preferably fibronectin scaffold proteins can be used advantageously in such embodiments and more preferably with the proper engineering of Cys or Lys amino acids.
In addition, nonPEG and PEG aspects of the invention include antibody moieties (e.g., camel antibodies and their derivatives, as well as single chain and domain antibodies; and particularly those expressed from microbes) and antibody-like moieties (e.g., derivatives of lipocalins, ankyrins, multiple Cys-Cys domains, and tetranectins; and particularly those expressed from microbes), particularly those less than about 40 kDa that are connect by PEG, and more particularly those that have a limited number of cys amino acids.
There are many properties and advantages of PEG linked proteins of the invention not previously recognized or discovered. When such proteins are expressed in microbes it may be preferable to isolate domains and then link them via PEG or other polymeric linker. PEG, or other functionally operably polymeric linkers, can be used to optimally vary the distance between each protein moiety to create a protein with one or more of the following characteristics: 1) reduced or increased steric hindrance of binding of one or more protein domain when binding to a protein of interest (e.g., a target), 2) connect two or more domains that bind different targets, 3) increase protein stability or solubility without searching for additional amino acid substitutions to increase stability or solubility (e.g., solubility at least about 20 mg/ml, or at least about 50 mg/ml), 4) decrease protein aggregation without searching for additional amino acid substitutions to decrease stability (e.g., as measured by SEC), 4) increase the overall avidity or affinity of the protein for the protein of interest by adding additional binding domains. Additional advantages of PEG linked proteins include rapidly making monospecific, multi-valent binding modes, as well as multi-specific, monovalent or multivalent binding modes depending on the number of protein targeting moieties that are included in the PEG linked protein.
10Fn3 polypeptides of the invention can be pegylated and retain ligand binding activity. In a preferred embodiment, the pegylated 10Fn3 polypeptide is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus. Accordingly, the present disclosure provides a target-binding 10Fn3 polypeptide with improved pharmacokinetic properties, the polypeptide comprising: a 10Fn3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10Fn3 domain participate in target binding; and a covalently bound PEG moiety, wherein said 10Fn3 polypeptide binds to the target with a KD of less than 100 nM and has a clearance rate of less than 30 mL/hr/kg in a mammal. The PEG moiety may be attached to the 10Fn3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at the N-terminus of the 10Fn3 polypeptide or between the N-terminus and the most N-terminal beta or beta-like strand or at the C-terminus of the 10Fn3 polypeptide or between the C-terminus and the most C-terminal beta or beta-like strand. A Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding. A PEG moiety may also be attached by other chemistry, including by conjugation to amines. In addition, the invention includes this type of N or C terminal PEG conjugation to antibody moieties (e.g., camel antibodies and their derivatives, as well as single chain and domain antibodies; and particularly those expressed from microbes) and antibody-like moieties (e.g., derivatives of lipocalins, ankyrins, multiple Cys-Cys domains, and tetranectins; and particularly those expressed from microbes), particularly those less than 40 kDa that are connect by PEG, and more particularly those that have a limited number of cys amino acids.
In one specific embodiment of the present invention, modified forms of the subject soluble polypeptides comprise linking the subject soluble polypeptides to nonproteinaceous polymers. In one specific embodiment, the polymer is polyethylene glycol (“PEG”), polypropylene glycol, or polyoxyalkylenes, in the manner as set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337. Examples of the modified polypeptide of the invention include PEGylated proteins further described herein.
PEG is a well-known, water soluble polymer that is commercially available or can be prepared by ring-opening polymerization of ethylene glycol according to methods well known in the art (Sandler and Karo, Polymer Synthesis, Academic Press, New York, Vol. 3, pages 138-161). The term “PEG” is used broadly to encompass any polyethylene glycol molecule, without regard to size or to modification at an end of the PEG, and can be represented by the formula:
X—O(CH2CH2O)n-1CH2CH2OH (1), where n is 20 to 2300 and X is H or a terminal modification, e.g., a C1-4 alkyl. In one embodiment, the PEG of the invention terminates on one end with hydroxy or methoxy, i.e., X is H or CH3 (“methoxy PEG”). A PEG can contain further chemical groups which are necessary for binding reactions; which results from the chemical synthesis of the molecule; or which is a spacer for optimal distance of parts of the molecule. In addition, such a PEG can consist of one or more PEG side-chains which are linked together. PEGs with more than one PEG chain are called multiarmed or branched PEGs. Branched PEGs can be prepared, for example, by the addition of polyethylene oxide to various polyols, including glycerol, pentaerythriol, and sorbitol. For example, a four-armed branched PEG can be prepared from pentaerythriol and ethylene oxide. Branched PEG are described in, for example, European Published Application No. 473084A and U.S. Pat. No. 5,932,462. One form of PEGs includes two PEG side-chains (PEG2) linked via the primary amino groups of a lysine (Monfardini, C., et al., Bioconjugate Chem. 6 (1995) 62-69).
Although PEG is well-known, this is, to our knowledge, the first demonstration that a two separate 10Fn3 polypeptides can be pegylated and retain ligand binding activity. In a preferred embodiment, the pegylated 10Fn3 polypeptide is produced by site-directed pegylation, particularly by conjugation of PEG to a cysteine moiety at the N- or C-terminus. Accordingly, the present disclosure provides a target-binding 10Fn3 polypeptide with improved pharmacokinetic properties, the polypeptide comprising: a 10Fn3 domain having from about 80 to about 150 amino acids, wherein at least one of the loops of said 10Fn3 domain participate in target binding; and a covalently bound PEG moiety, wherein said 10Fn3 polypeptide binds to the target with a KD of less than 100 nM and has a clearance rate of less than 30 mL/hr/kg in a mammal. The PEG moiety may be attached to the 10Fn3 polypeptide by site directed pegylation, such as by attachment to a Cys residue, where the Cys residue may be positioned at the N-terminus of the 10Fn3 polypeptide or between the N-terminus and the most N-terminal beta or beta-like strand or at the C-terminus of the 10Fn3 polypeptide or between the C-terminus and the most C-terminal beta or beta-like strand. A Cys residue may be situated at other positions as well, particularly any of the loops that do not participate in target binding. A PEG moiety may also be attached by other chemistry, including by conjugation to amines.
PEG conjugation to peptides or proteins generally involves the activation of PEG and coupling of the activated PEG-intermediates directly to target proteins/peptides or to a linker, which is subsequently activated and coupled to target proteins/peptides (see Abuchowski, A. et al, J. Biol. Chem., 252, 3571 (1977) and J. Biol. Chem., 252, 3582 (1977), Zalipsky, et al., and Harris et. al., in: Poly(ethylene glycol) Chemistry: Biotechnical and Biomedical Applications; (J. M. Harris ed.) Plenum Press: New York, 1992; Chap. 21 and 22). It is noted that a binding polypeptide containing a PEG molecule is also known as a conjugated protein, whereas the protein lacking an attached PEG molecule can be referred to as unconjugated.
A variety of molecular mass forms of PEG can be selected, e.g., from about 1,000 Daltons (Da) to 100,000 Da (n is 20 to 2300), for conjugating to binding polypeptides of the invention. The number of repeating units “n” in the PEG is approximated for the molecular mass described in Daltons. It is preferred that the combined molecular mass of PEG on an activated linker is suitable for pharmaceutical use. Thus, in one embodiment, the molecular mass of the PEG molecules does not exceed 100,000 Da. For example, if three PEG molecules are attached to a linker, where each PEG molecule has the same molecular mass of 12,000 Da (each n is about 270), then the total molecular mass of PEG on the linker is about 36,000 Da (total n is about 820). The molecular masses of the PEG attached to the linker can also be different, e.g., of three molecules on a linker two PEG molecules can be 5,000 Da each (each n is about 110) and one PEG molecule can be 12,000 Da (n is about 270).
In a specific embodiment of the invention, a IGF-IR or other receptor binding polypeptide is covalently linked to one poly(ethylene glycol) group of the formula: —CO—(CH2)x—(OCH2CH2)m—OR, with the —CO (i.e. carbonyl) of the poly(ethylene glycol) group forming an amide bond with one of the amino groups of the binding polypeptide; R being lower alkyl; x being 2 or 3; m being from about 450 to about 950; and n and m being chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to 40 kDa. In one embodiment, a binding polypeptide's ε-amino group of a lysine is the available (free) amino group.
The above conjugates may be more specifically presented by formula (II): P-NHCO—(CH2)x—(OCH2CH2)m—OR (II), wherein P is the group of a binding polypeptide as described herein, (i.e. without the amino group or amino groups which form an amide linkage with the carbonyl shown in formula (II); and wherein R is lower alkyl; x is 2 or 3; m is from about 450 to about 950 and is chosen so that the molecular weight of the conjugate minus the binding polypeptide is from about 10 to about 40 kDa. As used herein, the given ranges of “m” have an orientational meaning. The ranges of “m” are determined in any case, and exactly, by the molecular weight of the PEG group.
One skilled in the art can select a suitable molecular mass for PEG, e.g., based on how the pegylated binding polypeptide will be used therapeutically, the desired dosage, circulation time, resistance to proteolysis, immunogenicity, and other considerations. For a discussion of PEG and its use to enhance the properties of proteins, see N. V. Katre, Advanced Drug Delivery Reviews 10: 91-114 (1993).
In one embodiment of the invention, PEG molecules may be activated to react with amino groups on a binding polypeptide, such as with lysines (Bencham C. O. et al., Anal. Biochem., 131, 25 (1983); Veronese, F. M. et al., Appl. Biochem., 11, 141 (1985); Zalipsky, S. et al., Polymeric Drugs and Drug Delivery Systems, adrs 9-110 ACS Symposium Series 469 (1999); Zalipsky, S. et al., Europ. Polym. J., 19, 1177-1183 (1983); Delgado, C. et al., Biotechnology and Applied Biochemistry, 12, 119-128 (1990)).
In one specific embodiment, carbonate esters of PEG are used to form the PEG-binding polypeptide conjugates. N,N′-disuccinimidylcarbonate (DSC) may be used in the reaction with PEG to form active mixed PEG-succinimidyl carbonate that may be subsequently reacted with a nucleophilic group of a linker or an amino group of a binding polypeptide (see U.S. Pat. No. 5,281,698 and U.S. Pat. No. 5,932,462). In a similar type of reaction, 1,1′-(dibenzotriazolyl)carbonate and di-(2-pyridyl)carbonate may be reacted with PEG to form PEG-benzotriazolyl and PEG-pyridyl mixed carbonate (U.S. Pat. No. 5,382,657), respectively.
Pegylation of a 10Fn3 polypeptide can be performed according to the methods of the state of the art, for example by reaction of the binding polypeptide with electrophilically active PEGs (supplier: Shearwater Corp., USA, www.shearwatercorp.com). Preferred PEG reagents of the present invention are, e.g., N-hydroxysuccinimidyl propionates (PEG-SPA), butanoates (PEG-SBA), PEG-succinimidyl propionate or branched N-hydroxysuccinimides such as mPEG2-NHS (Monfardini, C., et al., Bioconjugate Chem. 6 (1995) 62-69). Such methods may used to pegylated at an ε-amino group of a binding polypeptide lysine or the N-terminal amino group of the binding polypeptide.
In another embodiment, PEG molecules may be coupled to sulfhydryl groups on a binding polypeptide (Sartore, L., et al., Appl. Biochem. Biotechnol., 27, 45 (1991); Morpurgo et al., Biocon. Chem., 7, 363-368 (1996); Goodson et al., Bio/Technology (1990) 8, 343; U.S. Pat. No. 5,766,897). U.S. Pat. Nos. 6,610,281 and 5,766,897 describes exemplary reactive PEG species that may be coupled to sulfhydryl groups.
In some embodiments where PEG molecules are conjugated to cysteine residues on a binding polypeptide, the cysteine residues are native to the binding polypeptide, whereas in other embodiments, one or more cysteine residues are engineered into the binding polypeptide. Mutations may be introduced into an binding polypeptide coding sequence to generate cysteine residues. This might be achieved, for example, by mutating one or more amino acid residues to cysteine. Preferred amino acids for mutating to a cysteine residue include serine, threonine, alanine and other hydrophilic residues. Preferably, the residue to be mutated to cysteine is a surface-exposed residue. Algorithms are well-known in the art for predicting surface accessibility of residues based on primary sequence or a protein. Alternatively, surface residues may be predicted by comparing the amino acid sequences of binding polypeptides, given that the crystal structure of the framework based on which binding polypeptides are designed and evolved has been solved (see Himanen et al., Nature. (2001) 20-27; 414(6866):933-8) and thus the surface-exposed residues identified. In one embodiment, cysteine residues are introduced into binding polypeptides at or near the N- and/or C-terminus, or within loop regions.
In some embodiments, the pegylated binding polypeptide comprises a PEG molecule covalently attached to the alpha amino group of the N-terminal amino acid. Site specific N-terminal reductive amination is described in Pepinsky et al., (2001) JPET, 297,1059, and U.S. Pat. No. 5,824,784. The use of a PEG-aldehyde for the reductive amination of a protein utilizing other available nucleophilic amino groups is described in U.S. Pat. No. 4,002,531, in Wieder et al., (1979) J. Biol. Chem. 254,12579, and in Chamow et al., (1994) Bioconjugate Chem. 5, 133.
In another embodiment, pegylated binding polypeptide comprises one or more PEG molecules covalently attached to a linker, which in turn is attached to the alpha amino group of the amino acid residue at the N-terminus of the binding polypeptide. Such an approach is disclosed in U.S. Publication No. 2002/0044921 and PCT Publication No. WO94/01451.
In one embodiment, a binding polypeptide is pegylated at the C-terminus. In a specific embodiment, a protein is pegylated at the C-terminus by the introduction of C-terminal azido-methionine and the subsequent conjugation of a methyl-PEG-triarylphosphine compound via the Staudinger reaction. This C-terminal conjugation method is described in Cazalis et al., C-Terminal Site-Specific PEGylation of a Truncated Thrombomodulin Mutant with Retention of Full Bioactivity, Bioconjug Chem. 2004; 15(5):1005-1009.
Monopegylation of a binding polypeptide can also be produced according to the general methods described in PCT Publication No. WO94/01451. WO94/01451 describes a method for preparing a recombinant polypeptide with a modified terminal amino acid alpha-carbon reactive group. The steps of the method involve forming the recombinant polypeptide and protecting it with one or more biologically added protecting groups at the N-terminal alpha-amine and C-terminal alpha-carboxyl. The polypeptide can then be reacted with chemical protecting agents to selectively protect reactive side chain groups and thereby prevent side chain groups from being modified. The polypeptide is then cleaved with a cleavage reagent specific for the biological protecting group to form an unprotected terminal amino acid alpha-carbon reactive group. The unprotected terminal amino acid alpha-carbon reactive group is modified with a chemical modifying agent. The side chain protected terminally modified single copy polypeptide is then deprotected at the side chain groups to form a terminally modified recombinant single copy polypeptide. The number and sequence of steps in the method can be varied to achieve selective modification at the N- and/or C-terminal amino acid of the polypeptide.
The ratio of a binding polypeptide to activated PEG in the conjugation reaction can be from about 1:0.5 to 1:50, between from about 1:1 to 1:30, or from about 1:5 to 1:15. Various aqueous buffers can be used in the present method to catalyze the covalent addition of PEG to the binding polypeptide. In one embodiment, the pH of a buffer used is from about 7.0 to 9.0. In another embodiment, the pH is in a slightly basic range, e.g., from about 7.5 to 8.5. Buffers having a pKa close to neutral pH range may be used, e.g., phosphate buffer. Other ratios will be used when making multi-specific PEG linked proteins, such as about 1:4 to 1:8, or about 1:3 to 1:5 Conventional separation and purification techniques known in the art can be used to purify PEGylated binding polypeptide, such as size exclusion (e.g., gel filtration) and ion exchange chromatography. Products may also be separated using SDS-PAGE. Products that may be separated include mono-, di-, tri- poly- and un-pegylated binding polypeptide, as well as free PEG. The percentage of mono-PEG conjugates can be controlled by pooling broader fractions around the elution peak to increase the percentage of mono-PEG in the composition. About ninety percent mono-PEG conjugates represents a good balance of yield and activity. Compositions in which, for example, at least ninety-two percent or at least ninety-six percent of the conjugates are mono-PEG species may be desired. In an embodiment of this invention the percentage of mono-PEG conjugates is from ninety percent to ninety-six percent.
In one embodiment, PEGylated binding polypeptide of the invention contain one, two or more PEG moieties. In one embodiment, the PEG moiety(ies) are bound to an amino acid residue which is on the surface of the protein and/or away from the surface that contacts the target ligand. In one embodiment, the combined or total molecular mass of PEG in PEG-binding polypeptide is from about 3,000 Da to 60,000 Da, optionally from about 10,000 Da to 36,000 Da. In a one embodiment, the PEG in pegylated binding polypeptide is a substantially linear, straight-chain PEG.
In one embodiment of the invention, the PEG in pegylated binding polypeptide is not hydrolyzed from the pegylated amino acid residue using a hydroxylamine assay, e.g., 450 mM hydroxylamine (pH 6.5) over 8 to 16 hours at room temperature, and is thus stable. In one embodiment, greater than 80% of the composition is stable mono-PEG-binding polypeptide, more preferably at least 90%, and most preferably at least 95%.
In another embodiment, the pegylated binding polypeptides of the invention will preferably retain at least about 25%, 50%, 60%, 70%, 80%, 85%, 90%, 95% or 100% of the biological activity associated with the unmodified protein. In one embodiment, biological activity refers to its ability to bind to VEGFR-2 or IGF-IR, as assessed by KD, kon or koff. In one specific embodiment, the pegylated binding polypeptide protein shows an increase in binding to VEGFR or IGF-IR relative to unpegylated binding polypeptide.
The serum clearance rate of PEG-modified polypeptide may be decreased by about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, or even 90%, relative to the clearance rate of the unmodified binding polypeptide. The PEG-modified polypeptide may have a half-life (t1/2) which is enhanced relative to the half-life of the unmodified protein. The half-life of PEG-binding polypeptide may be enhanced by at least 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 100%, 125%, 150%, 175%, 200%, 250%, 300%, 400% or 500%, or even by 1000% relative to the half-life of the unmodified binding polypeptide. In some embodiments, the protein half-life is determined in vitro, such as in a buffered saline solution or in serum. In other embodiments, the protein half-life is an in vivo half life, such as the half-life of the protein in the serum or other bodily fluid of an animal.
Additional Vector & Polynucleotide EmbodimentsNucleic acids encoding any of the various proteins or polypeptides disclosed herein may be synthesized chemically. Codon usage may be selected so as to improve expression in a cell. Such codon usage will depend on the cell type selected. Specialized codon usage patterns have been developed for E. coli and other bacteria, as well as mammalian cells, plant cells, yeast cells and insect cells. See for example: Mayfield et al., Proc Natl Acad Sci U.S.A. 2003 Jan. 21; 100(2):438-42; Sinclair et al. Protein Expr Purif. 2002 October; 26(1):96-105; Connell N D. Curr Opin Biotechnol. 2001 October; 12(5):446-9; Makrides et al. Microbiol Rev. 1996 September; 60(3):512-38; and Sharp et al. Yeast. 1991 October; 7(7):657-78.
General techniques for nucleic acid manipulation are described for example in Sambrook et al., Molecular Cloning: A Laboratory Manual, Vols. 1-3, Cold Spring Harbor Laboratory Press, 2 ed., 1989, or F. Ausubel et al., Current Protocols in Molecular Biology (Green Publishing and Wiley-Interscience: New York, 1987) and periodic updates, herein incorporated by reference. The DNA encoding the polypeptide is operably linked to suitable transcriptional or translational regulatory elements derived from mammalian, viral, or insect genes. Such regulatory elements include a transcriptional promoter, an optional operator sequence to control transcription, a sequence encoding suitable mRNA ribosomal binding sites, and sequences that control the termination of transcription and translation. The ability to replicate in a host, usually conferred by an origin of replication, and a selection gene to facilitate recognition of transformants are additionally incorporated.
The proteins of this invention may be produced recombinantly not only directly, but also as a fusion polypeptide with a heterologous polypeptide, which is preferably a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide. The heterologous signal sequence selected preferably is one that is recognized and processed (i.e., cleaved by a signal peptidase) by the host cell. For prokaryotic host cells that do not recognize and process a native signal sequence, the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from the group of the alkaline phosphatase, penicillinase, lpp, or heat-stable enterotoxin II leaders. For yeast secretion the native signal sequence may be substituted by, e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces.alpha.-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, or the signal described in PCT Publication No. WO90/13646. In mammalian cell expression, mammalian signal sequences as well as viral secretory leaders, for example, the herpes simplex gD signal, are available. The DNA for such precursor regions may be ligated in reading frame to DNA encoding the protein.
Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells. Generally, in cloning vectors this sequence is one that enables the vector to replicate independently of the host chromosomal DNA, and includes origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses. The origin of replication from the plasmid pBR322 is suitable for most Gram-negative bacteria, the 2.mu. plasmid origin is suitable for yeast, and various viral origins (SV40, polyoma, adenovirus, VSV or BPV) are useful for cloning vectors in mammalian cells. Generally, the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may typically be used only because it contains the early promoter).
Expression and cloning vectors may contain a selection gene, also termed a selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media, e.g., the gene encoding D-alanine racemase for Bacilli.
One example of a selection scheme utilizes a drug to arrest growth of a host cell. Those cells that are successfully transformed with a heterologous gene produce a protein conferring drug resistance and thus survive the selection regimen. Examples of such dominant selection use the drugs neomycin, mycophenolic acid and hygromycin.
Another example of suitable selectable markers for mammalian or eukaryotic cells are those that enable the identification of cells competent to take up the multivalent antibody nucleic acid, such as DHFR, thymidine kinase, metallothionein-I and —II, preferably primate metallothionein genes, adenosine deaminase, ornithine decarboxylase, etc.
For example, cells transformed with the DHFR selection gene are first identified by culturing all of the transformants in a culture medium that contains methotrexate (Mtx), a competitive antagonist of DHFR. An appropriate host cell when wild-type DHFR is employed is the Chinese hamster ovary (CHO) cell line deficient in DHFR activity.
Alternatively, host cells (particularly wild-type hosts that contain endogenous DHFR) transformed or co-transformed with DNA sequences encoding multivalent antibody, wild-type DHFR protein, and another selectable marker such as aminoglycoside 3′-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418. See U.S. Pat. No. 4,965,199.
A suitable selection gene for use in yeast is the trpl gene present in the yeast plasmid YRp7 (Stinchcomb et al., Nature, 282:39 (1979)). The trpl gene provides a selection marker for a mutant strain of yeast lacking the ability to grow in tryptophan, for example, ATCC No. 44076 or PEP4-1. Jones, Genetics, 85:12 (1977). The presence of the trpl lesion in the yeast host cell genome then provides an effective environment for detecting transformation by growth in the absence of tryptophan. Similarly, Leu2-deficient yeast strains (ATCC 20,622 or 38,626) are complemented by known plasmids bearing the Leu2 gene.
In addition, vectors derived from the 1.6.mu.m circular plasmid pKD1 can be used for transformation of Kluyveromyces yeasts. Alternatively, an expression system for large-scale production of recombinant calf chymosin was reported for K. lactis. Van den Berg, Bio/Technology, 8:135 (1990). Stable multi-copy expression vectors for secretion of mature recombinant human serum albumin by industrial strains of Kluyveromyces have also been disclosed. Fleer et al., Bio/Technology, 9:968-975 (1991).
Expression and cloning vectors usually contain a promoter that is recognized by the host organism and is operably linked to the nucleic acid encoding the protein of the invention, e.g., a fibronectin-based scaffold protein. Promoters suitable for use with prokaryotic hosts include the phoA promoter, beta-lactamase and lactose promoter systems, alkaline phosphatase, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter. However, other known bacterial promoters are suitable. Promoters for use in bacterial systems also will contain a Shine-Dalgarno (S.D.) sequence operably linked to the DNA encoding the protein of the invention.
Promoter sequences are known for eukaryotes. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Another sequence found 70 to 80 bases upstream from the start of transcription of many genes is a CNCAAT region where N may be any nucleotide. At the 3′ end of most eukaryotic genes is an AATAAA sequence that may be the signal for addition of the poly A tail to the 3′ end of the coding sequence. All of these sequences are suitably inserted into eukaryotic expression vectors.
Examples of suitable promoting sequences for use with yeast hosts include the promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase.
Other yeast promoters, which are inducible promoters having the additional advantage of transcription controlled by growth conditions, are the promoter regions for alcohol dehydrogenase 2, isocytochrome C, acid phosphatase, degradative enzymes associated with nitrogen metabolism, metallothionein, glyceraldehyde-3-phosphate dehydrogenase, and enzymes responsible for maltose and galactose utilization. Suitable vectors and promoters for use in yeast expression are further described in EP Patent Publication No. 73,657. Yeast enhancers also are advantageously used with yeast promoters.
Transcription from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses such as polyoma virus, fowlpox virus, adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and most preferably Simian Virus 40 (SV40), from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, from heat-shock promoters, provided such promoters are compatible with the host cell systems.
The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment. A system for expressing DNA in mammalian hosts using the bovine papilloma virus as a vector is disclosed in U.S. Pat. No. 4,419,446. A modification of this system is described in U.S. Pat. No. 4,601,978. See also Reyes et al., Nature 297:598-601 (1982) on expression of human .beta.-interferon cDNA in mouse cells under the control of a thymidine kinase promoter from herpes simplex virus. Alternatively, the rous sarcoma virus long terminal repeat can be used as the promoter.
Transcription of a DNA encoding proteins of the invention by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, .alpha.-fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus. Examples include the SV40 enhancer on the late side of the replication origin (bp 100-270), the cytomegalovirus early promoter enhancer, the polyoma enhancer on the late side of the replication origin, and adenovirus enhancers. See also Yaniv, Nature 297:17-18 (1982) on enhancing elements for activation of eukaryotic promoters. The enhancer may be spliced into the vector at a position 5′ or 3′ to the multivalent antibody-encoding sequence, but is preferably located at a site 5′ from the promoter.
Expression vectors used in eukaryotic host cells (e.g., yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA. Such sequences are commonly available from the 5′ and, occasionally 3′, untranslated regions of eukaryotic or viral DNAs or cDNAs. These regions contain nucleotide segments transcribed as polyadenylated fragments in the untranslated portion of the mRNA encoding the multivalent antibody. One useful transcription termination component is the bovine growth hormone polyadenylation region. See WO94/11026 and the expression vector disclosed therein.
The recombinant DNA can also include any type of protein tag sequence that may be useful for purifying the protein. Examples of protein tags include but are not limited to a histidine tag, a FLAG tag, a myc tag, an HA tag, or a GST tag. Appropriate cloning and expression vectors for use with bacterial, fungal, yeast, and mammalian cellular hosts can be found in Cloning Vectors: A Laboratory Manual, (Elsevier, New York, 1985), the relevant disclosure of which is hereby incorporated by reference.
The expression construct is introduced into the host cell using a method appropriate to the host cell, as will be apparent to one of skill in the art. A variety of methods for introducing nucleic acids into host cells are known in the art, including, but not limited to, electroporation; transfection employing calcium chloride, rubidium chloride, calcium phosphate, DEAE-dextran, or other substances; microprojectile bombardment; lipofection; and infection (where the vector is an infectious agent).
Suitable host cells include prokaryotes, yeast, mammalian cells, or bacterial cells. Suitable bacteria include gram negative or gram positive organisms, for example, E. coli or Bacillus spp. Yeast, preferably from the Saccharomyces species, such as S. cerevisiae, may also be used for production of polypeptides. Various mammalian or insect cell culture systems can also be employed to express recombinant proteins. Baculovirus systems for production of heterologous proteins in insect cells are reviewed by Luckow and Summers, (Bio/Technology, 6:47, 1988). Examples of suitable mammalian host cell lines include endothelial cells, COS-7 monkey kidney cells, CV-1, L cells, C127, 3T3, Chinese hamster ovary (CHO), human embryonic kidney cells, HeLa, 293, 293T, and BHK cell lines. Purified polypeptides are prepared by culturing suitable host/vector systems to express the recombinant proteins. For many applications, the small size of many of the polypeptides disclosed herein would make expression in E. coli as the preferred method for expression. The protein is then purified from culture media or cell extracts.
Additional Expression & Cell EmbodimentsPreferred proteins for production and cell embodiments are fibronectin based scaffolds and related proteins. Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above. Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, as well as Bacilli such as B. subtilis and B. licheniformis (e.g., B. licheniformis 41 P disclosed in DD 266,710 published 12 Apr. 1989), Pseudomonas such as P. aeruginosa, and Streptomyces. One preferred E. coli cloning host is E. coli 294 (ATCC 31,446), although other strains such as E. coli B, E. coli X1776 (ATCC 31,537), and E. coli W3110 (ATCC 27,325) are suitable. These examples are illustrative rather than limiting.
In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for protein-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. However, a number of other genera, species, and strains are commonly available and useful herein, such as Schizosaccharomyces pombe; Kluyveromyces hosts such as, e.g., K. lactis, K. fragilis (ATCC 12,424), K. bulgaricus (ATCC 16,045), K. wickeramii (ATCC 24,178), K. waltii (ATCC 56,500), K. drosophilarum (ATCC 36,906), K. thermotolerans, and K. marxianus; yarrowia (EP Patent Publication No. 402,226); Pichia pastoris (EP Patent Publication No. 183,070); Candida; Trichoderma reesia (EP Patent Publication No. 244,234); Neurospora crassa; Schwanniomyces such as Schwanniomyces occidentalis; and filamentous fungi such as, e.g., Neurospora, Penicillium, Tolypocladium, and Aspergillus hosts such as A. nidulans and A. niger.
Suitable host cells for the expression of glycosylated proteins of the invention are derived from multicellular organisms. Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruitfly), and Bombyx mori have been identified. A variety of viral strains for transfection are publicly available, e.g., the L-1 variant of Autographa californica NPV and the Bm-5 strain of Bombyx mori NPV, and such viruses may be used as the virus herein according to the present invention, particularly for transfection of Spodoptera frugiperda cells.
In some instance it will be desired to produce proteins in vertebrate cells, such as glycosylation, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV 1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59. (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); Chinese hamster ovary cells/-DHFR (CHO, Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); mouse sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N.Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; a human hepatoma line (Hep G2); and myeloma or lymphoma cells (e.g., Y0, J558L, P3 and NS0 cells) (see U.S. Pat. No. 5,807,715). Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, and tobacco can also be utilized as hosts.
Host cells are transformed with the herein-described expression or cloning vectors for protein production and cultured in conventional nutrient media modified as appropriate for inducing promoters, selecting transformants, or amplifying the genes encoding the desired sequences.
Culturing CellsThe host cells used to produce the proteins of this invention may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58:44 (1979), Barnes et al., Anal. Biochem. 102:255 (1980), U.S. Pat. Nos. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO90/03430; WO87/00195; or U.S. Pat. No. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCIN™ drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to the ordinarily skilled artisan.
Proteins disclosed herein can also be produced using cell-translation systems. For such purposes the nucleic acids encoding the polypeptide must be modified to allow in vitro transcription to produce mRNA and to allow cell-free translation of the mRNA in the particular cell-free system being utilized (eukaryotic such as a mammalian or yeast cell-free translation system or prokaryotic such as a bacterial cell-free translation system.
Proteins of the invention can also be produced by chemical synthesis (e.g., by the methods described in Solid Phase Peptide Synthesis, 2nd ed., 1984, The Pierce Chemical Co., Rockford, Ill.). Modifications to the protein can also be produced by chemical synthesis.
The proteins of the present invention can be purified by isolation/purification methods for proteins generally known in the field of protein chemistry. Non-limiting examples include extraction, recrystallization, salting out (e.g., with ammonium sulfate or sodium sulfate), centrifugation, dialysis, ultrafiltration, adsorption chromatography, ion exchange chromatography, hydrophobic chromatography, normal phase chromatography, reversed-phase chromatography, gel filtration, gel permeation chromatography, affinity chromatography, electrophoresis, countercurrent distribution or any combinations of these. After purification, polypeptides may be exchanged into different buffers and/or concentrated by any of a variety of methods known to the art, including, but not limited to, filtration and dialysis.
The purified polypeptide is preferably at least 85% pure, more preferably at least 95% pure, and most preferably at least 98% pure. Regardless of the exact numerical value of the purity, the polypeptide is sufficiently pure for use as a pharmaceutical product.
Additional Glycosylation EmbodimentsIn some embodiments it may be preferable to glycosylate proteins of the invention. Preferably, such proteins are fibronectin based scaffolds. Fibronectin based scaffolds do not normally contain glycosylation sites, however, such glycosylation may be engineered into the protein.
Glycosylation of proteins is typically either N-linked or O-linked. N-linked refers to the attachment of the carbohydrate moiety to the side chain of an asparagine residue. The tripeptide sequences asparagine-X-serine and asparagine-X-threonine, where X is any amino acid except proline, are the recognition sequences for enzymatic attachment of the carbohydrate moiety to the asparagine side chain. These can be engineered into the proteins of the invention, in particular fibronectin-based scaffold proteins and their corresponding polynucleotides. Thus, the presence of either of these tripeptide sequences in a polypeptide creates a potential glycosylation site. O-linked glycosylation refers to the attachment of one of the sugars N-aceylgalactosamine, galactose, or xylose to a hydroxyamino acid, most commonly serine or threonine, although 5-hydroxyproline or 5-hydroxylysine may also be used.
Addition of glycosylation sites to the proteins of the invention are conveniently accomplished by altering the amino acid sequence such that it contains one or more of the above-described tripeptide sequences (for N-linked glycosylation sites). The alteration may also be made by the addition of, or substitution by, one or more serine or threonine residues to the sequence of the original antibody (for O-linked glycosylation sites).
Nucleic acid molecules encoding such amino acid sequence variants of the proteins of the invention are prepared by a variety of methods known in the art. These methods include, but are not limited to, isolation from a natural source (in the case of naturally occurring amino acid sequence variants) or preparation by oligonucleotide-mediated (or site-directed) mutagenesis, PCR mutagenesis, and cassette mutagenesis of an earlier prepared variant or a non-variant version of the protein (e.g., fibronectin-based scaffold protein).
It may be desirable to modify proteins of the invention with respect to effector function, e.g., so as to enhance antigen-dependent cell-mediated cytotoxicity (ADCC) and/or complement dependent cytotoxicity (CDC) of the antibody. This may be achieved by introducing an active portion of an Fc region, as well as one or more amino acid modifications in an Fc region of the protein (e.g., fibronectin-based scaffold protein), thereby generating a variant Fc region. The Fc region variant may comprise a human Fc region sequence (e.g., a human IgG1, IgG2, IgG3 or IgG4 Fc region) comprising an amino acid modification (e.g., a substitution) at one or more amino acid positions.
In one embodiment, the variant Fc region may mediate antibody-dependent cell-mediated cytotoxicity (ADCC) in the presence of human effector cells more effectively, or bind an Fc gamma receptor (FcγR) with better affinity, than a native sequence Fc region. Such Fc region variants may comprise an amino acid modification at any one or more of positions 256, 290, 298, 312, 326, 330, 333, 334, 360, 378 or 430 of the Fc region, wherein the numbering of the residues in the Fc region is that of the EU index as in Kabat.
Additional Antibody Based Proteins, Including Moieties and DerivativesAdditional embodiments of the invention, include single domain antibodies are antibodies whose complementary determining regions are part of a single domain polypeptide. Preferably, directed to IGF-IR, as well as included in the PEG linked proteins of invention. Examples include, but are not limited to, heavy chain antibodies, antibodies naturally devoid of light chains, single domain antibodies derived from conventional 4-chain antibodies, engineered antibodies and single domain scaffolds other than those derived from antibodies. Single domain antibodies may be any of the art, or any future single domain antibodies. Single domain antibodies may be derived from any species including, but not limited to mouse, human, camel, llama, goat, rabbit, bovine. According to one aspect of the invention, a single domain antibodies as used herein is a naturally occurring single domain antibody known as heavy chain antibody devoid of light chains. Such single domain antibodies are disclosed in WO94/04678 for example. For clarity reasons, this variable domain derived from a heavy chain antibody naturally devoid of light chain is known herein as a VHH or nanobody to distinguish it from the conventional VH of four chain immunoglobulins. Such a VHH molecule can be derived from antibodies raised in Camelidae species, for example in camel, dromedary, llama, vicuna, alpaca and guanaco. Other species besides Camelidae may produce heavy chain antibodies naturally devoid of light chain; such VHHs are within the scope of the invention.
VHHs, according to the present invention, and as known to the skilled in the art are heavy chain variable domains derived from immunoglobulins naturally devoid of light chains such as those derived from Camelidae as described in WO94/04678 (and referred to hereinafter as VHH domains or nanobodies). VHH molecules are about 10.times. smaller than IgG molecules. They are single polypeptides and very stable, resisting extreme pH and temperature conditions. Moreover, they are resistant to the action of proteases which is not the case for conventional antibodies. Furthermore, in vitro expression of VHHs produces high yield, properly folded functional VHHs. In addition, antibodies generated in Camelids will recognize epitopes other than those recognized by antibodies generated in vitro through the use of antibody libraries or via immunization of mammals other than Camelids (WO9749805). As such, anti EGFR VHH's may interact more efficiently with EGFR than conventional antibodies, thereby blocking its interaction with the EGFR ligand(s) more efficiently. Since VHH's are known to bind into ‘unusual’ epitopes such as cavities or grooves (WO97/49805), the affinity of such VHH's may be more suitable for therapeutic treatment.
Another embodiment of the present invention is an anti-Epidermal Growth Factor Receptor consisting of a sequence corresponding to that of a Camelidae VHH directed towards EGFR or a closely related family member. The invention also relates to a homologous sequence, a function portion or a functional portion of a homologous sequence of said polypeptide. The invention also relates to nucleic acids capable of encoding said polypeptides. A single domain antibody of the present invention may be directed against EGFR or a closely related family member.
According to the invention, as and discussed herein, a polypeptide construct may further comprise single domain antibodies directed against other targets such as, for example, serum albumin. A single domain antibody directed against a target means a single domain antibody that is capable of binding to said target with an affinity of better than 10−6M.
The present invention further relates to single domain antibodies is a VHH belonging to a class having human-like sequences. One such class is characterized in that the VHHs carry an amino acid from the group consisting of glycine, alanine, valine, leucine, isoleucine, proline, phenylalanine, tyrosine, tryptophan, methionine, serine, threonine, asparagine, or glutamine at position 45, such as, for example, L45 and a tryptophan at position 103, according to the Kabat numbering. As such, polypeptides belonging to this class show a high amino acid sequence homology to human VH framework regions and said polypeptides might be administered to a human directly without expectation of an unwanted immune response therefrom, and without the burden of further humanization.
Another human-like class of Camelidae single domain antibodies has been described in PCT Publication No. WO03/035694 and contain the hydrophobic FR2 residues typically found in conventional antibodies of human origin or from other species, but compensating this loss in hydrophilicity by the charged arginine residue on position 103 that substitutes the conserved tryptophan residue present in VH from double-chain antibodies. As such, peptides belonging to these two classes show a high amino acid sequence homology to human VH framework regions and said peptides might be administered to a human directly without expectation of an unwanted immune response therefrom, and without the burden of further humanization. The invention also relates to nucleic acids capable of encoding said polypeptides. Polypeptides may include the full length Camelidae antibodies, namely Fc and VHH domains.
Anti-albumin VHH's may interact in a more efficient way with serum albumin which is known to be a carrier protein. As a carrier protein some of the epitopes of serum albumin may be inaccessible by bound proteins, peptides and small chemical compounds. Since VHH's are known to bind into ‘unusual’ or non-conventional epitopes such as cavities (WO97/49805), the affinity of such VHH's to circulating albumin may be more suitable for therapeutic treatment. The serum protein may be any suitable protein found in the serum of subject, or fragment thereof. In one aspect of the invention, the serum protein is serum albumin, serum immunoglobulins, thyroxine-binding protein, transferrin, or fibrinogen. Depending on the intended use such as the required half-life for effective treatment and/or compartmentalization of the target antigen, the VHH-partner can be directed to one of the above serum proteins.
“Antibody fragments” comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen. Examples of antibody fragments encompassed by the present definition include: (i) the Fab fragment, having VL, CL, VH and CH1 domains; (ii) the Fab′ fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the CH1 domain; (iii) the Fd fragment having VH and CH1 domains; (iv) the Fd′ fragment having VH and CH1 domains and one or more cysteine residues at the C-terminus of the CH1 domain; (v) the Fv fragment having the VL and VH domains of a single arm of an antibody; (vi) the dAb fragment (Ward et al., Nature 341, 544-546 (1989)) which consists of a VH domain; (vii) isolated CDR regions; (viii) F(ab′).sub.2 fragments, a bivalent fragment including two Fab′ fragments linked by a disulphide bridge at the hinge region; (ix) single chain antibody molecules (e.g., single chain Fv; scFv) (Bird et al., Science 242:423-426 (1988); and Huston et al., PNAS (USA) 85:5879-5883 (1988)); (x) “diabodies” with two antigen binding sites, comprising a heavy chain variable domain (VH) connected to a light chain variable domain (VL) in the same polypeptide chain (see, e.g., EP Patent Publication No. 404,097; WO93/11161; and Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993)); (xi) “linear antibodies” comprising a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al. Protein Eng. 8(10):1057-1062 (1995); and U.S. Pat. No. 5,641,870).
Various techniques have been developed for the production of antibody fragments that may be used to make antibody fragments used in the invention. Traditionally, these fragments were derived via proteolytic digestion of intact antibodies (see, e.g., Morimoto et al. , Journal of Biochemical and Biophysical Methods 24:107-117 (1992); and Brennan et al., Science, 229:81 (1985)). However, these fragments can now be produced directly by recombinant host cells. For example, the antibody fragments can be isolated from the antibody phage libraries discussed above. Alternatively, Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′).sub.2 fragments (Carter et al., Bio/Technology 10:163-167 (1992)). According to another approach, F(ab′).sub.2 fragments can be isolated directly from recombinant host cell culture. Other techniques for the production of antibody fragments will be apparent to the skilled practitioner. In other embodiments, the antibody of choice is a single chain Fv fragment (scFv). See WO 93/16185; U.S. Pat. No. 5,571,894; and U.S. Pat. No. 5,587,458. The antibody fragment may also be a “linear antibody”, e.g., as described in U.S. Pat. No. 5,641,870 for example. Such linear antibody fragments may be monospecific or bispecific.
Alternative Targeted Protein TherapeuticsIn certain embodiments, the proteins of the invention described herein may comprise one or more avimer sequences. Avimers are a type of binding proteins that have affinities and specificities for various target molecules, including those described herein. These proteins can be included in the PEG linked embodiments of the invention. They were developed from human extracellular receptor domains by in vitro exon shuffling and phage display. (Silverman et al., 2005, Nat. Biotechnol. 23:1493-94; Silverman et al., 2006, Nat. Biotechnol. 24:220.) The resulting multidomain proteins may comprise multiple independent binding domains, that may exhibit improved affinity (in some cases sub-nanomolar) and specificity compared with single-epitope binding proteins. In various embodiments, avimers may be attached to, for example, with PEG or polypeptide linkers. Additional details concerning methods of construction and use of avimers are disclosed, for example, in U.S. Patent Publication Nos. 20040175756, 20050048512, 20050053973, 20050089932 and 20050221384, the Examples section of each of which is incorporated herein by reference, as well as the entire document.
In certain embodiments, the proteins of the invention described herein may comprise one or more lipocalin related sequences, e.g., anticalins or lipocalin derivatives. Anticalins or lipocalin derivatives are a type of binding proteins that have affinities and specificities for various target molecules, including those described herein. Such proteins are described in US Patent Publication No. 20060058510—Anticalins, US Patent Publication No. 20060088908—“Muteins of human neutrophil gelatinase-associated lipocalin and related proteins”, US Patent Publication No. 20050106660—“Muteins of apolipoprotein d” and PCT Publication No. WO2006/056464. These proteins can be included in the PEG linked embodiments of the invention.
In certain embodiments, the proteins of the invention described herein may comprise one or more tetranectin C-type lectin related sequences or trinectins, e.g., tetranectin C-type lectin or tetranectin C-type lectin derivatives. Tetranectin C-type lectins or tetranectin C-type lectin derivatives are a type of binding proteins that have affinities and specificities for various target molecules including those described herein. Different tetranectin C-type lectin and related proteins are described in PCT Publication Nos. WO2006/053568, WO2005/080418, WO2004/094478, WO2004/039841, WO2004/005335, WO2002/048189, WO98/056906, and U.S. Patent Publication No. 20050202043. These proteins can be included in the PEG linked embodiments of the invention.
In certain embodiments, the proteins of the invention described herein may comprise one or more natural ankyrin repeat proteins, e.g., DARPins (Molecular Partners).
In certain embodiments, the proteins of the invention described herein may comprise one or more Affibodies™. Affibodies™ are derived from the IgG binding domain of Staphyloccal Protein A. Novel binding properties can be achieved by altering residues located near the binding surface of the Protein A domain.
In certain embodiments, the proteins of the invention described herein may comprise one or more cystein knot based protein scaffolds, i.e., microbodies (Selecore/NascaCell).
In certain embodiments, the proteins of the invention described herein may comprise one or more Trans-bodies™. Trans-bodies™ are based on transferrin scaffolds (BioResis/Pfizer).
In certain embodiments, the proteins of the invention described herein may comprise binding proteins based on gamma-crystallin or ubiquitin. These so-called Affilin™. (Scil Proteins) molecules are characterized by the de novo design of a binding region in beta sheet structures of the proteins. Affilin™ molecules have been described in U.S Publication No. 20070248536.
Toxins and Other Molecules Linked to Proteins of the InventionThe proteins of the invention as disclosed herein, may be linked to a cytotoxic agent. Such embodiments can be prepared by in vitro or in vivo methods as appropriate. In vitro methods, include conjugation chemistry well know in the art including chemistry compatible with proteins, such as chemistry for specific amino acids, such as Cys and Lys. In order to link a cytotoxic agent to protein of the invention, a linking group or reactive group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups. Preferred linking groups are disulfide groups and thioether groups. For example, conjugates can be constructed using a disulfide exchange reaction or by forming a thioether bond between the antibody and the cytotoxic agent. Preferred cytotoxic agents are maytansinoids, taxanes and analogs of CC-1065.
In vivo methods include linking toxic, tagging or labeling proteins to proteins of the invention as fusion proteins. A single polypeptide is produced using an encoding polynucleotide for the desired polypeptide. Toxic proteins can be controlled by expressing in toxin resistant or insensitive cells or with inducible promoters in cells that are sensitive.
Although not limiting, in various embodiments, proteins of the invention may be linked to proteins, such as a bacterial toxin, a plant toxin, ricin, abrin, a ribonuclease (RNase), DNase I, a protease, Staphylococcal enterotoxin-A, pokeweed antiviral protein, gelonin, diphtherin toxin, Pseudomonas exotoxin, Pseudomonas endotoxin, Ranpimase (Rap), Rap (N69Q), an enzyme, or a fluorescent protein.
Maytansinoids and maytansinoid analogs are among the preferred cytotoxic agents. Examples of suitable maytansinoids include maytansinol and maytansinol analogs. Suitable maytansinoids are disclosed in U.S. Pat. Nos. 4,424,219; 4,256,746; 4,294,757; 4,307,016; 4,313,946; 4,315,929; 4,331,598; 4,361,650; 4,362,663; 4,364,866; 4,450,254; 4,322,348; 4,371,533; 6,333,410; 5,475,092; 5,585,499; and 5,846,545.
Taxanes are also preferred cytotoxic agents. Taxanes suitable for use in the present invention are disclosed in U.S. Pat. Nos. 6,372,738 and 6,340,701.
CC-1065 and its analogs are also preferred cytotoxic drugs for use in the present invention. CC-1065 and its analogs are disclosed in U.S. Pat. Nos. 6,372,738; 6,340,701; 5,846,545 and 5,585,499.
An attractive candidate for the preparation of such cytotoxic conjugates is CC-1065, which is a potent anti-tumor antibiotic isolated from the culture broth of Streptomyces zelensis. CC-1065 is about 1000-fold more potent in vitro than are commonly used anti-cancer drugs, such as doxorubicin, methotrexate and vincristine (B. K. Bhuyan et al., Cancer Res., 42, 3532-3537 (1982)).
Cytotoxic drugs such as methotrexate, daunorubicin, doxorubicin, vincristine, vinblastine, melphalan, mitomycin C, chlorambucil, and calicheamicin are also suitable for the preparation of conjugates of the present invention, and the drug molecules can also be linked to the antibody molecules through an intermediary carrier molecule such as serum albumin.
For diagnostic applications, the antibodies of the present invention typically will be labeled with a detectable moiety. The detectable moiety can be any one which is capable of producing, either directly or indirectly, a detectable signal. For example, the detectable moiety may be a radioisotope, such as H3, C14 or 13, P32, S35, or 1131; a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin; or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase.
ConjugationAny method known in the art for conjugating the a protein to the detectable moiety may be employed, including those methods described by Hunter, et al., Nature 144:945 (1962); David, et al., Biochemistry 13:1014 (1974); Pain, et al., J. Immunol. Meth. 40:219 (1981); and Nygren, J. Histochem. and Cytochem. 30:407 (1982). In vitro methods, include conjugation chemistry well know in the art including chemistry compatible with proteins, such as chemistry for specific amino acids, such as Cys and Lys. In order to link a moiety (such as PEG) to a protein of the invention, a linking group or reactive group is used. Suitable linking groups are well known in the art and include disulfide groups, thioether groups, acid labile groups, photolabile groups, peptidase labile groups and esterase labile groups. Preferred linking groups are disulfide groups and thioether groups depending on the application. For fibronectin based scaffolds or other proteins with out a cys amino acid, a cys can be engineered in a location to allow for activity of the protein to exist while creating a location for conjugation.
Imaging and Other ApplicationsThe proteins of the invention also are useful for in vivo imaging, wherein an protein labeled with a detectable moiety such as a radio-opaque agent or radioisotope is administered to a subject, preferably into the bloodstream, and the presence and location of the labeled protein in the host is assayed. This imaging technique is useful in the staging and treatment of malignancies. The protein may be labeled with any moiety that is detectable in a host, whether by nuclear magnetic resonance, radiology, or other detection means known in the art.
The proteins of the invention also are useful as affinity purification agents. In this process, the antibodies are immobilized on a suitable support, such a Sephadex resin or filter paper, using methods well known in the art.
The proteins of the invention also are useful as reagents in biological research, based on their inhibition of the function of IGF-IR in cells.
The proteins of the invention can be employed in any known assay method, such as competitive binding assays, direct and indirect sandwich assays, and immunoprecipitation assays (Zola, Monoclonal Antibodies: A Manual of Techniques, pp. 147-158 (CRC Press, Inc., 1987)).
Additional Agents that May be Used with Appropriate Embodiments of the Invention
In other therapeutic treatments or compositions, the proteins of the invention are co-administered, or administered sequentially, with one or more additional therapeutic agents. Suitable therapeutic agents include, but are not limited to, targeted therapeutics, other targeted biologics, and cytotoxic or cytostatic agents. In some instances in will be preferred to administer agents from the same or separate therapeutically acceptable vial, syringe or other administration device that holds a liquid formulation.
Cancer therapeutic agents are those agents that seek to kill or limit the growth of cancer cells while having minimal effects on the patient. Thus, such agents may exploit any difference in cancer cell properties (e.g., metabolism, vascularization or cell-surface antigen presentation) from healthy host cells. Differences in tumor morphology are potential sites for intervention: for example, the second therapeutic can be an antibody such as an anti-VEGF antibody that is useful in retarding the vascularization of the interior of a solid tumor, thereby slowing its growth rate. Other therapeutic agents include, but are not limited to, adjuncts such as granisetron HCl, androgen inhibitors such as leuprolide acetate, antibiotics such as doxorubicin, antiestrogens such as tamoxifen, antimetabolites such as interferon alpha-2a, cytotoxic agents such as taxol, enzyme inhibitors such as ras farnesyl-transferase inhibitor, immunomodulators such as aldesleukin, and nitrogen mustard derivatives such as melphalan HCl, and the like.
The therapeutic agents that can be combined with proteins of the invention for improved anti-cancer efficacy include diverse agents used in oncology practice (Reference: Cancer, Principles & Practice of Oncology, DeVita, V. T., Hellman, S., Rosenberg, S. A., 6th edition, Lippincott-Raven, Philadelphia, 2001), such as docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab, capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab, 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab, idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab, tositumomab, interferon alpha-2b, melphalam, bortezomib, altretamine, asparaginase, gefitinib, erlonitib, anti-EGF receptor antibody (e.g., cetuximab or panitumab), ixabepilone, epothilones or derivatives thereof, and conjugates of cytotoxic drugs and antibodies against cell-surface receptors. Preferred therapeutic agents are platinum agents (such as carboplatin, oxaliplatin, cisplatin), taxanes (such as paclitaxel, docetaxel), gemcitabine, and camptothecin.
The one or more additional therapeutic agents can be administered before, concurrently, or after the antibody, antibody fragment or conjugate of the invention. The skilled artisan will understand that for each therapeutic agent there may be advantages to a particular order of administration. Similarly, the skilled artisan will understand that for each therapeutic agent, the length of time between which the agent, and an antibody, antibody fragment or conjugate of the invention is administered, will vary.
Formulation and AdministrationTherapeutic formulations of the invention are prepared for storage by mixing the described proteins having the desired degree of purity with optional physiologically acceptable carriers, excipients or stabilizers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of aqueous solutions, lyophilized or other dried formulations. Acceptable carriers, excipients, or stabilizers are nontoxic to recipients at the dosages and concentrations employed, and include buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyidimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride, benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrans; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g., Zn-protein complexes); and/or non-ionic surfactants such as TWEEN™, PLURONICS™ or polyethylene glycol (PEG).
The formulations herein may also contain more than one active compound as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Examples of combinations of active compounds are provided in herein. Such molecules are suitably present in combination in amounts that are effective for the purpose intended.
The active ingredients may also be entrapped in microcapsule prepared, for example, by coacervation techniques or by interfacial polymerization, for example, hydroxymethylcellulose or gelatin-microcapsule and poly-(methylmethacylate) microcapsule, respectively, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. Such techniques are disclosed in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980).
The formulations to be used for in vivo administration must be sterile. This is readily accomplished by filtration through sterile filtration membranes.
Sustained-release preparations may be prepared. Suitable examples of sustained-release preparations include semipermeable matrices of solid hydrophobic polymers containing the proteins of the invention, which matrices are in the form of shaped articles, e.g., films, or microcapsule. Examples of sustained-release matrices include polyesters, hydrogels (for example, poly(2-hydroxyethyl-methacrylate), or poly(vinylalcohol)), polylactides (U.S. Pat. No. 3,773,919), copolymers of L-glutamic acid and y ethyl-L-glutamate, non-degradable ethylene-vinyl acetate, degradable lactic acid-glycolic acid copolymers such as the LUPRON DEPOT™ (injectable microspheres composed of lactic acid-glycolic acid copolymer and leuprolide acetate), and poly-D-(−)-3-hydroxybutyric acid. While polymers such as ethylene-vinyl acetate and lactic acid-glycolic acid enable release of molecules for over 100 days, certain hydrogels release proteins for shorter time periods. When encapsulated proteins of the invention may remain in the body for a long time, they may denature or aggregate as a result of exposure to moisture at 37C, resulting in a loss of biological activity and possible changes in immunogenicity. Rational strategies can be devised for stabilization depending on the mechanism involved. For example, if the aggregation mechanism is discovered to be intermolecular S—S bond formation through thio-disulfide interchange, stabilization may be achieved by modifying sulfhydryl residues, lyophilizing from acidic solutions, controlling moisture content, using appropriate additives, and developing specific polymer matrix compositions.
While the skilled artisan will understand that the dosage of each therapeutic agent will be dependent on the identity of the agent, the preferred dosages can range from about 10 mg/square meter to about 2000 mg/square meter, more preferably from about 50 mg/square meter to about 1000 mg/square meter. For preferred agents such as platinum agents (carboplatin, oxaliplatin, cisplatin), the preferred dosage is about 10 mg/square meter to about 400 mg/square meter, for taxanes (paclitaxel, docetaxel) the preferred dosage is about 20 mg/square meter to about 150 mg/square meter, for gemcitabine the preferred dosage is about 100 mg/square meter to about 2000 mg/square meter, and for camptothecin the preferred dosage is about 50 mg/square meter to about 350 mg/square meter. The dosage of this and other therapeutic agents may depend on whether the antibody, antibody fragment or conjugate of the invention is administered concurrently or sequentially with a therapeutic agent.
For therapeutic applications, the proteins or conjugates of the invention are administered to a subject, in a pharmaceutically acceptable dosage form. They can be administered intravenously as a bolus or by continuous infusion over a period of time, by intramuscular, subcutaneous, intra-articular, intrasynovial, intrathecal, oral, topical, or inhalation routes. The protein may also be administered by intratumoral, peritumoral, intralesional, or perilesional routes, to exert local as well as systemic therapeutic effects. Suitable pharmaceutically acceptable carriers, diluents, and excipients are well known and can be determined by those of skill in the art as the clinical situation warrants. Examples of suitable carriers, diluents and/or excipients include: (1) Dulbecco's phosphate buffered saline, pH about 7.4, containing about 1 mg/ml to 25 mg/ml human serum albumin, (2) 0.9% saline (0.9% w/v NaCl), and (3) 5% (w/v) dextrose. The method of the present invention can be practiced in vitro, in vivo, or ex vivo.
Administration of a protein of the invention, and one or more additional therapeutic agents, whether co-administered or administered sequentially, may occur as described above for therapeutic applications. Suitable pharmaceutically acceptable carriers, diluents, and excipients for co-administration will be understood by the skilled artisan to depend on the identity of the particular therapeutic agent being co-administered.
When present in an aqueous dosage form, rather than being lyophilized, the protein typically will be formulated at a concentration of about 0.1 mg/ml to 100 mg/ml, although wide variation outside of these ranges is permitted. For the treatment of disease, the appropriate dosage of antibody or conjugate will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the antibodies are administered for preventive or therapeutic purposes, the course of previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The protein is suitably administered to the patient at one time or over a series of treatments.
Depending on the type and severity of the disease, preferably from about 1 mg/square meter to about 2000 mg/square meter of protein is an initial candidate dosage for administration to the patient, more preferably from about 10 mg/square meter to about 1000 mg/square meter of antibody whether, for example, by one or more separate administrations, or by continuous infusion. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and are not excluded.
The present invention also includes kits comprising one or more of the elements described herein, and instructions for the use of those elements. In a preferred embodiment, a kit of the present invention includes antibody, antibody fragment or conjugate of the invention, and a therapeutic agent. The instructions for this preferred embodiment include instructions for inhibiting the growth of a cancer cell using the protein of the invention, and the therapeutic agent, and/or instructions for a method of treating a patient having a cancer using the antibody, antibody fragment or conjugate of the invention, and the therapeutic agent.
Preferably, the therapeutic agent used in the kit is selected from the group consisting of docetaxel, paclitaxel, doxorubicin, epirubicin, cyclophosphamide, trastuzumab, capecitabine, tamoxifen, toremifene, letrozole, anastrozole, fulvestrant, exemestane, goserelin, oxaliplatin, carboplatin, cisplatin, dexamethasone, antide, bevacizumab, 5-fluorouracil, leucovorin, levamisole, irinotecan, etoposide, topotecan, gemcitabine, vinorelbine, estramustine, mitoxantrone, abarelix, zoledronate, streptozocin, rituximab, idarubicin, busulfan, chlorambucil, fludarabine, imatinib, cytarabine, ibritumomab, tositumomab, interferon alpha-2b, melphalam, bortezomib, altretamine, asparaginase, gefitinib, erlonitib, anti-EGF receptor antibody (e.g., cetuximab or panitumumab), ixabepilone, and an epothilone or derivative thereof. More preferably, the therapeutic agent is a platinum agent (such as carboplatin, oxaliplatin, cisplatin), a taxane (such as paclitaxel, docetaxel), gemcitabine, or camptothecin.
The elements of the kits of the present invention are in a suitable form for a kit, such as a solution or lyophilized powder. The concentration or amount of the elements of the kits will be understood by the skilled artisan to varying depending on the identity and intended use of each element of the kit.
The cancers and cells there from referred to in the instructions of the kits include breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer, lung cancer, synovial carcinoma, pancreatic cancer, melanoma, multiple myeloma, neuroblastoma, and rhabdomyosarcoma.
Additional Patent ReferencesMethods and compositions described in the following additional Patent Applications and Patents are also included in this disclosure:
U.S. Patent Publication Nos. 20050186203; 20050084906; 20050008642; 20040202655; 20040132028; 20030211078; 20060083683; 20060099205; 20060228355; 20040081648; 20040081647; 20050074865; 20040259155; 20050038229; 20050255548; 20060246059; and U.S. Pat. Nos. 5,707,632; 6,818,418; and 7,115,396; and PCT Publication Nos. WO2005/085430; WO2004/019878; WO2004/029224; WO2005/056764; WO2001/064942; and WO2002/032925. This application claims priority to U.S. Provisional Application Nos. 60/860,605 and 60/879,666 filed Nov. 22, 2006 and Jan. 9, 2007, respectively, the contents of which are incorporated by reference in their entirety.
INCORPORATION BY REFERENCEAll documents and references, including patent documents and websites, described herein are individually incorporated by reference to into this document to the same extent as if there were written in this document in full or in part.
EXAMPLESThe invention is now described by reference to the following examples, which are illustrative only, and are not intended to limit the present invention. While the invention has been described in detail and with reference to specific embodiments thereof, it will be apparent to one of skill in the art that various changes and modifications can be made thereto without departing from the spirit and scope thereof.
Example 1 Initial Identification of IGF-IR Binding MoleculesA library of approximately 1013 RNA-protein fusion variants was constructed based on the scaffold of the tenth type 3 domain of human fibronectin with three randomized regions at positions 23-29, 52-55 and 77-86 (amino acid nos. are referenced to SEQ ID NO:1) (three loop library; Xu et al, Chemistry & Biology 9:933-942, 2002). After conversion to mRNA/cDNA heteroduplexes, the library of a trillion mRNA/cDNA-protein fusions was bound to 100 nM biotinylated IGF-IR in solution, and captured on streptavidin-coated magnetic beads. The cDNA was eluted, amplified by PCR, and used to generate a new library of mRNA/cDNA-protein fusions. Five rounds of selection were carried out in this manner and the percentage of library binding to IGF-IR was monitored by quantitative PCR after every round to identify target binding enrichment (
Proteins encoded by independent clones were analyzed for inhibition of target binding in the presence of IGF-IR using a competitive binding assay. Over one hundred clones were identified that inhibited the binding of IGF-I to IGF-IR, suggesting that these clones bound IGF-IR at or near the natural ligand (IGF-I) binding site. The SEQ ID NOs (see
The purity and electrophoretic properties of selected clones were examined by SDS-PAGE (
Clones that were able to compete with IGF-I were sequenced and aligned using Vector NTI (Invitrogen). Most of the clones fell into three distinct families. One family was recognized by a conserved valine at position 6 of the BC loop and variable length FG loops containing a conserved arginine and tyrosine (Clones 218C04, 215D09, 214C04, 214F03, 214CO3, 214E01, and 218F09). A second family was recognized by a conserved tyrosine and proline in the DE loop and was usually associated with an FG loop of exactly 10 amino acids (Clones 225D03, 215E09, 215B07, 215D11, 218E09, 309B01, 310A01, and 310A03). A third family of clones had an FG loop of 14 amino acids with conserved hydrophobic amino acids (Clones 223B01, 223B02, and 218F08). The remaining clones showed no similarity to the other families, could not be grouped into distinct families, and are not shown.
Example 5 Identification of a Candidate Clone Suitable for OptimizationThe clones resulting from the above selection process are likely not to meet the stringent affinity, specificity, and biophysical requirements of a biotherapeutic and therefore require further mutagenesis wherein the binding loops are refined, or “optimized.” In order to identify the clones farthest along this trajectory, a selected number of candidates were subjected to in-depth characterization. In this example, the characterization of one IGF-IR-competitive clone, 218C04, is described.
A one liter E. coli growth was prepared and clone 218C04 was purified as indicated by SDS PAGE (
In the following example, the optimization of one IGF-IR-specific clone, 218C04, is described.
The sequence of clone 218C04 with the BC, DE, and FG loops, respectively, underlined is shown:
Three libraries were constructed in which one loop at a time was replaced with random sequence. The libraries were constructed at the DNA level as described below, except that random sequences in two out of three loops were replaced with fixed sequence corresponding to clone 218C04.
Amplification, synthesis of mRNA-protein fusions, and affinity selection were carried out with these three libraries. Binding percentages were monitored each round (
The master library containing all 3 optimized loops was taken through cycles of amplification, synthesis of mRNA-protein fusions, and affinity selections. IGF-IR was used at decreasing concentrations to select for the highest affinity binders (
Selected optimized fibronectin-based scaffold proteins were compared to a pre-optimized clone, clone 218C04 in this example, for their ability to inhibit the interaction between IGF-I and IGF-IR, in a competitive assay. Following HTPP and quantitation, many clones exhibit superior inhibition to the staring clone with IC50s in the low nM range (
Following optimization of selected clones and assessment of derivatives for inhibition of the IGF-IGF-IR interaction in a competitive assay, clones were sequenced. See SEQ ID NOS: 110-125 in
The FG loops of optimized clones also shared conserved residues with the parental clone 218C04 in specific positions in spite of variations in loop length. For this particular family of clones, the arginine-X-tyrosine motif appears to be an important motif required for functionality. This is found in all but one derivative clone and in this clone (354C10, arginine-X-valine) appears to be a tolerated, conservative substitution. Therefore, for the 218C04 family of clones, there appear to be four dominant positions, two in the BC loop and two in the FG loop, that appear to play the largest role in defining IGF-IR binding and inhibitory activity.
One liter E. coli growths of selected optimized clones were prepared and the proteins were purified. SDS PAGE (
One liter E. coli growths of selected IGF-IR optimized clones were prepared and the proteins were purified. Differential Scanning calorimetry (DSC) was performed to characterize the energetics of unfolding, or melting temperature, Tm, of individual clones. Clone 338A06 exhibited an unfolding temperature of 62° C. (
One liter E. coli growths of selected optimized clones were prepared and the proteins were purified. Size-exclusion chromatography (SEC) revealed monomeric behavior, in this example for clone 338A06 (
One liter E. coli growths of selected optimized clones were prepared and the proteins were purified. Surface plasmon resonance (BIAcore) analysis was performed using recombinant, immobilized IGF-IR and solution-phase clones in order to determine binding kinetics and binding affinities. As shown in Table 4, binding affinities ranged from double-digit pM to single digit nM KDs for the clones shown in the present example. Off-rates were in the 10−4 (1/s) range and on-rates were very fast, typically ˜106 (1/M·s).
One liter E. coli growths of selected optimized clones were prepared and the proteins were purified. The homology of human IGF-IR to the human insulin receptor is approximately 56%. To ensure that the IGF-IR competitive clones are indeed specific for IGF-IR, they were evaluated at high concentration against the human insulin receptor using BIAcore methodology. The human insulin receptor was immobilized onto a BIAcore chip as was an irrelevant protein to control for non-specific binding. Clones were passed over the chip at 10 μM, a concentration which is more than 10,000-fold greater than the KD of binding IGF-IR for the majority of clones. The percentage of signal for insulin binding at similar concentration was recorded and is presented in Table 5. The majority of clones exhibited no or barely detectable binding to the insulin receptor at this high concentration illustrating that they indeed are specific to IGF-IR. The clones exhibiting some degree of binding to the insulin receptor appear to be selective binders.
Mass spectrometry of the purified, optimized IGF-IR clones was performed to ensure identity. In the present example, clone 338A06 was examined. The predicted mass of clone 338A06 is 11741 atomic mass units (amu). MALDI TOF mass spectrometry of clone 338A06 revealed a mass of 11741 m/z after calibration with standards (
The purified, optimized IGF-IR clones were evaluated in cell-based assays in order to confirm activity. In one example, the inhibition of IGF-I-mediated mitogenesis by a selected clone 338A06 is demonstrated as shown in
In a second cell-based assay, the inhibition of radiolabelled IGF-I binding to an IGF-IR-expressing cancer cell line by clone 338A06 is demonstrated. Human breast adenocarcinoma MCF-7 cells were pre-incubated for 30 minutes with clone 338A06, monoclonal antibody MAB391, or unlabeled IGF-1. After the incubation period, radiolabelled IGF-I was added. Cells were subsequently lysed and radioactivity was quantitated. As shown in
One of the commonly seen degradation processes seen for proteins during storage is the oxidation of methionine residues which may result in the potential loss of chemical and physical stability and biological activity. While the fibronectin-based scaffold protein clones do not contain methionine residues in their backbone, a selected number of IGF-IR competitive clones contain methionine in their loops. Optimization was performed in order to select for clones which retained the desirable properties of biological activity and biophysical properties of the starting clone but substituted the undesirable methionine residue(s) in the loops. In the present example, the optimization of clone 338A06, which contains a methionine residue in the FG loop, is shown.
Clone 338A06 was optimized using a single library with 6 random amino acids in the FG loop. The sequence of 338A06 (SEQ ID NO: 111) was incorporated into the BC and DE loops of the new library using the appropriate oligonucleotides.
The library was constructed as described below and double-stranded DNA was converted into mRNA-protein fusions to give about 1000 copies of each FG loop sequence. PROfusion cycles of amplification, mRNA-protein fusion formation and affinity selection were carried out. In the first round, the biotinylated IGF-IR concentration was 100 nM, but this was dropped in subsequent rounds to enrich for the highest affinity binders.
Example 17 Direct Binding Assay for Optimized Derivatives of 338A06A direct binding assay was used to screen optimized derivatives of clone 338A06 for enhanced binding to IGF-IR. Clones that showed binding in a single-point assay were analyzed further using a gradient of clone concentrations. As shown in
Following FG loop optimization of the 338A06 clone and assessment of derivatives for binding to IGF-IR in the direct binding assay, clones were sequenced. See SEQ ID NOS: 184-202 of
Consistent with the 218C04 derivation of these clones, the arginine-X-tyrosine motif is retained in all of the products of the 338A06 FG loop optimization effort. This provides yet additional evidence these two residues in this register appear to be dominant determinants in IGF-IR binding and inhibition in the context of the fibronectin-based scaffold protein fold for this particular family.
Size-exclusion chromatography (SEC) of HTPP material for FG loop optimized 338A06 IGF-IR competitive clones revealed monomeric behavior indicating that at higher protein concentration, optimized clones did not have a tendency to aggregate. Nine clones derived from the optimization and HTPP are presented in this example (
One liter E. coli growths of selected FG loop optimized 338A06 IGF-IR competitive clones were prepared and the proteins were purified. BIAcore analysis was performed using recombinant, immobilized IGF-IR and solution-phase clones in order to determine binding kinetics and binding affinities. As shown in Table 7, binding affinities ranged from double-digit to triple digit pM for the clones shown in the present example. Off-rates were in the 10−4 (1/s) range and on-rates were very fast, typically ˜106 (1/M·s).
One liter E. coli growths of selected FG loop optimized 338A06 IGF-IR competitive clones were prepared and the proteins were purified. The homology of human IGF-IR to the human insulin receptor is approximately 56%. To ensure that the IGF-IR competitive clones are indeed specific for IGF-IR, they were evaluated at high concentration against the human insulin receptor using BIAcore methodology. The human insulin receptor was immobilized onto a BIAcore chip as was an irrelevant protein to control for non-specific binding. Clones were passed over the chip at 10 μM, a concentration which is more than 10,000-fold greater than the KD of binding IGF-IR for the majority of clones. The percentage of signal for insulin binding at similar concentration was recorded and is presented in Table 8. The majority of clones exhibited no detectable binding to the insulin receptor at this high concentration illustrating that these clones are indeed specific to IGF-IR.
One liter E. coli growths of selected FG loop optimized 338A06 IGF-IR competitive clones were prepared and the proteins were purified. Differential Scanning calorimetry (DSC) was performed to characterize the energetics of unfolding, or melting temperature, Tm, of individual clones. The clones tested exhibited unfolding temperatures of 58-63° C. indicating highly stable structures. The melting temperatures of the optimized clones are found in Table 9.
One liter E. coli growths of selected FG loop optimized 338A06 IGF-IR competitive clones were prepared and the proteins were purified. Size-exclusion chromatography (SEC) of HTPP material for FG loop optimized 338A06 IGF-IR competitive clones revealed monomeric behavior indicating that at higher protein concentrations, optimized clones did not have a tendency to aggregate. In this example, the SEC profile of a representative clone 387B01 is presented (
One liter E. coli growths of selected FG loop optimized 338A06 IGF-IR competitive clones were prepared and the proteins were purified. Reversed-Phase High Performance Liquid Chromatography (RP-HPLC) was performed to characterize the purity of clones as well as to establish clone homogeneity. All clones exhibited excellent purity and homogeneity following a single column purification that exploits the C-termini tag engineered into their C-termini as exemplified by the representative chromatogram shown in
One liter E. coli growths of selected FG loop optimized 338A06 IGF-IR competitive clones were prepared and the proteins were purified. Mass spectrometry of the purified, optimized IGF-IR clones was performed to ensure identity. In the present example, clone 387B01 was examined. The predicted mass of clone 387B01 is 11554 atomic mass units (amu). MALDI TOF mass spectrometry of clone 387B01 revealed a mass of approximately 11553 m/z after calibration with standards, well within experimental error of the instrumentation (
In order to perform in vivo studies, PEGylation of the fibronectin-based scaffold proteins was performed. In the present example, clone 385A08 was produced in an E. coli expression system with a C-terminal extension to yield the following protein sequence (C-terminal extension italicized in bold with Cys97 underlined):
The single sulfhydryl of the cysteine residue at position 97 was used to couple to PEG variants using standard maleimide chemistry to yield two different PEGylated forms of 385A08. Both a linear 20 kDa bifunctional PEG and a mono-functional branched 40 kDa PEG (NOF Corporation) were conjugated to clone 385A08 to produce 385A08-PEG20-385A08 and 385A08-PEG40, respectively. The PEGylated protein forms were purified from unreacted protein and PEG by anion exchange and size-exclusion chromatography. Covalent linkage of the two PEG forms of 385A08 was verified by SDS-PAGE (
Surface plasmon resonance (BIAcore) analysis was performed using recombinant, immobilized IGF-IR and solution-phase analyte in order to determine binding kinetics and binding affinities of 385A08-PEG20-385A08 and 385A08-PEG40 variants. While the 385A08-PEG40 form was found to have an approximately 10-fold slower on-rate (ka) relative to unmodified 385A08, the 385A08-PEG20-385A08 form has an approximately two-fold faster on-rate (Table 10). The off-rates (kd; Table 10) of the variants relative to unmodified 385A08 were slightly increased for the 385A08-PEG40 form and slightly decreased for the 385A08-PEG20-385A08 variant.
The PEGylated fibronectin-based scaffold variants were assessed for inhibition of serum mediated proliferation using the human plasmacytoma cell line NCI-H929. In this cell line, the anti-IGF-IR MAB391 and the unmodified 385A08 demonstrated comparable degrees of inhibition of cell growth with an apparent IC50 of approximately 100 pM. The 385A08-PEG40 variant was slightly less inhibitory with an IC50 approaching 1 nM. On the other hand, the PEG20-385A08-PEG20 variant was extremely potent and essentially 100% inhibitory at all concentrations tested. Therefore an IC50 was less than 100 fM.
Example 29 Evaluation of Multimers of Fibronectin Scaffold IGF-IR Binders in an IGF-IR Proliferation AssayA murine lymphocyte cell line, 32D, expressing human IGF-IR was used to evaluate effects of IGF-IR antagonists. Antagonists comprising two fibronectin scaffold IGF-IR binding domains demonstrated a marked increase in inhibitory effects over a single fibronectin scaffold domain or an anti-IGF-IR antibody.
Example 30 Evaluation of Bispecific Fibronectin Scaffold Multimers in an IGF-IR Proliferation AssayFibronectin scaffold proteins were assessed for inhibition of serum mediated proliferation using the human plasmacytoma cell line NCI-H929. In this cell line, the IGF-IR fibronectin scaffold and the IGF-IR/VEGFR2 bispecific fibronectin scaffold multimer demonstrated comparable degrees of inhibition of cell growth.
Example 31 Evaluation of Bispecific Fibronectin Scaffold Multimers in a VEGFR2 Proliferation AssayFibronectin scaffold proteins were assessed for inhibition of a VEGF-dependent cell line. In this cell line, the VEGFR2 fibronectin scaffold and the IGF-IR/VEGFR2 bispecific fibronectin scaffold multimer demonstrated comparable degrees of inhibition of cell growth.
Example 32 Evaluation of Fibronectin Scaffold IGF-IR Binder HSA ConjugateFibronectin scaffold proteins were assessed for inhibition of serum mediated proliferation using the human plasmacytoma cell line NCI-H929. IGF-IR and IGF-IR/HSA proteins demonstrated comparable degrees of inhibition of cell growth (see
Various IGF-IR antagonists were tested for their in vivo antitumor activity in RH41 sarcoma xenografts (see
Polypeptide fusion proteins of HSA-IGF-IR may also be generated. The following lists various N- and C-terminal HSA fusions to IGF-IR clone 385A08. The HSA leader and propeptide sequence is omitted in the C-terminal constructs. Fn linker1 is derived from the amino acid sequence linking the first and second fibronectin type III domains. Fn linker2 is derived from the amino acid sequence linking the tenth and eleventh fibronectin type III domains (see
Human serum albumin (unprocessed)-Fn linker1-385A08; SEQ ID NO: 228
385A08-Fn linker1-Human serum albumin (processed); SEQ ID NO: 229
Human serum albumin (unprocessed)-Fn linker2-385A08; SEQ ID NO: 230
Human serum albumin (unprocessed)-(GS)5 linker-385A08; SEQ ID NO: 231
Human serum albumin (unprocessed)-(GS)10 linker-385A08; SEQ ID NO: 232
385A08-Fn linker2-Human serum albumin (processed); SEQ ID NO: 233
385A08-(GS)5 linker-Human serum albumin (processed); SEQ ID NO: 234
385A08-(GS)10 linker-Human serum albumin (processed); SEQ ID NO: 235
Fibronectin scaffold proteins fused to transferrin are assessed for inhibition of serum mediated proliferation using the human plasmacytoma cell line NCI-H929.
Polypeptide fusion proteins of transferrin-IGF-IR may be generated. The following lists various N- and C-terminal transferrin fusions to IGF-IR clone 385A08. The transferrin leader sequence is omitted in the C-terminal constructs (see
Human transferrin (unprocessed)-Fn linker1-385A08; SEQ ID NO: 236
385A08-Fn linker1-Human transferrin (processed); SEQ ID NO: 237
Human transferrin (unprocessed)-Fn linker2-385A08; SEQ ID NO: 238
Human transferrin (unprocessed)-(GS)5 linker-385A08; SEQ ID NO: 239
Human transferrin (unprocessed)-(GS)10 linker-385A08; SEQ ID NO: 240
385A08-Fn linker2-Human transferrin (processed); SEQ ID NO: 241
385A08-(GS)5 linker-Human transferrin (processed); SEQ ID NO: 242
385A08-(GS)10 linker-Human transferrin (processed); SEQ ID NO: 243
Fibronectin-based scaffold proteins fused to Fc were evaluated for their ability to inhibit various cell lines. The IC50 values were determined for 385A08-Fc (amino acids 90-423 of SEQ ID NO: 247) in Rh41 cells (4.5 nM), DU4475 cells (>50 nM), H929 cells (0.15 nM), BXPC-3 (>500 nM), and HT-29 cells (>1000 nM). The IGF-IR-Fc fusion demonstrated a 91% maximum inhibition in the Rh41 cell line.
Fibronectin-based scaffold proteins fused to Fc were evaluated for their ability to inhibit IGF-1R, AKT and MAPK phosphorylation in Rh41 human rhabdomyosarcoma cells (see
Fibronectin-based scaffold proteins fused to Fc were evaluated for their ability to inhibit proliferation in Rh41 and H929 cell lines (Table 12). Cells were treated with nM concentrations of 385A08-Fc as noted. The IC50 values are as follows: Rh41 Trial 1 (48.65 nM), Rh41 Trial 2 (39.43 nM), average of Rh1 trials (44 nM), and H929 trial (0.15 nM).
The following materials and methods were used for the experiments described in the previous examples.
Recombinant Proteins:Recombinant human, IGF-I, IGF-IR, insulin receptor (IR), anti-IGF-IR MAB391, and recombinant human VEGF-R2-Fc were obtained from R&D Systems (Minneapolis, Minn.). Biotinylation of IGF-IR was carried out in 1×PBS at 4° C. for 2 hours in the presence of EZ-Link™ Sulfo-NHS-LC-LC-Biotin (Pierce, Ill.). Excess of EZ-Link™ Sulfo-NHS-LC-LC-Biotin was removed by dialysis against 1×PBS. The level of biotinylation was determined by mass spectroscopy and protein concentrations were determined using Coomassie Protein Plus Assay (Pierce, Ill.).
Primers:The following oligonucleotides were prepared by chemical synthesis for eventual use in library construction and mutagenesis of selected clones.
A diverse library was constructed by extension of the overlapping synthetic oligonucleotides listed above, using KOD polymerase (EMD Biosciences, San Diego, Calif.). In these oligonucleotide designations, “N” indicates a mixture of A, C, G and T; and “S” indicates a mixture of C and G. Loop definitions are identical to those described previously (Xu et al, 2002). The BC loop was constructed by extension of 50 pmol FnBC with 100 pmol FnCD in a 100 μD reaction that was supplemented with 1M Betaine and 3% DMSO. The reaction was taken through 10 temperature cycles of 30s at 94° C., 30s at 52° C. and 1 min at 68° C. to ensure complete extension of the fragments. The DE and FG loops were constructed in a similar manner, using 200 pmol FnDE with 100 pmol FnEF for the DE loop and 100 pmol FnFG10 with 200 pmol FnG for the FG loop. Following extension of the 3 individual loops, the DE and FG loops were combined and extended together for an additional 10 temperature cycles of 30s at 94° C., 30s at 52° C. and lmin at 68° C. The BC loop was extended with 100 pmol FnAB in the same manner. The DE/FG mixture and the BC loop were each diluted 10-fold with fresh KOD reagents and extended with FLAG and T7TMV respectively, for 10 temperature cycles 30s at 94° C., 30s at 52° C. and lmin at 68° C. Finally the fragments were combined and extended together for 10 temperature cycles of 30s at 94° C., 30s at 52° C. and lmin at 68° C. This produced a library with 7 random amino acids in the BC loop, 4 random amino acids in the DE loop, and 10 random amino acids in the FG loop. Additional libraries were constructed with different FG loop lengths by using oligonucleotides FnFG6, FnFG8, FnFG12 or FnFG14 instead of FnFG10. The libraries containing FG loop lengths between 6 and 14 amino acids were combined to give a variable-length FG library.
Construction of Single-Loop Randomized Libraries from Clone 218C04:
Three libraries were constructed in which single loops were replaced with random sequence. The libraries were constructed at the DNA level by overlap extension with KOD polymerase as described above, except that random sequences in two out of three loops were replaced with fixed sequence corresponding to clone 218C04. The fixed sequences were provided in the BC loop by oligonucleotide 218C04BC, and in the DE loop by oligonucleotide 218C04DE, and in the FG loop by oligonucleotide 218C04FG. These replaced the corresponding random oligonucleotides FnBC, FnDE, or FnFG10 during library construction.
The library in which the BC loop from clone 218C04 was replaced by random amino acids was made by assembling the oligonucleotides: T7TMV+FnAB+FnBC+FnCD+218C04DE+FnEF+218C04FG+FnG+FLAG as described above. The library in which the DE loop from clone 218C04 was replaced by random amino acids was made by assembling the oligonucleotides: T7TMV+FnAB+218C04BC+FnCD+FnDE+FnEF+218C04FG+FnG+FLAG. The library in which the FG loop from clone 218C04 was replaced by random amino acids was assembled from the oligonucleotides: T7TMV+FnAB+218C04BC+FnCD+218C04DE+FnEF+FnFG10+FnG+FLAG.
Construction of 3-Loop Randomized Libraries from Clone 218C04:
The three single-loop libraries derived from clone 218C04 were subjected to PROfusion selection as described above. The surviving clones in each library contained 2 loops from the parent clone and 1 loop from the random sequence that was compatible with binding of each fibronectin-based scaffold protein. The three random loops, one from each library, were amplified using oligonucleotide primers that bound the surrounding scaffold regions. The BC loop was amplified from the library containing the variable BC loop using oligonucleotide primers FnB and FnCD. The DE loop was amplified from the library containing the variable DE loop using oligonucleotide primers FnD and FnEF. The FG loop was amplified from the library containing the variable FG loop using oligonucleotide primers FnF and FnG. The three excised loops were purified by agarose gel electrophoresis, mixed in equal proportions and amplified by KOD polymerase with primers FnAB and FnG followed by T7TMV and FLAG.
Construction of a Single-Loop Random FG Library from Clone 338A06:
A library was constructed in which the FG loop of clone 338A06 was replaced by 6 random amino acids. KOD polymerase was used for overlap extension of the oligonucleotides T7TMV+FnAB+338A06BC+FnCD+338A06DE+FnEF+FnFG6+FnG+FLAG as described above. The loop sequences corresponding to clone 338A06 were introduced by oligonucleotides 338A06BC and 338A06DE, and the random 6-amino acid FG loop was introduced by oligonucleotide FnFG6.
RNA-Protein Fusion Production:Double-stranded DNA libraries were converted into RNA-protein fusions (PROfusion) essentially as described (Xu et al, 2002, Kurz et al, Nuc. Acid Res. 28:83, 2000). Briefly, the DNA library was transcribed using an in vitro transcription kit (MEGAscript™, Ambion, Austin, Tex.) and the resulting RNA was desalted by size exclusion chromatography on a NAP-5 column (GE Healthcare). 2 nmol RNA was crosslinked by irradiation at 314 nM for 20 min in 200 μl of a solution containing 150 mM NaCl, 10 mM Tris-HCl (pH8) and a 1.5-fold excess of puromycin-containing linker (5′-Pso u agc gga ugc XXX XXX CC Pu-3′ (Pu=puromycin, Pso=C6-psoralen, u, a, g, c=2′-OMe-RNA, X=9-atom PEG spacer.))
The mRNA-puromycin molecules were then translated in 3 ml rabbit reticulocyte lysate (Ambion, Austin, Tex.) in the presence of 35S-labeled methionine. The resulting mRNA-protein fusions were purified using oligo dT cellulose (GE Healthcare) and reverse-transcribed using superscript II reverse transcriptase (Invitrogen) and 2 nmol of the primer FLAG according to the manufacturers instructions.
The cDNA/mRNA-protein fusions were purified by M2 Flag agarose (Sigma, St Louis, Mo.) and quantitated by measuring the incorporated 35S methionine. This gave a purified library of approximately 1012 full length fibronectin-based scaffold proteins that were amplified by PCR using primers T7TMV and FLAG for use in subsequent PROfusion experiments.
Affinity Selection for Binding to IGF-IR:Libraries of mRNA-protein fusions, prepared as described above, were incubated with Streptavidin-coated magnetic beads (M280 Streptavidin, Invitrogen) to remove fibronectin-based scaffold proteins that bind to Streptavidin. The beads were separated on a magnet and the unbound fraction was collected and added to 100 nM biotinylated IGF-IR in PBS with 0.05% Tween 20 and 1 mg/ml BSA (Ambion). After 30 min, the bound fibronectin-based scaffold proteins were captured on Streptavidin-coated magnetic beads and washed 6 times using a Kingfisher magnetic particle processor (Thermo Electron, Waltham, Mass.). The cDNA was eluted in 100 mM KOH, neutralized with 100 mM Tris-HCl, and amplified by PCR to generate a second-generation library enriched in molecules that bind IGF-IR. The consecutive processes of amplification, synthesis of mRNA-protein fusions, and affinity selection were carried out a total of 5 times and the number of bound molecules was monitored by quantitative PCR. The fibronectin-based scaffold protein populations obtained after rounds 4 and 5 were amplified and ligated by recombination (InFusion™, Clontech, Mountain View, Calif.) into an E. coli expression vector containing a promoter for T7 RNA polymerase and an in-frame His6 tag. The ligated mixture was transformed into E. coli strain BL21 (DE3) pLysS (Invitrogen) that expresses T7 RNA polymerase upon induction with IPTG, thereby giving inducible protein expression.
Optimization of Clone 218C04 Containing 3 Random Loops:The 3-loop randomized 218C04 library was taken through cycles of amplification, synthesis of mRNA-protein fusions, and affinity selections as described above. For the first round, IGF-IR was immobilized on epoxy-activated beads to avoid selection of streptavidin-binding peptides. Thereafter, biotinylated IGF-IR was used at decreasing concentrations to select for the highest affinity binders. From round 2 onwards, non-biotinylated insulin receptor (IR) was also included at a concentration of 1 μM to act as a negative selection for IR binding. After 4 rounds, the resulting fibronectin-based scaffold protein populations were cloned into E. coli for analysis as described above.
Optimization of Clone 338A06 Containing a 6 Amino Acid Random FG Loop:The DNA library was converted into mRNA-protein fusions as described above to give about 1000 copies of each FG loop sequence. PROfusion cycles of amplification, mRNA-protein fusion formation and affinity selection were carried out as described above. In the first round, the biotinylated IGF-IR concentration was 100 nM, but this was dropped to 0.8 nM in round 2 and 0.4 nM in round 3. The target concentration was chosen such that the percentage of mRNA-protein fusions bound to IGF-IR was less than 0.1% in each case, as measured by quantitative PCR. By this method, fibronectin-based scaffold proteins with improved affinity would have an advantage compared to the population as a whole.
Competitive ELISA for IGF-IR:MaxiSorp™ plates (Nunc International, Rochester, N.Y.) were coated with 30 nM IGF-IR in PBS at 4° C. overnight followed by blocking in OptEIA buffer (BD biosciences, San Diego, Calif.) for 3 hours at room temperature. Purified fibronectin-based scaffold proteins in OptEIA buffer were bound to each well for 1 hour at room temperature at concentrations ranging from 50 pM to 1 μM. After washing in PBST to remove unbound fibronectin-based scaffold proteins, 10 nM biotinylated IGF-I (Upstate, Temecula, Calif.) was added for 1 hour at room temperature to bind to unoccupied IGF-IR. The excess ligand was removed by washing with PBST and bound ligand was detected with streptavidin-HRP (Pierce, Rockford, Ill.) using TMB detection reagents (BD biosciences) according to the manufacturer's instructions
Direct Binding ELISA for IGF-IR:MaxiSorp™ plates (Nunc International, Rochester, N.Y.) were coated with 10 nM IGF-IR in PBS at 4° C. overnight followed by blocking in PBS-casein buffer (Pierce) for 3 hours at room temperature. Purified fibronectin-based scaffold proteins in casein buffer were bound to each well for 1 hour at room temperature at a concentration of 5 nM. The plate was washed with PBST and 100 μl of a 1:4000 dilution of His-HRP probe (Pierce) was added to each well with incubation for 15 min at room temperature. The wells were washed 5 times with PBST and the bound HRP was detected with TMB detection reagents (BD biosciences) according to the manufacturer's instructions. Clones that showed binding in this single-point assay were analyzed further using a gradient of fibronectin-based scaffold protein concentrations ranging from 30 pmol to 330 nM.
High Throughput Protein Production (HTPP):Selected binders cloned into pDEST-14 vector and transformed into E. coli BL21 (DE3) pLysS cells were inoculated in 5 ml LB medium containing 50 μg/mL carbenicillin and 34 μg/mL chloromphenicol in a 24-well format and grown at 37° C. overnight. Fresh 5 ml LB medium (50 μg/mL carbenicillin and 34 μg/mL chloromphenicol) cultures were prepared for inducible expression by aspirating 200 μl from the overnight culture and dispensing it into the appropriate well. The cultures was grown at 37° C. until A600 0.6-1.0. After induction with 1 mM isopropyl-β-thiogalactoside (IPTG) the culture was grown for another 4 hours at 30° C. and harvested by centrifugation for 30 minutes at 3220 g at 4° C. Cell Pellets were frozen at −80° C.
Cell pellets (in 24-well format) were lysed by resuspension in 450 μl of Lysis buffer (50 mM NaH2PO4, 0.5 M NaCl, 1× Complete™ Protease Inhibitor Cocktail-EDTA free (Roche), 1 mM PMSF, 10 mM CHAPS, 40 mM Imidazole, 1 mg/ml lysozyme, 30 ug/ml DNAse, 2 ug/ml aprotonin, pH 8.0) and shaken at room temperature for 1 hour. Lysates were clarified and re-racked into a 96-well format by transfer into a 96-well Whatman GF/D Unifilter fitted with a 96-well, 650 μl catch plate and centrifuged for 5 minutes at 200 g. The clarified lysates were transferred to a 96-well Ni-Chelating Plate that had been equilibrated with equilibration buffer (50 mM NaH2PO4, 0.5 M NaCl, 10 mM CHAPS, 40 mM Imidazole, pH 8.0) and incubated for 5 min. Unbound material was removed by vacuum. The resin was washed 2×0.3 ml/well with Wash buffer #1 (50 mM NaH2PO4, 0.5 M NaCl, 5 mM CHAPS, 40 mM Imidazole, pH 8.0) with each wash removed by vacuum. Next the resin was washed with 3×0.3 ml/well with PBS with each wash step removed by vacuum. Prior to elution each well was washed with 50 μl Elution buffer (PBS+20 mM EDTA), incubated for 5 min and this wash discarded by vacuum. Protein was eluted by applying an additional 100 ul of Elution buffer to each well. After a 30 minute incubation at room temperature the plate(s) were centrifuged for 5 minutes at 200 g and eluted protein collected in 96-well catch plates containing 5 μl of 0.5M MgCl2 affixed to the bottom of the Ni-plates. Eluted protein was quantified using a Bradford assay with BSA as the protein standard.
Mid-Scale Expression and Purification of Soluble Fibronectin-Based Scaffold Protein Binders:For expression selected clone(s), followed by the His6 tag, were cloned into a pDEST-14 vector and expressed in E. coli BL21 (DE3) pLysS cells. 20 ml of an inoculum culture (generated from a single plated colony) was used to inoculate 1 liter of LB medium containing 50 μg/mL carbenicillin and 34 μg/mL chloromphenicol. The culture was grown at 37° C. until A600 0.6-1.0. After induction with 1 mM isopropyl-β-thiogalactoside (IPTG) the culture was grown for another 4 hours at 30° C. and harvested by centrifugation for 30 minutes at ≧10,000 g at 4° C. Cell Pellets were frozen at ˜80° C. The cell pellet was resuspended in 25 mL of lysis buffer (20 mM NaH2PO4, 0.5 M NaCl, 1× Complete™ Protease Inhibitor Cocktail-EDTA free (Roche), 1 mM PMSF, pH 7.4) using an Ultra-turrax homgenizer (IKA works) on ice. Cell lysis was achieved by high pressure homogenization (≧18,000 psi) using a Model M-110S Microfluidizer (Microfluidics). The soluble fraction was separated by centrifugation for 30 minutes at 23,300 g at 4° C. The supernatant was clarified via 0.45 μm filter. The clarified lysate was loaded onto a HisTrap column (GE) pre-equilibrated with 20 mM NaH2PO4, 0.5 M NaCl, pH 7.4. The column was then washed with 25 column volumes of 20 mM NaH2PO4, 0.5 M NaCl, pH 7.4, followed by 20 column volumes of 20 mM NaH2PO4, 0.5 M NaCl, 25 mM imidazole pH 7.4, and then 35 column volumes of 20 mM NaH2PO4, 0.5 M NaCl, 40 mM imidazole pH 7.4. Protein was eluted with 15 column volumes of column volumes of 20 mM NaH2PO4, 0.5 M NaCl, 500 mM imidazole pH 7.4, fractions pooled based on absorbance at A280 and dialyzed against 1×PBS or 50 mM NaOAc; 150 mM NaCl; pH4.5. Any precipitate was removed by filtering at 0.22 μm.
PEGylation of the Anti-IGF1R Fibronectin ScaffoldThe fibronectin scaffold-PEG40 molecule was prepared by using a 2-fold excess of PEG-40-kDa (NOF Corporation) to the C-version of the fibronectin scaffold via maleimide chemistry. The reaction was allowed to proceed at room temperature for 2.5 hours. Free PEG-40 was separated from fibronectin scaffold-PEG-40 by Cation Exchange Chromatography (SP-HiTrap; GE). The reaction mixture was diluted 1:10 with 20 mM NaH2PO4, pH 6.7 and applied to an SP-HiTrap column pre-equilibrated with Equilibration buffer (20 mM NaH2PO4, 10 mM NaCl, pH 6.7), washed with Equilibration buffer and eluted using 20 mM NaH2PO4, 0.5M NaCl, pH 6.7. Eluted fractions were pooled based on SDS-PAGE analysis. The SP-pooled eluate was buffer exchanged via G25 Chromatography (GE) into PBS.
The PEG20-fibronectin scaffold-PEG20 was prepared by using a 2-fold excess of purified fibronectin scaffold-C to PEG-20-kDa (NOF Corporation) via maleimide chemistry. The reaction was carried out at room temperature for 1 hour. Unpegylated fibronectin scaffold was separated from the PEG20-fibronectin scaffold-PEG20 by SEC Chromatography (Superose 6; GE) in 20 mM NaH2PO4, 10 mM NaCl, pH 6.7 buffer. The fractions containing the PEG20-fibronectin scaffold-PEG20 were pooled and further purified to removed mono-pegylated fibronectin scaffold. This was achieved by cation exchange chromatography (SP; GE). A SP-HiTrap column was pre-equilibrated with Buffer A (20 mM NaH2PO4, 10 mM NaCl, pH 6.7), the SEC eluate was applied, the column was then washed with buffer A, and then a gradient from 0-10% buffer B (20 mM NaH2PO4, 1.0M NaCl, pH 6.7) over 5 column volumes and held for an additional 5 column volumes was run. PEG20-fibronectin scaffold-PEG20 was eluted from the SP-column by eluting with 50% Buffer B. Fractions were pooled by A280 and buffer exchanged into PBS by G25 Chromatography (GE).
Production of IGF-IR-PEG-VEGFR2 BindersPEG 20 weighed on microbalance and dissolved to 100 mg/ml (5 mM) in 20 mM Sodium Phosphate/10 mM NaCl pH 6.7. PEG solution added to clone 385A08 (SEQ ID NO: 203) solution at a molar ratio of 5:1 (PEG:Protein). The reaction was incubated at room temperature for at least one hour with mixing.
To separate 385A08-PEG20 from uncoupled PEG, Bis-385A08, unPEGylated 385A08 monomer and 385A08 disulfide-linked dimer, the PEG-Protein reaction was loaded onto a HiTrap SP cation exchange column equilibrated with 20 mM Sodium Phosphate/10 mM NaCl pH 6.7 (Buffer A). Elution buffer (Buffer B) is 20 mM Sodium Phosphate/1.0M NaCl pH 6.7. Isocratic elution with 10% B (100 mM NaCl) isolates the 385A08-PEG20-species which is used to react with the VEGFR2 specific binder (SEQ ID NO: 128). Addition of the VEGFR2 specific binder to 385A08-PEG20- forms the 385A08-PEG20-VEGFR2 specific binder heterodimer.
Size exclusion chromatography was performed to separate uncoupled monomeric and dimeric the VEGFR2 specific binder from the 385A08-PEG20-VEGFR2 specific binder heterodimer. A Superdex 200 column was equilibrated with 20 mM Sodium Phosphate/10 mM NaCl pH 6.7. The 385A08-PEG20 plus the VEGFR2 specific binder reaction mixture was applied at a flow rate of 1.0 ml/min. Fractions corresponding the 385A08-PEG20-VEGFR2 specific binder were pooled as finished product.
BIAcore Analysis of the Soluble Fibronectin-Based Scaffold Proteins:The binding kinetics of fibronectin-based scaffold proteins binding proteins to the target was measured using BIAcore 2000 or 3000 biosensors (Pharmacia Biosensor). A capture assay was developed utilizing an IGF-IR-Fc fusion. A similar reagent had been described by Forbes et al. (Forbes et al. 2002, European J. Biochemistry, 269, 961-968). The extracellular domain of human IGF-IR (aa 1-932) was cloned into a mammalian expression vector containing the hinge and constant regions of human IgG1. Transient transfection of the plasmid produced a fusion protein, IGF-IR-Fc which was subsequently purified by Protein A chromatography and captured on Protein A immobilized on Biasensor CMS chips by amine coupling. The kinetic analysis involved the capture of IGF-IR-Fc on Protein A followed by injection of the fibronectin-based scaffold protein in solution and regeneration of the Protein A surface by glycine pH 2.0. Sensorgrams were obtained at each concentration and were evaluated using a program Biaevaluation, BIA Evaluation 2.0 (BIAcore), to determine the rate constants ka (kon) and kd (koff) The dissociation constant, KD was calculated from the ratio of rate constants koff/kon. Typically, a concentration series (2 uM to 0 uM) of purified fibronectin-based scaffold protein was evaluated for binding to protein A captured human IGF-IR-Fc fusion protein.
For experiments determining binding to human insulin receptor, recombinant human insulin receptor (IR) and recombinant human VEGF-R2-Fc were directly coupled to a CMS Biasensor chip by amine group linkage following standard procedures recommended by Biacore (Uppsala, Sweden). In brief, 60 ug/mL of IR diluted in acetate 4.5 was coupled/immobilized to a level of 8300 RU and 11.9 ug/mL of VEGF-R2-Fc diluted in acetate 5.0 was immobilized to a level of 9700 RU on flow cells 2 and 3. A blank reference surface was prepared on FC1. Specific binding to either IR or VEGF-R2-Fc was calculated by subtracting the binding observed to the blank reference flow cell 1. Fibronectin-based scaffold proteins were diluted to 10 uM in HBS-EP (10 mM Hepes 150 mM NaCl 3 mM EDTA 0.05% Surfactant P20) and injected at 20 uL/min for 3 minutes over the flow cells at 25C and dissociation was observed over 10 mins.
Differential Scanning Calorimetry:Differential Scanning calorimetry (DSC) analysis of midscaled clones was performed to determine thermal stability. A 1 mg/ml solution of appropriate clone was scanned in a N-DSC II calorimeter (calorimetry Sciences Corp) by ramping the temperature from 5° C. to 95° C. at a rate of 1 degree per minute under 3 atm pressure. The data was analyzed vs. a control run of the appropriate buffer using a best fit using Orgin Software (OrginLab Corp).
Size-Exclusion Chromatography:Size-exclusion chromatography (SEC) was performed using a TSKgel Super SW2000 column (TOSOH Biosciences, LLC), 4.6 mm×30 cm, on an Agilent 1100 HPLC system with UV detection at A214 nm and A280 nm and with fluorescence detection (excitation=280 nm, emission=350 nm). A buffer of 100 mM sodium sulfate, 100 mM sodium phosphate, 150 mM sodium chloride, pH 6.8 at a flow rate of 100 μL/min was employed. Samples (0.1 to 1 1 μg each) at a concentration of approximately 100 μg/mL were injected separately. Gel filtration standards (Bio-Rad Laboratories, Hercules, Calif.) were used for molecular weight calibration.
SEC MALLS Analysis of IGF-1R Fibronectin Scaffold Clones:Size Exclusion Chromatography (SEC) was performed on a Waters Breeze HPLC system equipped with a Waters 2487 UV detector using a Superdex 200 column (GE Healthcare) with a mobile phase of 100 mM Sodium Sulfate, 100 mM Sodium Phosphate, 150 mM Sodium Chloride pH 6.8 applied at a flow rate of 0.6 ml/min. Samples were diluted to approximately 1.0 mg/ml with mobile phase and 50 μl was injected. Multi-Angle Laser Light Scattering (MALLS) analysis was performed using a miniDAWN Light Scattering detector (Wyatt Technology Corporation) and Optilab DSP Differential Refractometer (Wyatt Technology Corporation) plumbed in-line after the UV detector. Analysis of the light scattering data was performed using Astra V version 5.1.9.1 software (Wyatt Technologies Corporation). To calculate the concentration of the fibronectin-based scaffold protein by absorbance at 280 nm, a theoretical molar extinction coefficient based on amino acid sequence was used. For concentration determination by Refractive Index, an estimated specific refractive index increment (dn/dc) of 0.185 mL/g was used.
RP-HPLC Chromatography:Reversed-phase HPLC (RP-HPLC) was performed using a C4 polymer column #259VHP5415 (Vydac), 4.6 mm×15 cm, heated to 60° C. on an Agilent 1100 HPLC system with UV detection at A214 nm and A280 nm and with fluorescence detection (excitation=280 nm, emission=350 nm). Solvent A consisted of MilliQ water containing 0.01% TFA, Solvent B was 100% HPLC-grade acetonitrile containing 0.01% TFA. A flow rate of 1 mL/min was employed. The elution scheme consisted of an equilibration condition of 10% B for 10 min followed by a linear gradient to 50% B over the course of 30 min. Under these conditions, fibronectin-based scaffold proteins eluted at approximately 25 to 30 minutes of total run time.
MALDI TOF Mass Spectrometry:Fibronectin-based scaffold proteins were analyzed by Matrix Assisted Laser Desorption Ionization Time of Flight (MALDI-TOF) mass spectrometer (
The human pancreatic adenocarcinoma cell line BxPC-3 (ATCC, Manassas, Va.) was plated in 96 well plates at a concentration of 2500 cells per well in RPMI 1640 (Invitrogen, Carlsbad, Calif.) containing 10% fetal bovine serum (Hyclone, Logan, Utah). The following day, cells were washed in starvation medium consisting of RPMI 1640 containing 0.1% BSA (Sigma, St. Louis, Mo.). Washed cells were pre-incubated for four hours in starvation medium containing various concentrations of each IGF-IR antagonist. Following the four hour pre-incubation, cells were exposed to IGF-I at 25 ng/mL and allowed to incubate for 24 hours at 37° C., 5% CO2. For the final four hours of incubation, cells were exposed to [3H]-Thymidine (0.25 μCi/well; Perkin Elmer, Wellesley, Mass.). After the incubation period, cells were washed in PBS, lysed in 100 μL buffer consisting of 0.1% SDS+0.5 N NaOH, and counted on a TopCount NXT Scintillation Counter (Perkin Elmer, Wellesley, Mass.). The data were analyzed using SigmaPlot (Systat Software, Point Richmond, Calif.).
Cell-Based Receptor Blocking Assay:The human breast adenocarcinoma MCF-7 (ATCC, Manassas, Va.) was plated in 24 well plates at a concentration of 50,000 cells per well in RPMI 1640 (Invitrogen, Carlsbad, Calif.) containing 10% fetal bovine serum (Hyclone, Logan, Utah). The following day, cells were washed in binding buffer consisting of RPMI 1640 containing 0.1% BSA (Sigma, St. Louis, Mo.), and then pre-incubated for 30 minutes on ice in 200 μL binding buffer containing IGF-IR competitor. After the pre-incubation period, 40 pM [125I]IGF-I (Perkin Elmer, Wellesley, Mass.), equivalent to approximately 60000 counts per minute, was added to each well and allowed to incubate for an additional three hours on ice with gentle agitation. The wells were then washed with ice cold PBS containing 0.1% BSA. Cells were lysed with 500 μL buffer consisting of 0.1% SDS+0.5 N NaOH. Radioactivity of the lysates was measured using a Wallac 1470 Gamma Counter (Perkin Elmer, Wellesley, Mass.), and the data were analyzed using SigmaPlot (Systat Software, Point Richmond, Calif.).
NCI-H929 Cell Proliferation Assay:The human plasmacytoma cell line NCI-H929 (ATCC, Manassas, Va.) was plated in 96 well plates at a concentration of either 10000 or 25000 cells per well in DMEM (Invitrogen, Carlsbad, Calif.) containing 10% fetal bovine serum (Hyclone, Logan, Utah) containing various concentrations of IGF-IR antagonists. Cells were allowed to proliferate for 72 hours at 37° C., 5% CO2. After the proliferation period, cells were exposed to 20 μL of Cell Titer 96 Aqueous Proliferation Reagent (Promega, Madison, Wis.) and allowed to incubate for an additional four hours. Absorbance at 490 nm was measured on a Spectramax Plus 384 (Molecular Devices, Sunnyvale, Calif.), and the resulting data were analyzed using SigmaPlot (Systat Software, Point Richmond, Calif.).
32D:IGF-IR Cell Proliferation AssayCells (104) were seeded in 96 well plates in RPMI (Invitrogen, Carlsbad, Calif.) containing 10% fetal bovine serum (Hyclone, Logan, Utah) in the presence 100 ng/mL human IGF-I (R&D Systems, Minneapolis, Minn.) and IGF-IR antagonists. Cells were allowed to proliferate for 72 hours at 37° C., 5% CO2 After the proliferation period, cells were exposed to Cell Titer 96 Aqueous Proliferation Reagent (Promega, Madison, Wis.) and allowed to incubate for an additional four hours. Absorbance at 490 nm was measured on a Spectramax Plus 384 (Molecular Devices, Sunnyvale, Calif.), and the resulting data was analyzed using SigmaPlot (Systat Software, Point Richmond, Calif.).
Ba/F3:VEGFR2 Cell Proliferation AssayA murine IL-3-dependent pro-B cell line, Ba/F3, was engineered to overexpress a chimeric VEGR2 (extracellular domain)/EpoR(intracellular domain) thereby becoming a VEGF-dependent cell line. BaF3:VEGFR2 cells (2.5×104) were seeded in 96 well plates in RPMI (Invitrogen, Carlsbad, Calif.) containing 10% fetal bovine serum (Hyclone, Logan, Utah) in the presence of VEGFR2 antagonists. Cells were allowed to proliferate for 72 hours at 37° C., 5% CO2. After the proliferation period, cells were exposed to Cell Titer 96 Aqueous Proliferation Reagent (Promega, Madison, Wis.) and allowed to incubate for an additional four hours. Absorbance at 490 nm was measured on a Spectramax Plus 384 (Molecular Devices, Sunnyvale, Calif.), and the resulting data was analyzed using SigmaPlot (Systat Software, Point Richmond, Calif.).
IGF-IR-HSA Conjugate ProductionBM(PEO)2 was added in molar excess to clone 385A08 (SEQ ID NO: 203). The 385A08-BM(PEO)2 was isolated by cation exchange chromatography. Recombinant Human Serum albumin with free sulfhydryl group was added to 385A08-BM(PEO)2 to form HSA-385A08. The conjugate was further purified by anion and cation exchange chromatography.
IGF-IR-Fc Fusion ProductionThe carboxyl-terminus of 385A08 (SEQ ID NO: 226) (underlined) was joined to the amino-terminal region of an Fc fragment (Fc Hinge-CH2-CH3) (bold). A spacer (in lower case) was placed between the two in order to minimize the risk of steric hindrance. The expression vector was designed to allow the molecule to be expressed in pichia cells, which is faster than the traditional mammalian cell approach. The expression vector also includes an alpha factor signal peptide (in italics) to enable secretion during expression in pichia cells. This signal sequence is removed upon secretion and is not part of the final purified IGF-IR-Fc molecule. The sequence of the resulting expression construct is given below.
The expression construct was linearized and transformed into 3 Pichia host cells, X-33, GS115 and KM17H. Transformants were selected on zeocin plates and screened for IGF-IR-Fc expression in 2 ml cultures. Selected clones were grown in shake flasks at varied pH and purified by Protein A resin. Expression was observed at pH 6.5 to 7.0. A 1 L shake flask of one of the clones was used to express IGF-IR-DPGG-Ig at pH 6.7 and purify via Protein A and size exclusion.
Tumors were propagated in nude mice. Tumor passages occurred every four weeks for human RH41 xenografts. With regard to efficacy testing human tumor xenografts were implanted in nude mice. All tumor passages were subcutaneous (sc).
Antitumor activity was evaluated in terms of: a) cures, and for the murine tumor models, increases in lifespan reflected by the relative median survival time (MST) of treated (T) versus control (C) groups (i.e. % T/C values); and b) primary tumor growth inhibition determined by calculating the relative median times for T and C mice to grow tumors of a predetermined “target” size (1 gm for all sc tumor models described) and expressed as T-C values, in days. The definition of a cured mouse was one whose tumor was undetectable, or <35 mg, when assessed more than 10 tumor volume doubling times (TVDTs) post-treatment. The activity criterion for tumor inhibition/reduction was a statistically significant delay in primary tumor growth consistent with ≧1 gross log cell kill (LCK). The following formula was employed to calculate LCK: LCK=T−C/(3.32×TVDT)
Where, TVDT=median time (days) for control tumors to reach target size−median time (days) for control tumors to reach half the target size. The dose of a compound which yielded the maximum therapeutic effect, was termed the optimal dose (OD). Treatment groups (typically 8 mice) with more than one death attributable to drug toxicity were considered to have had excessively toxic treatments and their data were not used in the evaluation of antitumor activity. The maximum tolerated dose (MTD) is defined as the dose level immediately below which excessive toxicity (i.e. more than one death) occurred. Treated mice dying prior to having their tumors reach target size were considered to have died from drug toxicity. Statistical evaluations of data were performed using Gehan's generalized Wilcoxon test (Gehan, Biometrika 52:203-223, 1965).
Western Blot Analysis of 385A08-FcRh41 human rhabdomyo sarcoma cells were serum-starved overnight in the presence of 0.3% BSA; they were then exposed to 385A08-Fc for 1 hr at 37° degrees after stimulation with IGF-I, IGF-II, or insulin ligands (50 ng/ml) for 5 minutes prior to lysis. Cells were lysed in TTG buffer (20 mM Tris-HCl, pH7.6, 1% triton X-100, 5% glycerol, 0.15M NaCl, 1 mM EDTA, Complete Tablets, and Phosphatase Inhibitor Cocktail. Protein concentrations of total cell lysates were determined using BSA as the standard. Equal amounts of protein from each lysate were loaded into each well of a gel. Proteins were separated by SDS PAGE, transferred to Nitrocellulose membrane and blocked in Odyssey Blocking Buffer (Li-Cor Biosciences) overnight at 4° C. Membranes were probed with phospho-specific antibodies to IGF-1R, Akt and MAPK for 2 hrs at room temperature, and then washed 3 times in TBS with 0.1% Tween-20. After washing, membranes were incubated with fluorescent-labeled secondary antibodies. Protein visualization was performed utilizing the Odyssey Infrared Imaging System (Li-Cor Biosciences) which enables simultaneous and independent detection of fluorescent signals. Based on densitometric scanning using the Li-Cor Biosciences imaging system, inhibition was calculated by comparing the ratio of phospho-signals in untreated versus treated samples after normalization to actin or GAPDH which are used as loading controls.
Cellular Proliferation in Rh41 (Human Rhabdomyosarcoma and H929 Human Multiple Myeloma).Proliferation was evaluated by incorporation of [3H]-thymidine into DNA after a 72 hour exposure to reagents. Rh41 cells were plated at a density of 3500 and H929 at 8000 cells/well, respectively, in 96-well microtiter plates and 24 hours later they were exposed to a range of drug concentrations. After 72 hours incubation at 37° C., cells were pulsed with 4 μCi/ml [3H] thymidine (Amersham Pharmacia Biotech, UK) for 3 hours, trypsinized, harvested onto UniFilter-96, GF/B plates (PerkinElmer, Boston, Mass.) and scintillation was measured on a TopCount.NXT (Packard, Conn.). Results are expressed as an IC50, which is the drug concentration required to inhibit cell proliferation by 50% to that of untreated control cells Data represents the average of triplicate wells with standard deviations shown.
Claims
1-21. (canceled)
22. A nucleic acid encoding a tenth fibronectin type III (10Fn3) domain comprising an amino acid sequence that is at least 85% identical to any one of SEQ ID NOs: 184-203, wherein the 10Fn3 domain binds human insulin-like growth factor-I receptor (IGF-IR) with a dissociation constant of about 1 μM or less.
23. The nucleic acid of claim 22, wherein the 10Fn3 domain comprises an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 184-203.
24. The nucleic acid of claim 22, wherein the 10Fn3 domain comprises an amino acid sequence that is at least 95% identical to any one of SEQ ID NOs: 184-203.
25. A nucleic acid encoding a tenth fibronectin type III (10Fn3) domain comprising the amino acid sequence of any one of SEQ ID NOs: 184-203.
26. A nucleic acid encoding a encoding a tenth fibronectin type III (10Fn3) domain consisting of an amino acid sequence that is at least 85% identical to any one of SEQ ID NOs: 184-203, wherein the 10Fn3 domain binds human insulin-like growth factor-I receptor (IGF-IR) with a dissociation constant of about 1 μM or less.
27. The nucleic acid of claim 26, wherein the amino acid sequence of the 10Fn3 domain is at least 90% identical to any one of SEQ ID NOs: 184-203.
28. The nucleic acid of claim 26, wherein the amino acid sequence of the 10Fn3 domain is at least 95% identical to any one of SEQ ID NOs: 184-203.
29. The nucleic acid of claim 26, wherein the amino acid sequence of the 10Fn3 domain is at least 95% identical to any one of SEQ ID NOs: 184-203.
30. The nucleic acid of claim 26, wherein the amino acid sequence of the 10Fn3 domain is identical to any one of SEQ ID NOs: 184-203.
31. A vector comprising the nucleic acid of claim 22.
32. A vector comprising the nucleic acid of claim 26.
33. A host cell expressing the nucleic acid of claim 22.
34. A host cell expressing the nucleic acid of claim 26.
35. A method of treating a subject have cancer associated with increased insulin-like growth factor activity, the method comprising administering to a subject in need thereof a pharmaceutically effective amount of a polypeptide comprising an altered tenth fibronectin type III (10Fn3) domain comprising an amino acid sequence that is at least 80% identical to any one of SEQ ID NOs: 184-203, and wherein the 10Fn3 domain binds human insulin-like growth factor-I receptor (IGF-IR) with a dissociation constant of about 1 μM or less.
36. The method of claim 35, wherein the altered 10Fn3 domain binds human IGF-IR with a disassociation constant of about 10 nM or less.
37. The method of claim 35, wherein the altered 10Fn3 domain comprises an amino acid sequence that is at least 85% identical to any one of SEQ ID NOs: 184-203.
38. The method of claim 35, wherein the altered 10Fn3 domain comprises an amino acid sequence that is at least 90% identical to any one of SEQ ID NOs: 184-203.
39. The method of claim 35, wherein the altered 10Fn3 domain comprises an amino acid sequence that is at least 95% identical to any one of SEQ ID NOs: 184-203.
40. The method of claim 35, wherein the altered 10Fn3 domain comprises an amino acid sequence that is identical to any one of SEQ ID NOs: 184-203.
41. The method of claim 35, wherein the altered 10Fn3 domain comprises an amino acid sequence of SEQ ID NO: 184.
42. The method of claim 35, wherein the polypeptide further comprises one or more pharmacokinetic (PK) moieties selected from: a polyoxyalkylene moiety, a human serum albumin binding protein, sialic acid, human serum albumin, transferrin, and an Fc fragment.
43. The method of claim 42, wherein the PK moiety is the polyoxyalkylene moiety and said polyoxyalkylene moiety is polyethylene glycol.
44. The method of claim 35, wherein the polypeptide inhibits the binding of insulin-like growth factor-I (IGF-I) or insulin-like growth factor-II (IGF-II) to IGF-IR and does not activate human IGF-IR at sub IC50 concentrations in a cell-based assay.
45. The method of claim 35, wherein the cancer is selected from the group consisting of breast cancer, colon cancer, ovarian carcinoma, osteosarcoma, cervical cancer, prostate cancer lung cancer, synovial carcinoma, pancreatic cancer, plasmacytoma, rhabdomyosarcoma and multiple myeloma.
Type: Application
Filed: Mar 16, 2015
Publication Date: Sep 10, 2015
Inventors: Ray CAMPHAUSEN (Wayland, MA), David FABRIZIO (South Hamilton, MA), Martin C. WRIGHT (Belmont, MA), Patrick GAGE (Bryn Mawr, PA), John MENDLEIN (Encinitas, CA)
Application Number: 14/659,028
