COMPOSITIONS AND METHODS COMPRISING KLK3 OR FOLH1 ANTIGEN
The present invention provides KLK3 peptides, FOLH1 peptides, recombinant polypeptides comprising same, recombinant nucleotide molecules encoding same, recombinant Listeria strains comprising same, and immunogenic and therapeutic methods utilizing same.
Latest THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA Patents:
- Smooth and biodegradable nano-cellulose composites for printed electronics
- Methods, systems, and computer readable media for defending large language models (LLMs) against jailbreaking attacks
- Modified mRNA vaccines encoding herpes simplex virus glycoproteins and uses thereof
- Superoxide dismutase-loaded porous polymersomes as highly efficient antioxidant nanoparticles
- Machine learning models for patent valuation
This application is a divisional of U.S. application Ser. No. 14/581,217, filed Dec. 23, 2014, which is a divisional of U.S. application Ser. No. 11/798,177, filed May 10, 2007, now U.S. Pat. No. 9,012,141, which is a Continuation-in-Part of co-pending U.S. application Ser. No. 11/727,889, filed Mar. 28, 2007 now abandoned, which is a Continuation-in-Part of co-pending U.S. application Ser. No. 11/223,945, filed Sep. 13, 2005, now U.S. Pat. No. 7,820,180, which is a Continuation-in-Part of co-pending U.S. application Ser. No. 10/949,667, filed Sep. 24, 2004, now U.S. Pat. No. 7,794,729, which is a Continuation-in-Part of U.S. application Ser. No. 10/441,851, filed May 20, 2003, now U.S. Pat. No. 7,135,188, which is a Continuation of U.S. application Ser. No. 09/535,212, filed Mar. 27, 2000, now U.S. Pat. No. 6,565,852. These applications are hereby incorporated in their entirety by reference herein.
FIELD OF THE INVENTIONThe present invention provides KLK3 peptides, FOLH1 peptides, recombinant polypeptides comprising same, recombinant nucleotide molecules encoding same, recombinant Listeria strains comprising same, and immunogenic and therapeutic methods utilizing same.
BACKGROUND OF THE INVENTIONStimulation of an immune response is dependent upon the presence of antigens recognized as foreign by the host immune system. Bacterial antigens such as Salmonella enterica and Mycobacterium bovis BCG remain in the phagosome and stimulate CD4+ T-cells via antigen presentation through major histocompatibility class II molecules. In contrast, bacterial antigens such as Listeria monocytogenes exit the phagosome into the cytoplasm. The phagolysosomal escape of L. monocytogenes is a unique mechanism which facilitates major histocompatibility class I antigen presentation of listerial antigens. This escape is dependent upon the pore-forming sulfhydryl-activated cytolysin, listeriolysin O (LLO).
ActA is a surface-associated Listerial protein, and acts as a scaffold in infected host cells to facilitate the polymerization, assembly and activation of host actin polymers in order to propel the Listeria organism through the cytoplasm. Shortly after entry into the mammalian cell cytosol, L. monocytogenes induces the polymerization of host actin filaments and uses the force generated by actin polymerization to move, first intracellularly and then from cell to cell. A single bacterial protein, ActA is responsible for mediating actin nucleation and actin-based motility. The ActA protein provides multiple binding sites for host cytoskeletal components, thereby acting as a scaffold to assemble the cellular actin polymerization machinery. The NH2 terminus of ActA binds to monomeric actin and acts as a constitutively active nucleation promoting factor by stimulating the intrinsic actin nucleation activity. ActA and hly are both members of the 10-kb gene cluster regulated by the transcriptional activator PrfA, and is upregulated approximately 226-fold in the mammalian cytosol.
Prostate cancer is the most frequent type of cancer in American men and it is the second cause of cancer related death in this population. Prostate Specific Antigen (PSA) is a marker for prostate cancer that is highly expressed by prostate tumors.
There exists a long-felt need to develop compositions and methods to enhance the immunogenicity of antigens, especially antigens useful in the prevention and treatment of tumors and intracellular pathogens.
SUMMARY OF THE INVENTIONThe present invention provides KLK3 peptides, FOLH1 peptides, recombinant polypeptides comprising same, recombinant nucleotide molecules encoding same, recombinant Listeria strains comprising same, and immunogenic and therapeutic methods utilizing same.
In another embodiment, the present invention provides a recombinant Listeria strain expressing a kallikrein-related peptidase 3 (KLK3) peptide. In another embodiment, the sequence of the KLK3 peptide is selected from SEQ ID No: 25, 27, 29-32, 34, and 36-39. In another embodiment, the KLK3 peptide is an immunogenic KLK3 peptide. In another embodiment, the KLK3 peptide is any other KLK3 peptide known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant Listeria strain expressing a folate hydrolase 1 (FOLH1) peptide. In another embodiment, the sequence of the FOLH1 peptide is selected from SEQ ID No: 41, 43, 44, and 45. In another embodiment, the FOLH1 peptide is an immunogenic FOLH1 peptide. In another embodiment, the FOLH1 peptide is any other FOLH1 peptide known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant polypeptide, comprising a KLK3 peptide operatively linked to a non-KLK3 peptide. In another embodiment, the non-KLK3 peptide is an LLO peptide. In another embodiment, the non-KLK3 peptide is an ActA peptide. In another embodiment, the non-KLK3 peptide is a PEST-like sequence peptide. In another embodiment, the non-KLK3 peptide enhances the immunogenicity of the KLK3 peptide. In another embodiment, the non-KLK3 peptide is any other type of peptide known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant polypeptide, comprising an FOLH1 peptide operatively linked to a non-FOLH1 peptide. In another embodiment, the non-FOLH1 peptide is an LLO peptide. In another embodiment, the non-FOLH1 peptide is an ActA peptide. In another embodiment, the non-FOLH1 peptide is a PEST-like sequence peptide. In another embodiment, the non-FOLH1 peptide enhances the immunogenicity of the FOLH1 peptide. In another embodiment, the non-FOLH1 peptide is any other type of peptide known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant vaccine vector encoding a recombinant polypeptide of the present invention.
In another embodiment, the present invention provides a nucleotide molecule encoding a recombinant polypeptide of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-KLK3 immune response in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby inducing an anti-KLK3 immune response in a subject.
In another embodiment, the present invention provides a method of treating a KLK3 protein-expressing tumor in a subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the KLK3 protein-expressing tumor, thereby treating a KLK3 protein-expressing tumor in a subject. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against a KLK3 protein-expressing tumor, the method comprising the step of administering to the human subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the KLK3 protein, thereby protecting a human subject against a KLK3 protein-expressing tumor. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-FOLH1 immune response in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby inducing an anti-FOLH1 immune response in a subject.
In another embodiment, the present invention provides a method of treating an FOLH1 protein-expressing tumor in a subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the FOLH1 protein-expressing tumor, thereby treating an FOLH1 protein-expressing tumor in a subject. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against an FOLH1 protein-expressing tumor, the method comprising the step of administering to the human subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the FOLH1 protein, thereby protecting a human subject against an FOLH1 protein-expressing tumor. Each possibility represents a separate embodiment of the present invention.
The present invention provides KLK3 peptides, FOLH1 peptides, recombinant polypeptides comprising same, recombinant nucleotide molecules encoding same, recombinant Listeria strains comprising same, and immunogenic and therapeutic methods utilizing same.
In another embodiment, the present invention provides a recombinant Listeria strain expressing a kallikrein-related peptidase 3 (KLK3) peptide. In another embodiment, the sequence of the KLK3 peptide is selected from SEQ ID No: 25, 27, 29-32, 34, and 36-39. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 25. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 27. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 29. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 30. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 31. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 32. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 34. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 36. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 37. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 38. In another embodiment, the sequence of the KLK3 peptide is set forth in SEQ ID No: 39. In another embodiment, the sequence of the KLK3 peptide is any other KLK3 protein sequence known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the sequence of the KLK3 peptide comprises a sequence selected from SEQ ID No: 25, 27, 29-32, 34, and 36-39.
In another embodiment, the KLK3 peptide is an immunogenic fragment of a larger KLK3 peptide, wherein the sequence of the larger KLK3 peptide is a sequence selected from SEQ ID No: 25, 27, 29-32, 34, and 36-39. In another embodiment, the KLK3 peptide is an immunogenic fragment of a larger KLK3 peptide, wherein the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 25. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 27. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 29. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 30. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 31. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 32. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 34. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 36. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 37. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 38. In another embodiment, the sequence of the larger KLK3 peptide is set forth in SEQ ID No: 39. In another embodiment, the sequence of the larger KLK3 peptide is any other KLK3 protein sequence known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the sequence of the KLK3 peptide comprises an immunogenic fragment of a sequence selected from SEQ ID No: 25, 27, 29-32, 34, and 36-39.
In another embodiment, the KLK3 peptide is any other KLK3 peptide known in the art. In another embodiment, the KLK3 peptide is a fragment of any other KLK3 peptide known in the art. Each type of KLK3 peptide represents a separate embodiment of the present invention.
“KLK3 peptide” refers, in another embodiment, to a full-length KLK3 protein. In another embodiment, the term refers to a fragment of a KLK3 protein. In another embodiment, the term refers to a fragment of a KLK3 protein that is lacking the KLK3 signal peptide. In another embodiment, the term refers to a KLK3 protein that contains the entire KLK3 sequence except the KLK3 signal peptide. “KLK3 signal sequence” refers, in another embodiment, to any signal sequence found in nature on a KLK3 protein. In another embodiment, a KLK3 protein of methods and compositions of the present invention does not contain any signal sequence. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the kallikrein-related peptidase 3 (KLK3 protein) that is the source of a KLK3 peptide of methods and compositions of the present invention is a PSA protein. In another embodiment, the KLK3 protein is a P-30 antigen protein. In another embodiment, the KLK3 protein is a gamma-seminoprotein protein. In another embodiment, the KLK3 protein is a kallikrein 3 protein. In another embodiment, the KLK3 protein is a semenogelase protein. In another embodiment, the KLK3 protein is a seminin protein. In another embodiment, the KLK3 protein is any other type of KLK3 protein that is known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is a splice variant 1 KLK3 protein. In another embodiment, the KLK3 protein is a splice variant 2 KLK3 protein. In another embodiment, the KLK3 protein is a splice variant 3 KLK3 protein. In another embodiment, the KLK3 protein is a transcript variant 1 KLK3 protein. In another embodiment, the KLK3 protein is a transcript variant 2 KLK3 protein. In another embodiment, the KLK3 protein is a transcript variant 3 KLK3 protein. In another embodiment, the KLK3 protein is a transcript variant 4 KLK3 protein. In another embodiment, the KLK3 protein is a transcript variant 5 KLK3 protein. In another embodiment, the KLK3 protein is a transcript variant 6 KLK3 protein. In another embodiment, the KLK3 protein is a splice variant RP5 KLK3 protein. In another embodiment, the KLK3 protein is any other splice variant KLK3 protein known in the art. In another embodiment, the KLK3 protein is any other transcript variant KLK3 protein known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is a mature KLK3 protein. In another embodiment, the KLK3 protein is a pro-KLK3 protein. In another embodiment, the leader sequence has been removed from a mature KLK3 protein of methods and compositions of the present invention. An example of a mature KLK3 protein is encoded by 378-1088 of SEQ ID No: 40. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein that is the source of a KLK3 peptide of methods and compositions of the present invention is a human KLK3 protein. In another embodiment, the KLK3 protein is a primate KLK3 protein. In another embodiment, the KLK3 protein is a KLK3 protein of any other species known in the art. In another embodiment, 1 of the above KLK3 proteins is referred to in the art as a “KLK3 protein.” Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
MWVPVVFLTLSVTWIGAAPLILSRIVGGWECEKHSQPWQVLVASRGRAVCGGVL VHPQWVLTAAHCIRNKSVILLGRHSLFHPEDTGQVFQVSHSFPHPLYDMSLLKNRFLRPG DDSSHDLMLLRLSEPAELTDAVKVMDLPTQEPALGTTCYASGWGSIEPEEFLTPKKLQCV DLHVISNDVCAQVHPQKVTKFMLCAGRWTGGKSTCSGDSGGPLVCNGVLQGITSWGSEP CALPERPSLYTKVVHYRKWIKDTIVANP (SEQ ID No: 25; GenBank Accession No. X14810). In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 25. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 25. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 25. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 25. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is encoded by a nucleotide molecule having the sequence:
In another embodiment, the KLK3 protein is encoded by residues 401 . . . 446, 1688 . . . 1847, 3477 . . . 3763, 3907 . . . 4043, and 5413 . . . 5568 of SEQ ID No: 26. In another embodiment, the KLK3 protein is encoded by a homologue of SEQ ID No: 26. In another embodiment, the KLK3 protein is encoded by a variant of SEQ ID No: 26. In another embodiment, the KLK3 protein is encoded by an isomer of SEQ ID No: 26. In another embodiment, the KLK3 protein is encoded by a fragment of SEQ ID No: 26. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 27. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 27. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 27. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 27. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is encoded by a nucleotide molecule having the sequence:
In another embodiment, the KLK3 protein is encoded by residues 42-758 of SEQ ID No: 28. In another embodiment, the KLK3 protein is encoded by a homologue of SEQ ID No: 28. In another embodiment, the KLK3 protein is encoded by a variant of SEQ ID No: 28. In another embodiment, the KLK3 protein is encoded by an isomer of SEQ ID No: 28. In another embodiment, the KLK3 protein is encoded by a fragment of SEQ ID No: 28. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 29. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 29. In another embodiment, the sequence of the KLK3 protein comprises SEQ ID No: 29. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 29. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 29. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein that is the source of the KLK3 peptide has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 30. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 30. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 30. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 30. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 31. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 31. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 31. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 31. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 32. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 32. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 32. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 32. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is encoded by a nucleotide molecule having the sequence:
In another embodiment, the KLK3 protein is encoded by residues 42-827 of SEQ ID No: 33. In another embodiment, the KLK3 protein is encoded by a homologue of SEQ ID No: 33. In another embodiment, the KLK3 protein is encoded by a variant of SEQ ID No: 33. In another embodiment, the KLK3 protein is encoded by an isomer of SEQ ID No: 33. In another embodiment, the KLK3 protein is encoded by a fragment of SEQ ID No: 33. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 34. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 34. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 34. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 34. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is encoded by a nucleotide molecule having the sequence:
In another embodiment, the KLK3 protein is encoded by residues 47-832 of SEQ ID No: 35. In another embodiment, the KLK3 protein is encoded by a homologue of SEQ ID No: 35. In another embodiment, the KLK3 protein is encoded by a variant of SEQ ID No: 35. In another embodiment, the KLK3 protein is encoded by an isomer of SEQ ID No: 35. In another embodiment, the KLK3 protein is encoded by a fragment of SEQ ID No: 35. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 36. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 36. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 36. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 36. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 37. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 37. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 37. In another embodiment, the sequence of the KLK3 protein comprises SEQ ID No: 37. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 37. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 38. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 38. In another embodiment, the sequence of the KLK3 protein comprises SEQ ID No: 38. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 38. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 38. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence:
In another embodiment, the KLK3 protein is a homologue of SEQ ID No: 39. In another embodiment, the KLK3 protein is a variant of SEQ ID No: 39. In another embodiment, the KLK3 protein is an isomer of SEQ ID No: 39. In another embodiment, the KLK3 protein is a fragment of SEQ ID No: 39. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is encoded by a nucleotide molecule having the sequence:
In another embodiment, the KLK3 protein is encoded by residues 67-1088 of SEQ ID No: 40. In another embodiment, the KLK3 protein is encoded by a homologue of SEQ ID No: 40. In another embodiment, the KLK3 protein is encoded by a variant of SEQ ID No: 40. In another embodiment, the KLK3 protein is encoded by an isomer of SEQ ID No: 40. In another embodiment, the KLK3 protein is encoded by a fragment of SEQ ID No: 40. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has a sequence set forth in one of the following GenBank Accession Numbers: BC005307, AJ310938, AJ310937, AF335478, AF335477, M27274, and M26663. In another embodiment, the KLK3 protein is encoded by a sequence set forth in one of the above GenBank Accession Numbers. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is encoded by a sequence set forth in one of the following GenBank Accession Numbers: NM_001030050, NM_001030049, NM_001030048, AJ459782, AJ512346, or AJ459784. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein has the sequence that comprises a sequence set forth in one of the following GenBank Accession Numbers: X13943, X13942, X13940, X13941, and X13944. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3 protein is any other KLK3 protein known in the art. Each KLK3 protein represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant Listeria strain expressing a folate hydrolase 1 (FOLH1) peptide. In another embodiment, the sequence of the FOLH1 peptide is selected from SEQ ID No: 41, 43, 44, and 45. In another embodiment, the sequence of the FOLH1 peptide is set forth in SEQ ID No: 41. In another embodiment, the sequence of the FOLH1 peptide is set forth in SEQ ID No: 43. In another embodiment, the sequence of the FOLH1 peptide is set forth in SEQ ID No: 44. In another embodiment, the sequence of the FOLH1 peptide is set forth in SEQ ID No: 45. In another embodiment, the sequence of the FOLH1 peptide is any other FOLH1 protein sequence known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the sequence of the FOLH1 peptide comprises a sequence selected from SEQ ID No: 41, 43, 44, and 45.
In another embodiment, the FOLH1 peptide is an immunogenic fragment of a larger FOLH1 peptide, wherein the sequence of the larger FOLH1 peptide is a sequence selected from SEQ ID No: 41, 43, 44, and 45. In another embodiment, the FOLH1 peptide is an immunogenic fragment of a larger FOLH1 peptide, wherein the sequence of the larger FOLH1 peptide is set forth in SEQ ID No: 41. In another embodiment, the sequence of the larger FOLH1 peptide is set forth in SEQ ID No: 43. In another embodiment, the sequence of the larger FOLH1 peptide is set forth in SEQ ID No: 44. In another embodiment, the sequence of the larger FOLH1 peptide is set forth in SEQ ID No: 45. In another embodiment, the sequence of the larger FOLH1 peptide is any other FOLH1 protein sequence known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the sequence of the FOLH1 peptide comprises an immunogenic fragment of a sequence selected from SEQ ID No: 41, 43, 44, and 45.
“FOLH1 peptide” refers, in another embodiment, to a full-length FOLH1 protein. In another embodiment, the term refers to a fragment of an FOLH1 protein. In another embodiment, the term refers to a fragment of an FOLH1 protein that is lacking the FOLH1 signal peptide. In another embodiment, the term refers to an FOLH1 protein that contains the entire FOLH1 sequence except the FOLH1 signal peptide. “FOLH1 signal sequence” refers, in another embodiment, to any signal sequence found in nature on an FOLH1 protein. In another embodiment, an FOLH1 protein of methods and compositions of the present invention does not contain any signal sequence. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein that is the source of an FOLH1 peptide of methods and compositions of the present invention is a human FOLH1 protein. In another embodiment, the FOLH1 protein is a mouse FOLH1 protein. In another embodiment, the FOLH1 protein is a rodent FOLH1 protein. In another embodiment, the FOLH1 protein is an FOLH1 protein of any other species known in the art. In another embodiment, 1 of the above FOLH1 proteins is referred to in the art as a “FOLH1 protein.” Each possibility represents a separate embodiment of the present invention.
The FOLH1 protein that is the source of an FOLH1 peptide of methods and compositions of the present invention is a folate hydrolase (prostate-specific membrane antigen) protein. In another embodiment, the FOLH1 protein is PSMA protein. In another embodiment, the FOLH1 protein is a N-acetylated alpha-linked acidic dipeptidase 1 protein. In another embodiment, the FOLH1 protein is a folate hydrolase 1 protein. In another embodiment, the FOLH1 protein is a folylpoly-gamma-glutamate carboxypeptidase protein. In another embodiment, the FOLH1 protein is a glutamate carboxylase II protein. In another embodiment, the FOLH1 protein is a glutamate carboxypeptidase II protein. In another embodiment, the FOLH1 protein is a membrane glutamate carboxypeptidase protein. In another embodiment, the FOLH1 protein is a pteroylpoly-gamma-glutamate carboxypeptidase protein. In another embodiment, the FOLH1 protein is any other type of FOLH1 protein that is known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein has the sequence:
In another embodiment, the FOLH1 protein is a homologue of SEQ ID No: 41. In another embodiment, the FOLH1 protein is a variant of SEQ ID No: 41. In another embodiment, the FOLH1 protein is an isomer of SEQ ID No: 41. In another embodiment, the FOLH1 protein is a fragment of SEQ ID No: 41. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein is encoded by a nucleotide molecule having the sequence:
In another embodiment, the FOLH1 protein is encoded by residues 160-2319 of SEQ ID No: 42. In another embodiment, the FOLH1 protein is encoded by a homologue of SEQ ID No: 42. In another embodiment, the FOLH1 protein is encoded by a variant of SEQ ID No: 42. In another embodiment, the FOLH1 protein is encoded by an isomer of SEQ ID No: 42. In another embodiment, the FOLH1 protein is encoded by a fragment of SEQ ID No: 42. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein has the sequence:
In another embodiment, the FOLH1 protein is a homologue of SEQ ID No: 43. In another embodiment, the FOLH1 protein is a variant of SEQ ID No: 43. In another embodiment, the FOLH1 protein is an isomer of SEQ ID No: 43. In another embodiment, the FOLH1 protein is a fragment of SEQ ID No: 43. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein has the sequence:
In another embodiment, the FOLH1 protein is a homologue of SEQ ID No: 44. In another embodiment, the FOLH1 protein is a variant of SEQ ID No: 44. In another embodiment, the FOLH1 protein is an isomer of SEQ ID No: 44. In another embodiment, the FOLH1 protein is a fragment of SEQ ID No: 44. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein has the sequence:
In another embodiment, the FOLH1 protein is a homologue of SEQ ID No: 45. In another embodiment, the FOLH1 protein is a variant of SEQ ID No: 45. In another embodiment, the FOLH1 protein is an isomer of SEQ ID No: 45. In another embodiment, the FOLH1 protein is a fragment of SEQ ID No: 45. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein is encoded by a sequence set forth in one of the following GenBank Accession Numbers: NM_001014986, NM_004476, BC108719. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein has the sequence that comprises a sequence set forth in one of the above GenBank Accession Numbers. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 protein is any other FOLH1 protein known in the art. Each FOLH1 protein represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a vaccine comprising a recombinant Listeria strain of the present invention and an adjuvant.
In another embodiment, the present invention provides an immunogenic composition comprising a recombinant Listeria strain of the present invention.
In another embodiment, the recombinant Listeria strain expresses a recombinant polypeptide that comprises a KLK3 peptide. In another embodiment, the recombinant Listeria strain comprises a recombinant polypeptide, wherein the recombinant peptide comprises a KLK3 peptide. In another embodiment, the recombinant Listeria strain comprises a recombinant nucleotide encoding the recombinant polypeptide. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the recombinant Listeria strain expresses a recombinant polypeptide that comprises an FOLH1 peptide. In another embodiment, the recombinant Listeria strain comprises a recombinant polypeptide, wherein the recombinant peptide comprises an FOLH1 peptide. In another embodiment, the recombinant Listeria strain comprises a recombinant nucleotide encoding the recombinant polypeptide. Each possibility represents a separate embodiment of the present invention.
The KLK3 peptide expressed by the recombinant Listeria strain is, in another embodiment, in the form of a fusion peptide. In another embodiment, the fusion peptide further comprises a non-KLK3 peptide. In another embodiment, the non-KLK3 peptide enhances the immunogenicity of the KLK3 peptide. Each possibility represents a separate embodiment of the present invention.
In another embodiment, an FOLH1 peptide expressed by the recombinant Listeria strain is in the form of a fusion peptide. In another embodiment, the fusion peptide further comprises a non-FOLH1 peptide. In another embodiment, the non-FOLH1 peptide enhances the immunogenicity of the FOLH1 peptide. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the non-KLK3/non-FOLH1 peptide of methods and compositions of the present invention is a non-hemolytic LLO peptide. In another embodiment, the non-KLK3/non-FOLH1 peptide is an ActA peptide. In another embodiment, the non-KLK3/non-FOLH1 peptide is a PEST-like sequence-containing peptide. In another embodiment, the non-KLK3/non-FOLH1 peptide is any other non-KLK3/non-FOLH1 peptide known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant Listeria strain comprising a recombinant polypeptide of the present invention. In another embodiment, the present invention provides a recombinant Listeria strain comprising a recombinant nucleotide encoding a recombinant polypeptide of the present invention. In another embodiment, the Listeria vaccine strain is a strain of the species Listeria monocytogenes (LM). In another embodiment, the present invention provides a composition comprising the Listeria strain. In another embodiment, the present invention provides an immunogenic composition comprising the Listeria strain. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the Listeria strain is a recombinant Listeria seeligeri strain. In another embodiment, the Listeria strain is a recombinant Listeria grayi strain. In another embodiment, the Listeria strain is a recombinant Listeria ivanovii strain. In another embodiment, the Listeria strain is a recombinant Listeria murrayi strain. In another embodiment, the Listeria strain is a recombinant Listeria welshimeri strain. In another embodiment, the Listeria strain is a recombinant strain of any other Listeria species known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a recombinant Listeria strain of the present invention has been passaged through an animal host. In another embodiment, the passaging maximizes efficacy of the strain as a vaccine vector. In another embodiment, the passaging stabilizes the immunogenicity of the Listeria strain. In another embodiment, the passaging stabilizes the virulence of the Listeria strain. In another embodiment, the passaging increases the immunogenicity of the Listeria strain. In another embodiment, the passaging increases the virulence of the Listeria strain. In another embodiment, the passaging removes unstable sub-strains of the Listeria strain. In another embodiment, the passaging reduces the prevalence of unstable sub-strains of the Listeria strain. In another embodiment, the Listeria strain contains a genomic insertion of the gene encoding the KLK3 peptide-containing recombinant peptide. In another embodiment, the Listeria strain contains a genomic insertion of the gene encoding the FOLH1 peptide-containing recombinant peptide. In another embodiment, the Listeria strain carries a plasmid comprising the gene encoding the KLK3 peptide-containing recombinant peptide. In another embodiment, the Listeria strain carries a plasmid comprising the gene encoding the FOLH1 peptide-containing recombinant peptide. Methods for passaging a recombinant Listeria strain through an animal host are well known in the art, and are described, for example, in United States Patent Application No. 2006/0233835, which is incorporated herein by reference. In another embodiment, the passaging is performed by any other method known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the recombinant Listeria strain utilized in methods of the present invention has been stored in a frozen cell bank. In another embodiment, the recombinant Listeria strain has been stored in a lyophilized cell bank. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the cell bank of methods and compositions of the present invention is a master cell bank. In another embodiment, the cell bank is a working cell bank. In another embodiment, the cell bank is Good Manufacturing Practice (GMP) cell bank. In another embodiment, the cell bank is intended for production of clinical-grade material. In another embodiment, the cell bank conforms to regulatory practices for human use. In another embodiment, the cell bank is any other type of cell bank known in the art. Each possibility represents a separate embodiment of the present invention.
“Good Manufacturing Practices” are defined, in another embodiment, by (21 CFR 210-211) of the United States Code of Federal Regulations. In another embodiment, “Good Manufacturing Practices” are defined by other standards for production of clinical-grade material or for human consumption; e.g. standards of a country other than the United States. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a recombinant Listeria strain utilized in methods of the present invention is from a batch of vaccine doses.
In another embodiment, a recombinant Listeria strain utilized in methods of the present invention is from a frozen stock produced by a method disclosed herein.
In another embodiment, a recombinant Listeria strain utilized in methods of the present invention is from a lyophilized stock produced by a method disclosed herein.
In another embodiment, a cell bank, frozen stock, or batch of vaccine doses of the present invention exhibits viability upon thawing of greater than 90%. In another embodiment, the thawing follows storage for cryopreservation or frozen storage for 24 hours. In another embodiment, the storage is for 2 days. In another embodiment, the storage is for 3 days. In another embodiment, the storage is for 4 days. In another embodiment, the storage is for 1 week. In another embodiment, the storage is for 2 weeks. In another embodiment, the storage is for 3 weeks. In another embodiment, the storage is for 1 month. In another embodiment, the storage is for 2 months. In another embodiment, the storage is for 3 months. In another embodiment, the storage is for 5 months. In another embodiment, the storage is for 6 months. In another embodiment, the storage is for 9 months. In another embodiment, the storage is for 1 year. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a cell bank, frozen stock, or batch of vaccine doses of the present invention is cryopreserved by a method that comprises growing a culture of the Listeria strain in a nutrient media, freezing the culture in a solution comprising glycerol, and storing the Listeria strain at below −20 degrees Celsius. In another embodiment, the temperature is about −70 degrees Celsius. In another embodiment, the temperature is about −70-−80 degrees Celsius.
In another embodiment, a cell bank, frozen stock, or batch of vaccine doses of the present invention is cryopreserved by a method that comprises growing a culture of the Listeria strain in a defined media of the present invention (as described below), freezing the culture in a solution comprising glycerol, and storing the Listeria strain at below −20 degrees Celsius. In another embodiment, the temperature is about −70 degrees Celsius. In another embodiment, the temperature is about −70-−80 degrees Celsius. In another embodiment, any defined microbiological media of the present invention may be used in this method. Each defined microbiological media represents a separate embodiment of the present invention.
In another embodiment of methods and compositions of the present invention, the culture (e.g. the culture of a Listeria vaccine strain that is used to produce a batch of Listeria vaccine doses) is inoculated from a cell bank. In another embodiment, the culture is inoculated from a frozen stock. In another embodiment, the culture is inoculated from a starter culture. In another embodiment, the culture is inoculated from a colony. In another embodiment, the culture is inoculated at mid-log growth phase. In another embodiment, the culture is inoculated at approximately mid-log growth phase. In another embodiment, the culture is inoculated at another growth phase. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the solution used for freezing contains another colligative additive or additive with anti-freeze properties, in place of glycerol. In another embodiment, the solution used for freezing contains another colligative additive or additive with anti-freeze properties, in addition to glycerol. In another embodiment, the additive is mannitol. In another embodiment, the additive is DMSO. In another embodiment, the additive is sucrose. In another embodiment, the additive is any other colligative additive or additive with anti-freeze properties that is known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the nutrient media utilized for growing a culture of a Listeria strain is LB. In another embodiment, the nutrient media is TB. In another embodiment, the nutrient media is a modified, animal-product free Terrific Broth. In another embodiment, the nutrient media is a defined media. In another embodiment, the nutrient media is a defined media of the present invention. In another embodiment, the nutrient media is any other type of nutrient media known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment of methods and compositions of the present invention, the step of growing is performed with a shake flask. In another embodiment, the flask is a baffled shake flask. In another embodiment, the growing is performed with a batch fermenter. In another embodiment, the growing is performed with a stirred tank or flask. In another embodiment, the growing is performed with an airflit fermenter. In another embodiment, the growing is performed with a fed batch. In another embodiment, the growing is performed with a continuous cell reactor. In another embodiment, the growing is performed with an immobilized cell reactor. In another embodiment, the growing is performed with any other means of growing bacteria that is known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a constant pH is maintained during growth of the culture (e.g. in a batch fermenter). In another embodiment, the pH is maintained at about 7.0. In another embodiment, the pH is about 6. In another embodiment, the pH is about 6.5. In another embodiment, the pH is about 7.5. In another embodiment, the pH is about 8. In another embodiment, the pH is 6.5-7.5. In another embodiment, the pH is 6-8. In another embodiment, the pH is 6-7. In another embodiment, the pH is 7-8. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a constant temperature is maintained during growth of the culture. In another embodiment, the temperature is maintained at about 37° C. In another embodiment, the temperature is 37° C. In another embodiment, the temperature is 25° C. In another embodiment, the temperature is 27° C. In another embodiment, the temperature is 28° C. In another embodiment, the temperature is 30° C. In another embodiment, the temperature is 32° C. In another embodiment, the temperature is 34° C. In another embodiment, the temperature is 35° C. In another embodiment, the temperature is 36° C. In another embodiment, the temperature is 38° C. In another embodiment, the temperature is 39° C. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a constant dissolved oxygen concentration is maintained during growth of the culture. In another embodiment, the dissolved oxygen concentration is maintained at 20% of saturation. In another embodiment, the concentration is 15% of saturation. In another embodiment, the concentration is 16% of saturation. In another embodiment, the concentration is 18% of saturation. In another embodiment, the concentration is 22% of saturation. In another embodiment, the concentration is 25% of saturation. In another embodiment, the concentration is 30% of saturation. In another embodiment, the concentration is 35% of saturation. In another embodiment, the concentration is 40% of saturation. In another embodiment, the concentration is 45% of saturation. In another embodiment, the concentration is 50% of saturation. In another embodiment, the concentration is 55% of saturation. In another embodiment, the concentration is 60% of saturation. In another embodiment, the concentration is 65% of saturation. In another embodiment, the concentration is 70% of saturation. In another embodiment, the concentration is 75% of saturation. In another embodiment, the concentration is 80% of saturation. In another embodiment, the concentration is 85% of saturation. In another embodiment, the concentration is 90% of saturation. In another embodiment, the concentration is 95% of saturation. In another embodiment, the concentration is 100% of saturation. In another embodiment, the concentration is near 100% of saturation. Each possibility represents a separate embodiment of the present invention.
In another embodiment of methods and compositions of the present invention, the Listeria culture is flash-frozen in liquid nitrogen, followed by storage at the final freezing temperature. In another embodiment, the culture is frozen in a more gradual manner; e.g. by placing in a vial of the culture in the final storage temperature. In another embodiment, the culture is frozen by any other method known in the art for freezing a bacterial culture. Each possibility represents a separate embodiment of the present invention.
In another embodiment of methods and compositions of the present invention, the storage temperature of the culture is between −20 and −80 degrees Celsius (° C.). In another embodiment, the temperature is significantly below −20° C. In another embodiment, the temperature is not warmer than −70° C. In another embodiment, the temperature is −70° C. In another embodiment, the temperature is about −70° C. In another embodiment, the temperature is −20° C. In another embodiment, the temperature is about −20° C. In another embodiment, the temperature is −30° C. In another embodiment, the temperature is −40° C. In another embodiment, the temperature is −50° C. In another embodiment, the temperature is −60° C. In another embodiment, the temperature is −80° C. In another embodiment, the temperature is −30-−70° C. In another embodiment, the temperature is −40-−70° C. In another embodiment, the temperature is −50-−70° C. In another embodiment, the temperature is −60-−70° C. In another embodiment, the temperature is −30-−80° C. In another embodiment, the temperature is −40-−80° C. In another embodiment, the temperature is −50-−80° C. In another embodiment, the temperature is −60-−80° C. In another embodiment, the temperature is −70-−80° C. In another embodiment, the temperature is colder than −70° C. In another embodiment, the temperature is colder than −80° C. Each possibility represents a separate embodiment of the present invention.
Methods for lyophilization and cryopreservation of recombinant Listeria strains are well known to those skilled in the art. Each possibility represents a separate embodiment of the present invention.
The Listeria-containing composition of methods and compositions of the present invention is, in another embodiment, an immunogenic composition. In another embodiment, the composition is inherently immunogenic by virtue of its comprising a Listeria strain of the present invention. In another embodiment, the composition further comprises an adjuvant. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant polypeptide, comprising a KLK3 peptide operatively linked to a non-KLK3 peptide. In another embodiment, the non-KLK3 peptide is an LLO peptide. In another embodiment, the non-KLK3 peptide is an ActA peptide. In another embodiment, the non-KLK3 peptide is a PEST-like sequence peptide. In another embodiment, the non-KLK3 peptide enhances the immunogenicity of the KLK3 peptide. In another embodiment, the non-KLK3 peptide is any other type of peptide known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a recombinant polypeptide, comprising an FOLH1 peptide operatively linked to a non-FOLH1 peptide. In another embodiment, the non-FOLH1 peptide is an LLO peptide. In another embodiment, the non-FOLH1 peptide is an ActA peptide. In another embodiment, the non-FOLH1 peptide is a PEST-like sequence peptide. In another embodiment, the non-FOLH1 peptide enhances the immunogenicity of the FOLH1 peptide. In another embodiment, the non-FOLH1 peptide is any other type of peptide known in the art. Each possibility represents a separate embodiment of the present invention.
As provided herein, a recombinant Listeria strain expressing an LLO-KLK3 fusion protects mice from tumors and elicits formation of antigen-specific CTL. Thus, Listeria strains expressing prostate-specific antigens (e.g. prostate-specific antigen/KLK3 and prostate-specific membrane antigen/FOLH1) are antigenic and efficacious in vaccination methods. Further, fusions of LLO and fragments thereof to prostate-specific antigens (e.g. prostate-specific antigen/KLK3 and prostate-specific membrane antigen/FOLH1) are antigenic and efficacious in vaccination methods.
Further, as provided herein, Lm-LLO-E7 induces regression of established subcutaneous HPV-16 immortalized tumors from C57B1/6 mice (Example 1). Further, as provided herein, Lm-LLO-NP protects mice from RENCA-NP, a renal cell carcinoma (Example 3). Further, as provided herein, fusion of antigens to ActA and PEST-like sequences produces similar results. Thus, non-hemolytic LLO, ActA, and PEST-like sequences are all efficacious at enhancing the immunogenicity of KLK3 and FOLH1 peptides.
In another embodiment, the present invention provides a vaccine comprising a recombinant polypeptide of the present invention and an adjuvant.
In another embodiment, the present invention provides an immunogenic composition comprising a recombinant polypeptide of the present invention.
In another embodiment, the present invention provides a recombinant vaccine vector encoding a recombinant polypeptide of the present invention.
In another embodiment, the present invention provides a nucleotide molecule encoding a recombinant polypeptide of the present invention.
In another embodiment, the present invention provides a vaccine comprising a nucleotide molecule of the present invention and an adjuvant.
In another embodiment, the present invention provides an immunogenic composition comprising a nucleotide molecule of the present invention.
In another embodiment, the present invention provides a recombinant vaccine vector comprising a nucleotide molecule of the present invention.
In other embodiments, the adjuvant of methods and compositions of the present invention is Montanide ISA 51. Montanide ISA 51 contains a natural metabolizable oil and a refined emulsifier. In another embodiment, the adjuvant is GM-CSF. In another embodiment, the adjuvant is KLH. Recombinant GM-CSF is a human protein grown, in another embodiment, in a yeast (S. cerevisiae) vector. GM-CSF promotes clonal expansion and differentiation of hematopoietic progenitor cells, APC, and dendritic cells and T cells.
In another embodiment, the adjuvant is a cytokine. In another embodiment, the adjuvant is a growth factor. In another embodiment, the adjuvant is a cell population. In another embodiment, the adjuvant is QS21. In another embodiment, the adjuvant is Freund's incomplete adjuvant. In another embodiment, the adjuvant is aluminum phosphate. In another embodiment, the adjuvant is aluminum hydroxide. In another embodiment, the adjuvant is BCG. In another embodiment, the adjuvant is alum. In another embodiment, the adjuvant is an interleukin. In another embodiment, the adjuvant is an unmethylated CpG oligonucleotide. In another embodiment, the adjuvant is quill glycosides. In another embodiment, the adjuvant is monophosphoryl lipid A. In another embodiment, the adjuvant is liposomes. In another embodiment, the adjuvant is a bacterial mitogen. In another embodiment, the adjuvant is a bacterial toxin. In another embodiment, the adjuvant is a chemokine. In another embodiment, the adjuvant is any other type of adjuvant known in the art. In another embodiment, the vaccine of methods and compositions of the present invention comprises 2 of the above adjuvants. In another embodiment, the vaccine comprises more than 2 of the above adjuvants. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-KLK3 immune response in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby inducing an anti-KLK3 immune response in a subject.
In another embodiment, the present invention provides a method of treating a KLK3-expressing tumor in a subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the KLK3-expressing tumor, thereby treating a KLK3-expressing tumor in a subject. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against a KLK3-expressing tumor, the method comprising the step of administering to the human subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the KLK3-expressing tumor, thereby protecting a human subject against a KLK3-expressing tumor. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-FOLH1 immune response in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby inducing an anti-FOLH1 immune response in a subject.
In another embodiment, the present invention provides a method of treating an FOLH1-expressing tumor in a subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby treating an FOLH1-expressing tumor in a subject. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against an FOLH1-expressing tumor, the method comprising the step of administering to the human subject a composition comprising a recombinant Listeria strain of the present invention, whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby protecting a human subject against an FOLH1-expressing tumor. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
Methods for assessing efficacy of prostate cancer vaccines are well known in the art, and are described, for example, in Dzojic H et al (Adenovirus-mediated CD40 ligand therapy induces tumor cell apoptosis and systemic immunity in the TRAMP-C2 mouse prostate cancer model. Prostate. 2006 Jun. 1; 66(8):831-8), Naruishi K et al (Adenoviral vector-mediated RTVP-1 gene-modified tumor cell-based vaccine suppresses the development of experimental prostate cancer. Cancer Gene Ther. 2006 July; 13(7):658-63), Sehgal I et al (Cancer Cell Int. 2006 Aug. 23; 6:21), and Heinrich J E et al (Vaccination against prostate cancer using a live tissue factor deficient cell line in Lobund-Wistar rats. Cancer Immunol Immunother 2007; 56(5):725-30). Each possibility represents a separate embodiment of the present invention.
In another embodiment, the prostate cancer model used to test methods and compositions of the present invention is the TRAMP-C2 mouse model. In another embodiment, the prostate cancer model is a 178-2 BMA cell model. In another embodiment, the prostate cancer model is a PAIII adenocarcinoma cells model. In another embodiment, the prostate cancer model is a PC-3M model. In another embodiment, the prostate cancer model is any other prostate cancer model known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the vaccine is tested in human subjects, and efficacy is monitored using methods well known in the art, e.g. directly measuring CD4+ and CD8+ T cell responses, or measuring disease progression, e.g. by determining the number or size of tumor metastases, or monitoring disease symptoms (cough, chest pain, weight loss, etc). Methods for assessing the efficacy of a prostate cancer vaccine in human subjects are well known in the art, and are described, for example, in Uenaka A et al (T cell immunomonitoring and tumor responses in patients immunized with a complex of cholesterol-bearing hydrophobized pullulan (CHP) and NY-ESO-1 protein. Cancer Immun. 2007 Apr. 19; 7:9) and Thomas-Kaskel A K et al (Vaccination of advanced prostate cancer patients with PSCA and PSA peptide-loaded dendritic cells induces DTH responses that correlate with superior overall survival. Int J Cancer. 2006 Nov. 15; 119(10):2428-34). Each method represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-KLK3 immune response in a subject, comprising administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, thereby inducing an anti-KLK3 immune response in a subject.
In another embodiment, the present invention provides a method of treating a KLK3-expressing tumor in a subject, the method comprising the step of administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, whereby the subject mounts an immune response against the KLK3 expressing tumor, thereby treating a KLK3 expressing tumor in a subject. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against a KLK3 expressing tumor, the method comprising the step of administering to the human subject an immunogenic composition comprising a recombinant polypeptide of the present invention, whereby the subject mounts an immune response against the KLK3 expressing tumor, thereby protecting a human subject against a KLK3 expressing tumor. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-KLK3 immune response in a subject, comprising administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, thereby inducing an anti-KLK3 immune response in a subject.
In another embodiment, the present invention provides a method of treating a KLK3 expressing tumor in a subject, the method comprising the step of administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, whereby the subject mounts an immune response against the KLK3 expressing tumor, thereby treating a KLK3 expressing tumor in a subject. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against a KLK3 expressing tumor, the method comprising the step of administering to the human subject an immunogenic composition comprising a nucleotide molecule of the present invention whereby the subject mounts an immune response against the KLK3 expressing tumor, thereby protecting a human subject against a KLK3 expressing tumor. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-KLK3 immune response in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain, wherein the strain comprises a recombinant polypeptide of the present invention, thereby inducing an anti-KLK3 immune response in a subject.
In another embodiment, the present invention provides a method of treating a KLK3 expressing tumor in a subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain, wherein the strain comprises a recombinant polypeptide of the present invention, whereby the subject mounts an immune response against the KLK3 expressing tumor, thereby treating a KLK3 expressing tumor in a subject. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against a KLK3 expressing tumor, the method comprising the step of administering to the human subject a composition comprising a recombinant Listeria strain, wherein the strain comprises a recombinant polypeptide of the present invention whereby the subject mounts an immune response against the KLK3 expressing tumor, thereby protecting a human subject against a KLK3 expressing tumor. In another embodiment, the KLK3 expressing tumor is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of impeding a growth of a KLK3-expressing prostate cancer tumor in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby impeding a growth of a KLK3-expressing prostate cancer tumor in a subject.
In another embodiment, the present invention provides a method of overcoming an immune tolerance of a subject to a KLK3-expressing prostate cancer tumor, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby overcoming an immune tolerance of a subject to a KLK3-expressing prostate cancer tumor.
In another embodiment, the present invention provides a method of impeding a growth of a KLK3-expressing prostate cancer tumor in a subject, comprising administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, thereby impeding a growth of a KLK3-expressing prostate cancer tumor in a subject.
In another embodiment, the present invention provides a method of overcoming an immune tolerance of a subject to a KLK3-expressing prostate cancer tumor, comprising administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, thereby overcoming an immune tolerance of a subject to a KLK3-expressing prostate cancer tumor.
In another embodiment, the present invention provides a method of impeding a growth of a KLK3-expressing prostate cancer tumor in a subject, comprising administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, thereby impeding a growth of a KLK3-expressing prostate cancer tumor in a subject.
In another embodiment, the present invention provides a method of overcoming an immune tolerance of a subject to a KLK3-expressing prostate cancer tumor, comprising administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, thereby overcoming an immune tolerance of a subject to a KLK3-expressing prostate cancer tumor.
In another embodiment, the present invention provides a method of inducing an anti-FOLH1 immune response in a subject, comprising administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, thereby inducing an anti-FOLH1 immune response in a subject.
In another embodiment, the present invention provides a method of treating an FOLH1-expressing tumor in a subject, the method comprising the step of administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby treating an FOLH1-expressing tumor in a subject. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against an FOLH1-expressing tumor, the method comprising the step of administering to the human subject an immunogenic composition comprising a recombinant polypeptide of the present invention, whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby protecting a human subject against an FOLH1-expressing tumor. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-FOLH1 immune response in a subject, comprising administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, thereby inducing an anti-FOLH1 immune response in a subject.
In another embodiment, the present invention provides a method of treating an FOLH1-expressing tumor in a subject, the method comprising the step of administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby treating an FOLH1-expressing tumor in a subject. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against an FOLH1-expressing tumor, the method comprising the step of administering to the human subject an immunogenic composition comprising a nucleotide molecule of the present invention whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby protecting a human subject against an FOLH1-expressing tumor. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of inducing an anti-FOLH1 immune response in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain, wherein the strain comprises a recombinant polypeptide of the present invention, thereby inducing an anti-FOLH1 immune response in a subject.
In another embodiment, the present invention provides a method of treating an FOLH1-expressing tumor in a subject, the method comprising the step of administering to the subject a composition comprising a recombinant Listeria strain, wherein the strain comprises a recombinant polypeptide of the present invention, whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby treating an FOLH1-expressing tumor in a subject. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of protecting a human subject against an FOLH1-expressing tumor, the method comprising the step of administering to the human subject a composition comprising a recombinant Listeria strain, wherein the strain comprises a recombinant polypeptide of the present invention whereby the subject mounts an immune response against the FOLH1-expressing tumor, thereby protecting a human subject against an FOLH1-expressing tumor. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of impeding a growth of an FOLH1-expressing prostate cancer tumor in a subject, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby impeding a growth of an FOLH1-expressing prostate cancer tumor in a subject.
In another embodiment, the present invention provides a method of overcoming an immune tolerance of a subject to an FOLH1-expressing prostate cancer tumor, comprising administering to the subject a composition comprising a recombinant Listeria strain of the present invention, thereby overcoming an immune tolerance of a subject to an FOLH1-expressing prostate cancer tumor.
In another embodiment, the present invention provides a method of impeding a growth of an FOLH1-expressing prostate cancer tumor in a subject, comprising administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, thereby impeding a growth of an FOLH1-expressing prostate cancer tumor in a subject.
In another embodiment, the present invention provides a method of overcoming an immune tolerance of a subject to an FOLH1-expressing prostate cancer tumor, comprising administering to the subject an immunogenic composition comprising a recombinant polypeptide of the present invention, thereby overcoming an immune tolerance of a subject to an FOLH1-expressing prostate cancer tumor.
In another embodiment, the present invention provides a method of impeding a growth of an FOLH1-expressing prostate cancer tumor in a subject, comprising administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, thereby impeding a growth of an FOLH1-expressing prostate cancer tumor in a subject.
In another embodiment, the present invention provides a method of overcoming an immune tolerance of a subject to an FOLH1-expressing prostate cancer tumor, comprising administering to the subject an immunogenic composition comprising a nucleotide molecule of the present invention, thereby overcoming an immune tolerance of a subject to an FOLH1-expressing prostate cancer tumor.
“Tolerance” refers, in another embodiment, to a lack of responsiveness of the host to an antigen. In another embodiment, the term refers to a lack of detectable responsiveness of the host to an antigen. In another embodiment, the term refers to a lack of immunogenicity of an antigen in a host. In another embodiment, tolerance is measured by lack of responsiveness in an in vitro CTL assay. In another embodiment, tolerance is measured by lack of responsiveness in a delayed-type hypersensitivity assay. In another embodiment, tolerance is measured by lack of responsiveness in any other suitable assay known in the art. In another embodiment, tolerance is determined or measured as depicted in the Examples herein. Each possibility represents another embodiment of the present invention.
“Overcome” refers, in another embodiment, to a reversible of tolerance by a vaccine. In another embodiment, the term refers to conferment of detectable immune response by a vaccine. In another embodiment, overcoming of immune tolerance is determined or measured as depicted in the Examples herein. Each possibility represents another embodiment of the present invention.
In another embodiment, the present invention provides a method of treating benign prostate hyperplasia (BPH) in a subject, the method comprising the step of administering to the subject a KLK3-expressing Listeria strain of the present invention, thereby treating BPH in a subject. In another embodiment, the present invention provides a method of impeding the progression of BPH in a subject, the method comprising the step of administering to the subject a KLK3-expressing Listeria strain of the present invention, thereby impeding the progression of BPH in a subject.
In another embodiment, the present invention provides a method of treating BPH in a subject, the method comprising the step of administering to the subject an FOLH1-expressing Listeria strain of the present invention, thereby treating BPH in a subject. In another embodiment, the present invention provides a method of impeding the progression of BPH in a subject, the method comprising the step of administering to the subject an FOLH1-expressing Listeria strain of the present invention, thereby impeding the progression of BPH in a subject.
In another embodiment, the present invention provides a method of treating Prostatic Intraepithelial Neoplasia (PIN) in a subject, the method comprising the step of administering to the subject a KLK3-expressing Listeria strain of the present invention, thereby treating PIN in a subject. In another embodiment, the present invention provides a method of impeding the progression of PIN in a subject, the method comprising the step of administering to the subject a KLK3-expressing Listeria strain of the present invention, thereby impeding the progression of PIN in a subject.
In another embodiment, the present invention provides a method of treating Prostatic Intraepithelial Neoplasia (PIN) in a subject, the method comprising the step of administering to the subject an FOLH1-expressing Listeria strain of the present invention, thereby treating PIN in a subject. In another embodiment, the present invention provides a method of impeding the progression of PIN in a subject, the method comprising the step of administering to the subject an FOLH1-expressing Listeria strain of the present invention, thereby impeding the progression of PIN in a subject.
In another embodiment, the present invention provides a method of treating BPH in a subject, the method comprising the step of administering to the subject a KLK3-containing peptide of the present invention, thereby treating BPH in a subject. In another embodiment, the present invention provides a method of impeding the progression of BPH in a subject, the method comprising the step of administering to the subject a KLK3-containing peptide of the present invention, thereby impeding the progression of BPH in a subject.
In another embodiment, the present invention provides a method of treating BPH in a subject, the method comprising the step of administering to the subject an FOLH1-containing peptide of the present invention, thereby treating BPH in a subject. In another embodiment, the present invention provides a method of impeding the progression of BPH in a subject, the method comprising the step of administering to the subject an FOLH1-containing peptide of the present invention, thereby impeding the progression of BPH in a subject.
In another embodiment, the present invention provides a method of treating Prostatic Intraepithelial Neoplasia (PIN) in a subject, the method comprising the step of administering to the subject a KLK3-containing peptide of the present invention, thereby treating PIN in a subject. In another embodiment, the present invention provides a method of impeding the progression of PIN in a subject, the method comprising the step of administering to the subject a KLK3-containing peptide of the present invention, thereby impeding the progression of PIN in a subject.
In another embodiment, the present invention provides a method of treating Prostatic Intraepithelial Neoplasia (PIN) in a subject, the method comprising the step of administering to the subject an FOLH1-containing peptide of the present invention, thereby treating PIN in a subject. In another embodiment, the present invention provides a method of impeding the progression of PIN in a subject, the method comprising the step of administering to the subject an FOLH1-containing peptide of the present invention, thereby impeding the progression of PIN in a subject.
In another embodiment, the present invention provides a method of treating BPH in a subject, the method comprising the step of administering to the subject a KLK3-encoding nucleotide molecule of the present invention, thereby treating BPH in a subject. In another embodiment, the present invention provides a method of impeding the progression of BPH in a subject, the method comprising the step of administering to the subject a KLK3-encoding nucleotide molecule of the present invention, thereby impeding the progression of BPH in a subject.
In another embodiment, the present invention provides a method of treating BPH in a subject, the method comprising the step of administering to the subject an FOLH1-encoding nucleotide molecule of the present invention, thereby treating BPH in a subject. In another embodiment, the present invention provides a method of impeding the progression of BPH in a subject, the method comprising the step of administering to the subject an FOLH1-encoding nucleotide molecule of the present invention, thereby impeding the progression of BPH in a subject.
In another embodiment, the present invention provides a method of treating Prostatic Intraepithelial Neoplasia in a subject, the method comprising the step of administering to the subject a KLK3-encoding nucleotide molecule of the present invention, thereby treating Prostatic Intraepithelial Neoplasia in a subject. In another embodiment, the present invention provides a method of impeding the progression of Prostatic Intraepithelial Neoplasia in a subject, the method comprising the step of administering to the subject a KLK3-encoding nucleotide molecule of the present invention, thereby impeding the progression of Prostatic Intraepithelial Neoplasia in a subject.
In another embodiment, the present invention provides a method of treating Prostatic Intraepithelial Neoplasia in a subject, the method comprising the step of administering to the subject an FOLH1-encoding nucleotide molecule of the present invention, thereby treating Prostatic Intraepithelial Neoplasia in a subject. In another embodiment, the present invention provides a method of impeding the progression of Prostatic Intraepithelial Neoplasia in a subject, the method comprising the step of administering to the subject an FOLH1-encoding nucleotide molecule of the present invention, thereby impeding the progression of Prostatic Intraepithelial Neoplasia in a subject.
In another embodiment, fusion proteins of the present invention need not be expressed by LM, but rather can be expressed and isolated from other vectors and cell systems used for protein expression and isolation.
As provided herein, LLO-E7 fusions exhibit significant therapeutic efficacy. In these experiments, a vaccinia vector that expresses E7 as a fusion protein with a non-hemolytic truncated form of LLO was constructed. Expression of the LLO-E7 fusion product by plaque purified vaccinia was verified by Western blot using an antibody directed against the LLO protein sequence. Vac-LLO-E7 was demonstrated to produce CD8+ T cells specific to LLO and E7 as determined using the LLO (91-99) and E7 (49-57) epitopes of Balb/c and C57/BL6 mice, respectively. Results were confirmed by a CTL assay (Example 4).
Thus, expression of an antigen, e.g. KLK3 or FOLH1, as a fusion protein with a non-hemolytic truncated form of LLO, ActA, or a PEST-like sequence in host cell systems in Listeria and host cell systems other than Listeria results in enhanced immunogenicity of the antigen. While comparative experiments were performed with vaccinia, a multitude of other plasmids and expression systems which can be used to express these fusion proteins are known. For example, bacterial vectors useful in the present invention include, but are not limited to Salmonella sp., Shigella sp., BCG, L. monocytogenes and S. gordonii. In addition the fusion proteins can be delivered by recombinant bacterial vectors modified to escape phagolysosomal fusion and live in the cytoplasm of the cell. Viral vectors useful in the present invention include, but are not limited to, Vaccinia, Avipox, Adenovirus, AAV, Vaccinia virus NYVAC, Modified vaccinia strain Ankara (MVA), Semliki Forest virus, Venezuelan equine encephalitis virus, herpes viruses, and retroviruses. Naked DNA vectors can also be used.
In another embodiment, a KLK3 protein expressed by the target tumor cell shares complete homology with the KLK3 peptide (throughout the length of the peptide) expressed by the Listerial vector. In another embodiment, the KLK3 protein is highly homologous (throughout the length of the peptide) to the KLK3 peptide expressed by the Listerial vector. “Highly homologous” refers, in another embodiment, to a homology of greater than 90%. In another embodiment, the term refers to a homology of greater than 92%. In another embodiment, the term refers to a homology of greater than 93%. In another embodiment, the term refers to a homology of greater than 94%. In another embodiment, the term refers to a homology of greater than 95%. In another embodiment, the term refers to a homology of greater than 96%. In another embodiment, the term refers to a homology of greater than 97%. In another embodiment, the term refers to a homology of greater than 98%. In another embodiment, the term refers to a homology of greater than 99%. In another embodiment, the term refers to a homology of 100%. Each possibility represents a separate embodiment of the present invention.
In another embodiment, an FOLH1 protein expressed by the target tumor cell shares complete homology with the FOLH1 peptide (throughout the length of the peptide) expressed by the Listerial vector. In another embodiment, the FOLH1 protein is highly homologous (throughout the length of the peptide) to the FOLH1 peptide expressed by the Listerial vector. “Highly homologous” refers, in another embodiment, to a homology of greater than 90%. In another embodiment, the term refers to a homology of greater than 92%. In another embodiment, the term refers to a homology of greater than 93%. In another embodiment, the term refers to a homology of greater than 94%. In another embodiment, the term refers to a homology of greater than 95%. In another embodiment, the term refers to a homology of greater than 96%. In another embodiment, the term refers to a homology of greater than 97%. In another embodiment, the term refers to a homology of greater than 98%. In another embodiment, the term refers to a homology of greater than 99%. In another embodiment, the term refers to a homology of 100%. Each possibility represents a separate embodiment of the present invention.
The KLK3 peptide of methods and compositions of the present invention is, in another embodiment, 200-261 amino acids (AA) in length. In another embodiment, the KLK3 peptide is about 100-261 AA long. In another embodiment, the length is 100-261 AA. In another embodiment, the length is 110-261 AA. In another embodiment, the length is 120-261 AA. In another embodiment, the length is 130-261 AA. In another embodiment, the length is 140-261 AA. In another embodiment, the length is 150-261 AA. In another embodiment, the length is 160-261 AA. In another embodiment, the length is 175-261 AA. In another embodiment, the length is 190-261 AA. In another embodiment, the length is 200-261 AA. In another embodiment, the length is 210-261 AA. In another embodiment, the length is 220-261 AA. In another embodiment, the length is 230-261 AA. In another embodiment, the length is 240-261 AA. In another embodiment, the length is 250-261 AA. In another embodiment, the length is 100-150 AA. In another embodiment, the length is 100-160 AA. In another embodiment, the length is 100-170 AA. In another embodiment, the length is 100-180 AA. In another embodiment, the length is 100-190 AA. In another embodiment, the length is 100-200 AA. In another embodiment, the length is 100-210 AA. In another embodiment, the length is 100-220 AA. In another embodiment, the length is 100-240 AA. In another embodiment, the length is 50-150 AA. In another embodiment, the length is 50-160 AA. In another embodiment, the length is 50-170 AA. In another embodiment, the length is 50-180 AA. In another embodiment, the length is 50-190 AA. In another embodiment, the length is 50-200 AA.
In another embodiment, the length is about 175 AA. In another embodiment, the length is about 200 AA. In another embodiment, the length is about 220 AA. In another embodiment, the length is about 240 AA. In another embodiment, the length is about 260 AA.
Each length represents a separate embodiment of the present invention.
In another embodiment, the KLK3 peptide consists of about one-third to one-half of the KLK3 protein. In another embodiment, the fragment consists of about one-tenth to one-fifth thereof. In another embodiment, the fragment consists of about one-fifth to one-fourth thereof. In another embodiment, the fragment consists of about one-fourth to one-third thereof. In another embodiment, the fragment consists of about one-third to one-half thereof. In another embodiment, the fragment consists of about one-half to three quarters thereof. In another embodiment, the fragment consists of about three quarters to the KLK3 protein. In another embodiment, the fragment consists of about 5-10% thereof. In another embodiment, the fragment consists of about 10-15% thereof. In another embodiment, the fragment consists of about 15-20% thereof. In another embodiment, the fragment consists of about 20-25% thereof. In another embodiment, the fragment consists of about 25-30% thereof. In another embodiment, the fragment consists of about 30-35% thereof. In another embodiment, the fragment consists of about 35-40% thereof. In another embodiment, the fragment consists of about 45-50% thereof. In another embodiment, the fragment consists of about 50-55% thereof. In another embodiment, the fragment consists of about 55-60% thereof. In another embodiment, the fragment consists of about 5-15% thereof. In another embodiment, the fragment consists of about 10-20% thereof. In another embodiment, the fragment consists of about 15-25% thereof. In another embodiment, the fragment consists of about 20-30% thereof. In another embodiment, the fragment consists of about 25-35% thereof. In another embodiment, the fragment consists of about 30-40% thereof. In another embodiment, the fragment consists of about 35-45% thereof. In another embodiment, the fragment consists of about 45-55% thereof. In another embodiment, the fragment consists of about 50-60% thereof. In another embodiment, the fragment consists of about 55-65% thereof. In another embodiment, the fragment consists of about 60-70% thereof. In another embodiment, the fragment consists of about 65-75% thereof. In another embodiment, the fragment consists of about 70-80% thereof. In another embodiment, the fragment consists of about 5-20% thereof. In another embodiment, the fragment consists of about 10-25% thereof. In another embodiment, the fragment consists of about 15-30% thereof. In another embodiment, the fragment consists of about 20-35% thereof. In another embodiment, the fragment consists of about 25-40% thereof. In another embodiment, the fragment consists of about 30-45% thereof. In another embodiment, the fragment consists of about 35-50% thereof. In another embodiment, the fragment consists of about 45-60% thereof. In another embodiment, the fragment consists of about 50-65% thereof. In another embodiment, the fragment consists of about 55-70% thereof. In another embodiment, the fragment consists of about 60-75% thereof. In another embodiment, the fragment consists of about 65-80% thereof. In another embodiment, the fragment consists of about 70-85% thereof. In another embodiment, the fragment consists of about 75-90% thereof. In another embodiment, the fragment consists of about 80-95% thereof. In another embodiment, the fragment consists of about 85-100% thereof. In another embodiment, the fragment consists of about 5-25% thereof. In another embodiment, the fragment consists of about 10-30% thereof. In another embodiment, the fragment consists of about 15-35% thereof. In another embodiment, the fragment consists of about 20-40% thereof. In another embodiment, the fragment consists of about 30-50% thereof. In another embodiment, the fragment consists of about 40-60% thereof. In another embodiment, the fragment consists of about 50-70% thereof. In another embodiment, the fragment consists of about 60-80% thereof. In another embodiment, the fragment consists of about 70-90% thereof. In another embodiment, the fragment consists of about 80-100% thereof. In another embodiment, the fragment consists of about 5-35% thereof. In another embodiment, the fragment consists of about 10-40% thereof. In another embodiment, the fragment consists of about 15-45% thereof. In another embodiment, the fragment consists of about 20-50% thereof. In another embodiment, the fragment consists of about 30-60% thereof. In another embodiment, the fragment consists of about 40-70% thereof. In another embodiment, the fragment consists of about 50-80% thereof. In another embodiment, the fragment consists of about 60-90% thereof. In another embodiment, the fragment consists of about 70-100% thereof. In another embodiment, the fragment consists of about 5-45% thereof. In another embodiment, the fragment consists of about 10-50% thereof. In another embodiment, the fragment consists of about 20-60% thereof. In another embodiment, the fragment consists of about 30-70% thereof. In another embodiment, the fragment consists of about 40-80% thereof. In another embodiment, the fragment consists of about 50-90% thereof. In another embodiment, the fragment consists of about 60-100% thereof. In another embodiment, the fragment consists of about 5-55% thereof. In another embodiment, the fragment consists of about 10-60% thereof. In another embodiment, the fragment consists of about 20-70% thereof. In another embodiment, the fragment consists of about 30-80% thereof. In another embodiment, the fragment consists of about 40-90% thereof. In another embodiment, the fragment consists of about 50-100% thereof. In another embodiment, the fragment consists of about 5-65% thereof. In another embodiment, the fragment consists of about 10-70% thereof. In another embodiment, the fragment consists of about 20-80% thereof. In another embodiment, the fragment consists of about 30-90% thereof. In another embodiment, the fragment consists of about 40-100% thereof. In another embodiment, the fragment consists of about 5-75% thereof. In another embodiment, the fragment consists of about 10-80% thereof. In another embodiment, the fragment consists of about 20-90% thereof. In another embodiment, the fragment consists of about 30-100% thereof. In another embodiment, the fragment consists of about 10-90% thereof. In another embodiment, the fragment consists of about 20-100% thereof. In another embodiment, the fragment consists of about 10-100% thereof.
In another embodiment, the fragment consists of about 5% of the KLK3 protein. In another embodiment, the fragment consists of about 6% thereof. In another embodiment, the fragment consists of about 8% thereof. In another embodiment, the fragment consists of about 10% thereof. In another embodiment, the fragment consists of about 12% thereof. In another embodiment, the fragment consists of about 15% thereof. In another embodiment, the fragment consists of about 18% thereof. In another embodiment, the fragment consists of about 20% thereof. In another embodiment, the fragment consists of about 25% thereof. In another embodiment, the fragment consists of about 30% thereof. In another embodiment, the fragment consists of about 35% thereof. In another embodiment, the fragment consists of about 40% thereof. In another embodiment, the fragment consists of about 45% thereof. In another embodiment, the fragment consists of about 50% thereof. In another embodiment, the fragment consists of about 55% thereof. In another embodiment, the fragment consists of about 60% thereof. In another embodiment, the fragment consists of about 65% thereof. In another embodiment, the fragment consists of about 70% thereof. In another embodiment, the fragment consists of about 75% thereof. In another embodiment, the fragment consists of about 80% thereof. In another embodiment, the fragment consists of about 85% thereof. In another embodiment, the fragment consists of about 90% thereof. In another embodiment, the fragment consists of about 95% thereof. In another embodiment, the fragment consists of about 100% thereof. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a KLK3 peptide or FOLH1 peptide of methods and compositions of the present invention is an immunogenic peptide. “Immunogenic” refers, in another embodiment, to an ability to induce an immune response when administered to a subject. In another embodiment, the subject is a human subject. In another embodiment, the immune response elicited is a T-cell response. In another embodiment, the immune response elicited is a cytotoxic T lymphocyte (CTL) response. In another embodiment, the immune response elicited is detectable. In another embodiment, the immune response elicited is detectable by an in vitro assay. In another embodiment, the assay is a cytokine release assay (e.g. fluorescence-activated cell sorting; or FACS). In another embodiment, the assay is a chromium-release assay or other in vitro cytotoxicity assay. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the immunogenic fragment of a sequence selected from the sequences set forth in SEQ ID No: 25, 27, 29-32, 34, and 36-39, which is contained in a KLK3 peptide of methods and compositions of the present invention, is about 10-150 AA long. In another embodiment, the length is 15-150 AA. In another embodiment, the length is 20-150 AA. In another embodiment, the length is 30-150 AA. In another embodiment, the length is 40-150 AA. In another embodiment, the length is 50-150 AA. In another embodiment, the length is 60-150 AA. In another embodiment, the length is 70-150 AA. In another embodiment, the length is 80-150 AA. In another embodiment, the length is 90-150 AA. In another embodiment, the length is 100-150 AA. In another embodiment, the length is 10-100 AA. In another embodiment, the length is 15-100 AA. In another embodiment, the length is 20-100 AA. In another embodiment, the length is 30-100 AA. In another embodiment, the length is 40-100 AA. In another embodiment, the length is 50-100 AA. In another embodiment, the length is 60-100 AA. In another embodiment, the length is 70-100 AA. In another embodiment, the length is 10-80 AA. In another embodiment, the length is 15-80 AA. In another embodiment, the length is 20-80 AA. In another embodiment, the length is 30-80 AA. In another embodiment, the length is 40-80 AA. In another embodiment, the length is 50-80 AA. In another embodiment, the length is 60-80 AA. In another embodiment, the length is 70-80 AA. In another embodiment, the length is 10-60 AA. In another embodiment, the length is 15-60 AA. In another embodiment, the length is 20-60 AA. In another embodiment, the length is 30-60 AA. In another embodiment, the length is 40-60 AA. In another embodiment, the length is 50-60 AA. In another embodiment, the length is 10-50 AA. In another embodiment, the length is 15-50 AA. In another embodiment, the length is 20-50 AA. In another embodiment, the length is 30-50 AA. In another embodiment, the length is 40-50 AA. In another embodiment, the length is 10-40 AA. In another embodiment, the length is 15-40 AA. In another embodiment, the length is 20-40 AA. In another embodiment, the length is 30-40 AA. In another embodiment, the length is 10-30 AA. In another embodiment, the length is 15-30 AA. In another embodiment, the length is 20-30 AA. In another embodiment, the length is 5-20 AA. In another embodiment, the length is 10-20 AA. In another embodiment, the length is 15-20 AA.
In another embodiment, the length of the immunogenic fragment is about 10 AA. In another embodiment, the length is about 15 AA. In another embodiment, the length is about 20 AA. In another embodiment, the length is about 30 AA. In another embodiment, the length is about 40 AA. In another embodiment, the length is about 50 AA. In another embodiment, the length is about 60 AA. In another embodiment, the length is about 70 AA. In another embodiment, the length is about 80 AA. In another embodiment, the length is about 90 AA. In another embodiment, the length is about 100 AA.
Each length of the immunogenic fragment represents a separate embodiment of the present invention.
The FOLH1 peptide of methods and compositions of the present invention is, in another embodiment, 200-750 AA in length. In another embodiment, the FOLH1 peptide is about 100-750 AA long. In another embodiment, the length is 100-750 AA. In another embodiment, the length is 110-750 AA. In another embodiment, the length is 120-750 AA. In another embodiment, the length is 130-750 AA. In another embodiment, the length is 140-750 AA. In another embodiment, the length is 150-750 AA. In another embodiment, the length is 160-750 AA. In another embodiment, the length is 175-750 AA. In another embodiment, the length is 190-750 AA. In another embodiment, the length is 200-750 AA. In another embodiment, the length is 210-750 AA. In another embodiment, the length is 220-750 AA. In another embodiment, the length is 230-750 AA. In another embodiment, the length is 240-750 AA. In another embodiment, the length is 250-750 AA. In another embodiment, the length is 280-750 AA. In another embodiment, the length is 300-750 AA. In another embodiment, the length is 350-750 AA. In another embodiment, the length is 400-750 AA. In another embodiment, the length is 450-750 AA. In another embodiment, the length is 500-750 AA. In another embodiment, the length is 550-750 AA. In another embodiment, the length is 600-750 AA. In another embodiment, the length is 650-750 AA. In another embodiment, the length is 700-750 AA. In another embodiment, the length is 100-150 AA. In another embodiment, the length is 100-160 AA. In another embodiment, the length is 100-170 AA. In another embodiment, the length is 100-180 AA. In another embodiment, the length is 100-190 AA. In another embodiment, the length is 100-200 AA. In another embodiment, the length is 100-220 AA. In another embodiment, the length is 100-240 AA. In another embodiment, the length is 100-260 AA. In another embodiment, the length is 100-280 AA. In another embodiment, the length is 100-300 AA. In another embodiment, the length is 100-350 AA. In another embodiment, the length is 100-400 AA. In another embodiment, the length is 100-450 AA. In another embodiment, the length is 100-500 AA. In another embodiment, the length is 100-600 AA. In another embodiment, the length is 100-700 AA. In another embodiment, the length is 50-150 AA. In another embodiment, the length is 50-160 AA. In another embodiment, the length is 50-170 AA. In another embodiment, the length is 50-180 AA. In another embodiment, the length is 50-190 AA. In another embodiment, the length is 50-200 AA. In another embodiment, the length is 50-220 AA. In another embodiment, the length is 50-240 AA. In another embodiment, the length is 50-260 AA. In another embodiment, the length is 50-280 AA. In another embodiment, the length is 50-300 AA. In another embodiment, the length is 50-350 AA. In another embodiment, the length is 50-400 AA. In another embodiment, the length is 50-450 AA. In another embodiment, the length is 50-500 AA.
In another embodiment, the length is about 175 AA. In another embodiment, the length is about 200 AA. In another embodiment, the length is about 220 AA. In another embodiment, the length is about 240 AA. In another embodiment, the length is about 260 AA.
Each length represents a separate embodiment of the present invention.
In another embodiment, the FOLH1 peptide consists of about one-third to one-half of the FOLH1 protein. In another embodiment, the fragment consists of about one-tenth to one-fifth thereof. In another embodiment, the fragment consists of about one-fifth to one-fourth thereof. In another embodiment, the fragment consists of about one-fourth to one-third thereof. In another embodiment, the fragment consists of about one-third to one-half thereof. In another embodiment, the fragment consists of about one-half to three quarters thereof. In another embodiment, the fragment consists of about three quarters to the FOLH1 protein. In another embodiment, the fragment consists of about 5-10% thereof. In another embodiment, the fragment consists of about 10-15% thereof. In another embodiment, the fragment consists of about 15-20% thereof. In another embodiment, the fragment consists of about 20-25% thereof. In another embodiment, the fragment consists of about 25-30% thereof. In another embodiment, the fragment consists of about 30-35% thereof. In another embodiment, the fragment consists of about 35-40% thereof. In another embodiment, the fragment consists of about 45-50% thereof. In another embodiment, the fragment consists of about 50-55% thereof. In another embodiment, the fragment consists of about 55-60% thereof. In another embodiment, the fragment consists of about 5-15% thereof. In another embodiment, the fragment consists of about 10-20% thereof. In another embodiment, the fragment consists of about 15-25% thereof. In another embodiment, the fragment consists of about 20-30% thereof. In another embodiment, the fragment consists of about 25-35% thereof. In another embodiment, the fragment consists of about 30-40% thereof. In another embodiment, the fragment consists of about 35-45% thereof. In another embodiment, the fragment consists of about 45-55% thereof. In another embodiment, the fragment consists of about 50-60% thereof. In another embodiment, the fragment consists of about 55-65% thereof. In another embodiment, the fragment consists of about 60-70% thereof. In another embodiment, the fragment consists of about 65-75% thereof. In another embodiment, the fragment consists of about 70-80% thereof. In another embodiment, the fragment consists of about 5-20% thereof. In another embodiment, the fragment consists of about 10-25% thereof. In another embodiment, the fragment consists of about 15-30% thereof. In another embodiment, the fragment consists of about 20-35% thereof. In another embodiment, the fragment consists of about 25-40% thereof. In another embodiment, the fragment consists of about 30-45% thereof. In another embodiment, the fragment consists of about 35-50% thereof. In another embodiment, the fragment consists of about 45-60% thereof. In another embodiment, the fragment consists of about 50-65% thereof. In another embodiment, the fragment consists of about 55-70% thereof. In another embodiment, the fragment consists of about 60-75% thereof. In another embodiment, the fragment consists of about 65-80% thereof. In another embodiment, the fragment consists of about 70-85% thereof. In another embodiment, the fragment consists of about 75-90% thereof. In another embodiment, the fragment consists of about 80-95% thereof. In another embodiment, the fragment consists of about 85-100% thereof. In another embodiment, the fragment consists of about 5-25% thereof. In another embodiment, the fragment consists of about 10-30% thereof. In another embodiment, the fragment consists of about 15-35% thereof. In another embodiment, the fragment consists of about 20-40% thereof. In another embodiment, the fragment consists of about 30-50% thereof. In another embodiment, the fragment consists of about 40-60% thereof. In another embodiment, the fragment consists of about 50-70% thereof. In another embodiment, the fragment consists of about 60-80% thereof. In another embodiment, the fragment consists of about 70-90% thereof. In another embodiment, the fragment consists of about 80-100% thereof. In another embodiment, the fragment consists of about 5-35% thereof. In another embodiment, the fragment consists of about 10-40% thereof. In another embodiment, the fragment consists of about 15-45% thereof. In another embodiment, the fragment consists of about 20-50% thereof. In another embodiment, the fragment consists of about 30-60% thereof. In another embodiment, the fragment consists of about 40-70% thereof. In another embodiment, the fragment consists of about 50-80% thereof. In another embodiment, the fragment consists of about 60-90% thereof. In another embodiment, the fragment consists of about 70-100% thereof. In another embodiment, the fragment consists of about 5-45% thereof. In another embodiment, the fragment consists of about 10-50% thereof. In another embodiment, the fragment consists of about 20-60% thereof. In another embodiment, the fragment consists of about 30-70% thereof. In another embodiment, the fragment consists of about 40-80% thereof. In another embodiment, the fragment consists of about 50-90% thereof. In another embodiment, the fragment consists of about 60-100% thereof. In another embodiment, the fragment consists of about 5-55% thereof. In another embodiment, the fragment consists of about 10-60% thereof. In another embodiment, the fragment consists of about 20-70% thereof. In another embodiment, the fragment consists of about 30-80% thereof. In another embodiment, the fragment consists of about 40-90% thereof. In another embodiment, the fragment consists of about 50-100% thereof. In another embodiment, the fragment consists of about 5-65% thereof. In another embodiment, the fragment consists of about 10-70% thereof. In another embodiment, the fragment consists of about 20-80% thereof. In another embodiment, the fragment consists of about 30-90% thereof. In another embodiment, the fragment consists of about 40-100% thereof. In another embodiment, the fragment consists of about 5-75% thereof. In another embodiment, the fragment consists of about 10-80% thereof. In another embodiment, the fragment consists of about 20-90% thereof. In another embodiment, the fragment consists of about 30-100% thereof. In another embodiment, the fragment consists of about 10-90% thereof. In another embodiment, the fragment consists of about 20-100% thereof. In another embodiment, the fragment consists of about 10-100% thereof.
In another embodiment, the fragment consists of about 5% of the FOLH1 protein. In another embodiment, the fragment consists of about 6% thereof. In another embodiment, the fragment consists of about 8% thereof. In another embodiment, the fragment consists of about 10% thereof. In another embodiment, the fragment consists of about 12% thereof. In another embodiment, the fragment consists of about 15% thereof. In another embodiment, the fragment consists of about 18% thereof. In another embodiment, the fragment consists of about 20% thereof. In another embodiment, the fragment consists of about 25% thereof. In another embodiment, the fragment consists of about 30% thereof. In another embodiment, the fragment consists of about 35% thereof. In another embodiment, the fragment consists of about 40% thereof. In another embodiment, the fragment consists of about 45% thereof. In another embodiment, the fragment consists of about 50% thereof. In another embodiment, the fragment consists of about 55% thereof. In another embodiment, the fragment consists of about 60% thereof. In another embodiment, the fragment consists of about 65% thereof. In another embodiment, the fragment consists of about 70% thereof. In another embodiment, the fragment consists of about 75% thereof. In another embodiment, the fragment consists of about 80% thereof. In another embodiment, the fragment consists of about 85% thereof. In another embodiment, the fragment consists of about 90% thereof. In another embodiment, the fragment consists of about 95% thereof. In another embodiment, the fragment consists of about 100% thereof. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the immunogenic fragment of a sequence selected from the sequences set forth in SEQ ID No: 41, 43, 44, and 45, which is contained in an FOLH1 peptide of methods and compositions of the present invention, is about 10-150 AA long. In another embodiment, the length is 15-150 AA. In another embodiment, the length is 20-150 AA. In another embodiment, the length is 30-150 AA. In another embodiment, the length is 40-150 AA. In another embodiment, the length is 50-150 AA. In another embodiment, the length is 60-150 AA. In another embodiment, the length is 70-150 AA. In another embodiment, the length is 80-150 AA. In another embodiment, the length is 90-150 AA. In another embodiment, the length is about 10-200 AA long. In another embodiment, the length is 15-200 AA. In another embodiment, the length is 20-200 AA. In another embodiment, the length is 30-200 AA. In another embodiment, the length is 40-200 AA. In another embodiment, the length is 50-200 AA. In another embodiment, the length is 60-200 AA. In another embodiment, the length is 70-200 AA. In another embodiment, the length is 80-200 AA. In another embodiment, the length is 90-200 AA. In another embodiment, the length is 100-200 AA. In another embodiment, the length is 50-300 AA. In another embodiment, the length is 60-300 AA. In another embodiment, the length is 70-300 AA. In another embodiment, the length is 80-300 AA. In another embodiment, the length is 90-300 AA. In another embodiment, the length is 100-300 AA. In another embodiment, the length is 90-300 AA. In another embodiment, the length is 200-300 AA. In another embodiment, the length is 50-400 AA. In another embodiment, the length is 60-400 AA. In another embodiment, the length is 70-400 AA. In another embodiment, the length is 80-400 AA. In another embodiment, the length is 90-400 AA. In another embodiment, the length is 100-400 AA. In another embodiment, the length is 200-400 AA. In another embodiment, the length is 300-400 AA. In another embodiment, the length is 100-150 AA. In another embodiment, the length is 10-100 AA. In another embodiment, the length is 15-100 AA. In another embodiment, the length is 20-100 AA. In another embodiment, the length is 30-100 AA. In another embodiment, the length is 40-100 AA. In another embodiment, the length is 50-100 AA. In another embodiment, the length is 60-100 AA. In another embodiment, the length is 70-100 AA. In another embodiment, the length is 10-80 AA. In another embodiment, the length is 15-80 AA. In another embodiment, the length is 20-80 AA. In another embodiment, the length is 30-80 AA. In another embodiment, the length is 40-80 AA. In another embodiment, the length is 50-80 AA. In another embodiment, the length is 60-80 AA. In another embodiment, the length is 70-80 AA. In another embodiment, the length is 10-60 AA. In another embodiment, the length is 15-60 AA. In another embodiment, the length is 20-60 AA. In another embodiment, the length is 30-60 AA. In another embodiment, the length is 40-60 AA. In another embodiment, the length is 50-60 AA. In another embodiment, the length is 10-50 AA. In another embodiment, the length is 15-50 AA. In another embodiment, the length is 20-50 AA. In another embodiment, the length is 30-50 AA. In another embodiment, the length is 40-50 AA. In another embodiment, the length is 10-40 AA. In another embodiment, the length is 15-40 AA. In another embodiment, the length is 20-40 AA. In another embodiment, the length is 30-40 AA. In another embodiment, the length is 10-30 AA. In another embodiment, the length is 15-30 AA. In another embodiment, the length is 20-30 AA. In another embodiment, the length is 5-20 AA. In another embodiment, the length is 10-20 AA. In another embodiment, the length is 15-20 AA.
In another embodiment, the length of the immunogenic fragment is about 10 AA. In another embodiment, the length is about 15 AA. In another embodiment, the length is about 20 AA. In another embodiment, the length is about 30 AA. In another embodiment, the length is about 40 AA. In another embodiment, the length is about 50 AA. In another embodiment, the length is about 60 AA. In another embodiment, the length is about 70 AA. In another embodiment, the length is about 80 AA. In another embodiment, the length is about 90 AA. In another embodiment, the length is about 100 AA.
Each length of the immunogenic fragment represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of reducing a size of a KLK3-expressing tumor, comprising administering a vaccine, immunogenic composition, or vector comprising a recombinant Listeria strain of the present invention, thereby reducing a size of a KLK3-expressing tumor. In another embodiment, a cell of the tumor expresses KLK3. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of suppressing a formation of a KLK3-expressing tumor, comprising administering an effective amount of a vaccine comprising either: (a) a recombinant Listeria strain comprising an N-terminal fragment of a protein fused to a KLK3 peptide; or (b) a recombinant nucleotide encoding the recombinant polypeptide, whereby the subject mounts an immune response against the KLK3-expressing tumor, thereby suppressing a formation of a KLK3-expressing tumor.
In another embodiment, the present invention provides a method of reducing a size of a KLK3-expressing tumor, comprising administering a vaccine, immunogenic composition, or vector comprising a recombinant polypeptide of the present invention, thereby reducing a size of a KLK3-expressing tumor. In another embodiment, a cell of the tumor expresses KLK3. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of suppressing a formation of a KLK3-expressing tumor, comprising administering an effective amount of a vaccine comprising either: (a) a recombinant polypeptide comprising an N-terminal fragment of a protein fused to a KLK3 peptide; or (b) a recombinant nucleotide encoding the recombinant polypeptide, whereby the subject mounts an immune response against the KLK3-expressing tumor, thereby suppressing a formation of a KLK3-expressing tumor.
In another embodiment, the present invention provides a method of reducing a size of a KLK3-expressing tumor, comprising administering a vaccine, immunogenic composition, or vector comprising a recombinant nucleotide molecule of the present invention, thereby reducing a size of a KLK3-expressing tumor. In another embodiment, a cell of the tumor expresses KLK3. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a method of suppressing a formation of a KLK3-expressing tumor, comprising administering an effective amount of a vaccine comprising either: (a) a recombinant nucleotide molecule comprising an N-terminal fragment of a protein fused to a KLK3 peptide; or (b) a recombinant nucleotide encoding the recombinant polypeptide, whereby the subject mounts an immune response against the KLK3-expressing tumor, thereby suppressing a formation of a KLK3-expressing tumor.
The non-KLK3/non-FOLH1 peptide of methods and compositions of the present invention is, in another embodiment, a listeriolysin (LLO) peptide. In another embodiment, the non-KLK3/non-FOLH1 peptide is an ActA peptide. In another embodiment, the non-KLK3/non-FOLH1 peptide is a PEST-like sequence peptide. In another embodiment, the non-KLK3/non-FOLH1 peptide is any other peptide capable of enhancing the immunogenicity of a KLK3 or FOLH1 peptide. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a recombinant fusion peptide of methods and compositions of the present invention is an LLO-KLK3 fusion peptide. In another embodiment, the fusion peptide has the sequence set forth in SEQ ID No: 54. In another embodiment, the fusion peptide is homologous to the sequence set forth in SEQ ID No: 54. In another embodiment, the fusion peptide is a variant of the sequence set forth in SEQ ID No: 54. In another embodiment, “homology” refers to identity to one of SEQ ID No: 54 of greater than 72%. In another embodiment, the homology is greater than 75%. In another embodiment, “homology” refers to identity to a sequence of greater than 78%. In another embodiment, the homology is greater than 80%. In another embodiment, the homology is greater than 82%. In another embodiment, “homology” refers to identity to a sequence of greater than 83%. In another embodiment, the homology is greater than 85%. In another embodiment, the homology is greater than 87%. In another embodiment, “homology” refers to identity to a sequence of greater than 88%. In another embodiment, the homology is greater than 90%. In another embodiment, the homology is greater than 92%. In another embodiment, “homology” refers to identity to a sequence of greater than 93%. In another embodiment, the homology is greater than 95%. In another embodiment, “homology” refers to identity to a sequence of greater than 96%. In another embodiment, the homology is greater than 97%. In another embodiment, the homology is greater than 98%. In another embodiment, the homology is greater than 99%. Each possibility represents a separate embodiment of the present invention.
The sequence of the LLO protein utilized to construct vaccines of the present invention is, in another embodiment:
nucleic acid sequence is set forth in GenBank Accession No. X15127). The first 25 amino acids of the proprotein corresponding to this sequence are the signal sequence and are cleaved from LLO when it is secreted by the bacterium. Thus, in this embodiment, the full length active LLO protein is 504 residues long. In another embodiment, the LLO protein is a homologue of SEQ ID No: 17. In another embodiment, the LLO protein is a variant of SEQ ID No: 17. In another embodiment, the LLO protein is an isomer of SEQ ID No: 17. In another embodiment, the LLO protein is a fragment of SEQ ID No: 17. Each possibility represents a separate embodiment of the present invention.
In another embodiment, “LLO peptide” and “LLO fragment” refer to an N-terminal fragment of an LLO protein. In another embodiment, the terms refer to a full-length but non-hemolytic LLO protein. In another embodiment, the terms refer to a non-hemolytic protein containing a point mutation in cysteine 484 of sequence ID No: 17 or a corresponding residue thereof in a homologous LLO protein. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the N-terminal fragment of an LLO protein utilized in compositions and methods of the present invention has the sequence:
In another embodiment, the LLO fragment is a homologue of SEQ ID No: 18. In another embodiment, the LLO fragment is a variant of SEQ ID No: 18. In another embodiment, the LLO fragment is an isomer of SEQ ID No: 18. In another embodiment, the LLO fragment is a fragment of SEQ ID No: 18. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the LLO fragment has the sequence:
In another embodiment, the LLO fragment is a homologue of SEQ ID No: 19. In another embodiment, the LLO fragment is a variant of SEQ ID No: 19. In another embodiment, the LLO fragment is an isomer of SEQ ID No: 19. In another embodiment, the LLO fragment is a fragment of SEQ ID No: 19. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the LLO fragment is any other LLO fragment known in the art. Each possibility represents a separate embodiment of the present invention.
“ActA peptide” refers, in another embodiment, to a full-length ActA protein. In another embodiment, the term refers to an ActA fragment. Each possibility represents a separate embodiment of the present invention.
The ActA fragment of methods and compositions of the present invention is, in another embodiment, an N-terminal ActA fragment. In another embodiment, the fragment is any other type of ActA fragment known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the N-terminal fragment of an ActA protein has the sequence:
In another embodiment, the ActA fragment comprises SEQ ID No: 15. In another embodiment, the ActA fragment is a homologue of SEQ ID No: 15. In another embodiment, the ActA fragment is a variant of SEQ ID No: 15. In another embodiment, the ActA fragment is an isomer of SEQ ID No: 15. In another embodiment, the ActA fragment is a fragment of SEQ ID No: 15. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the N-terminal fragment of an ActA protein has the sequence:
In another embodiment, the ActA fragment is a homologue of SEQ ID No: 14. In another embodiment, the ActA fragment is a variant of SEQ ID No: 14. In another embodiment, the ActA fragment is an isomer of SEQ ID No: 14. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the ActA fragment of methods and compositions of the present invention comprises a PEST-like sequence. In another embodiment, the PEST-like sequence contained in the ActA fragment is selected from SEQ ID No: 2-5. In another embodiment, the ActA fragment comprises at least 2 of the PEST-like sequences set forth in SEQ ID No: 2-5. In another embodiment, the ActA fragment comprises at least 3 of the PEST-like sequences set forth in SEQ ID No: 2-5. In another embodiment, the ActA fragment comprises the 4 PEST-like sequences set forth in SEQ ID No: 2-5. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the N-terminal ActA fragment is encoded by a nucleotide molecule having the sequence SEQ ID NO: 16:
In another embodiment, the ActA fragment is encoded by a nucleotide molecule that comprises SEQ ID No: 16. In another embodiment, the ActA fragment is encoded by a nucleotide molecule that is a homologue of SEQ ID No: 16. In another embodiment, the ActA fragment is encoded by a nucleotide molecule that is a variant of SEQ ID No: 16. In another embodiment, the ActA fragment is encoded by a nucleotide molecule that is an isomer of SEQ ID No: 16. In another embodiment, the ActA fragment is encoded by a nucleotide molecule that is a fragment of SEQ ID No: 16. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a recombinant nucleotide of the present invention comprises any other sequence that encodes a fragment of an ActA protein. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the ActA fragment is any other ActA fragment known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment of methods and compositions of the present invention, a PEST-like AA sequence is fused to the KLK3 peptide or FOLH1 peptide. In another embodiment, the PEST-like AA sequence has a sequence selected from SEQ ID NO: 2-7 and 20. In another embodiment, the PEST-like sequence is any other PEST-like sequence known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the PEST-like AA sequence is KENSISSMAPPASPPASPKTPIEKKHADEIDK (SEQ ID NO: 1). In another embodiment, the PEST-like sequence is KENSISSMAPPASPPASPK (SEQ ID No: 21). In another embodiment, fusion of a KLK3 peptide or FOLH1 peptide to any LLO sequence that includes the 1 of the PEST-like AA sequences enumerated herein is efficacious for enhancing cell-mediated immunity against KLK3 or FOLH1.
The present invention also provides methods for enhancing cell mediated and anti-tumor immunity and compositions with enhanced immunogenicity which comprise a PEST-like amino acid sequence derived from a prokaryotic organism fused to a KLK3 or FOLH1 antigen. In another embodiment, the PEST-like sequence is embedded within an antigen. In another embodiment, the PEST-like sequence is fused to either the amino terminus of the antigen. In another embodiment, the PEST-like sequence is fused to the carboxy terminus. As demonstrated herein, fusion of an antigen to the PEST-like sequence of LM enhanced cell mediated and anti-tumor immunity of the antigen. Thus, fusion of an antigen to other PEST-like sequences derived from other prokaryotic organisms will also enhance immunogenicity of KLK3 or FOLH1. PEST-like sequence of other prokaryotic organism can be identified routinely in accordance with methods such as described by, for example Rechsteiner and Rogers (1996, Trends Biochem. Sci. 21:267-271) for LM. In another embodiment, PEST-like AA sequences from other prokaryotic organisms are identified based by this method. In another embodiment, the PEST-like AA sequence is from another Listeria species. For example, the LM protein ActA contains 4 such sequences.
In another embodiment, the PEST-like AA sequence is a PEST-like sequence from a Listeria ActA protein. In another embodiment, the PEST-like sequence is KTEEQPSEVNTGPR (SEQ ID NO: 2), KASVTDTSEGDLDSSMQSADESTPQPLK (SEQ ID NO: 3), KNEEVNASDFPPPPTDEELR (SEQ ID NO: 4), or RGGIPTSEEFSSLNSGDFTDDENSETTEEEIDR (SEQ ID NO: 5). In another embodiment, the PEST-like sequence is from Listeria seeligeri cytolysin, encoded by the lso gene. In another embodiment, the PEST-like sequence is RSEVTISPAETPESPPATP (SEQ ID NO: 20). In another embodiment, the PEST-like sequence is from Streptolysin 0 protein of Streptococcus sp. In another embodiment, the PEST-like sequence is from Streptococcus pyogenes Streptolysin 0, e.g. KQNTASTETTTTNEQPK (SEQ ID NO: 6) at AA 35-51. In another embodiment, the PEST-like sequence is from Streptococcus equisimilis Streptolysin 0, e.g. KQNTANTETTTTNEQPK (SEQ ID NO: 7) at AA 38-54. In another embodiment, the PEST-like sequence has a sequence selected from SEQ ID NO: 1-7 and 20-21. In another embodiment, the PEST-like sequence has a sequence selected from SEQ ID NO: 2-7 and 20. In another embodiment, the PEST-like sequence is another PEST-like AA sequence derived from a prokaryotic organism.
PEST-like sequences of other prokaryotic organism are identified, in another embodiment, in accordance with methods such as described by, for example Rechsteiner and Rogers (1996, Trends Biochem. Sci. 21:267-271) for LM. Alternatively, PEST-like AA sequences from other prokaryotic organisms can also be identified based by this method. Other prokaryotic organisms wherein PEST-like AA sequences would be expected to include, but are not limited to, other Listeria species. In another embodiment, the PEST-like sequence is embedded within the antigenic protein. Thus, in another embodiment, “fusion” refers to an antigenic protein comprising a KLK3 peptide and a PEST-like amino acid sequence linked at one end of the KLK3 peptide. In another embodiment, the term refers to an antigenic protein comprising an FOLH1 peptide and a PEST-like amino acid sequence linked at one end of the FOLH1 peptide. In another embodiment, the term refers to an antigenic protein comprising PEST-like amino acid sequence embedded within the KLK3 peptide. In another embodiment, the term refers to an antigenic protein comprising PEST-like amino acid sequence embedded within the FOLH1 peptide. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the PEST-like sequence is identified using the PEST-find program. In another embodiment, a PEST-like sequence is defined as a hydrophilic stretch of at least 12 AA in length with a high local concentration of proline (P), aspartate (D), glutamate (E), serine (S), and/or threonine(T) residues. In another embodiment, a PEST-like sequence contains no positively charged AA, namely arginine (R), histidine (H) and lysine (K).
In another embodiment, identification of PEST motifs is achieved by an initial scan for positively charged AA R, H, and K within the specified protein sequence. All AA between the positively charged flanks are counted and only those motifs are considered further, which contain a number of AA equal to or higher than the window-size parameter. In another embodiment, a PEST-like sequence must contain at least 1 P, 1 D or E, and at least 1 S or T.
In another embodiment, the quality of a PEST motif is refined by means of a scoring parameter based on the local enrichment of critical AA as well as the motifs hydrophobicity. Enrichment of D, E, P, S and T is expressed in mass percent (w/w) and corrected for 1 equivalent of D or E, 1 of P and 1 of S or T. In another embodiment, calculation of hydrophobicity follows in principle the method of J. Kyte and R. F. Doolittle (Kyte, J and Dootlittle, R F. J. Mol. Biol. 157, 105 (1982). For simplified calculations, Kyte-Doolittle hydropathy indices, which originally ranged from −4.5 for arginine to +4.5 for isoleucine, are converted to positive integers, using the following linear transformation, which yielded values from 0 for arginine to 90 for isoleucine.
Hydropathy index=10*Kyte-Doolittle hydropathy index+45
In another embodiment, a potential PEST motif's hydrophobicity is calculated as the sum over the products of mole percent and hydrophobicity index for each AA species. The desired PEST score is obtained as combination of local enrichment term and hydrophobicity term as expressed by the following equation:
PEST score=0.55*DEPST−0.5*hydrophobicity index.
In another embodiment, “PEST-like sequence,” “PEST-like sequence peptide,” or “PEST-like sequence-containing peptide” refers to a peptide having a score of at least +5, using the above algorithm. In another embodiment, the term refers to a peptide having a score of at least 6. In another embodiment, the peptide has a score of at least 7. In another embodiment, the score is at least 8. In another embodiment, the score is at least 9. In another embodiment, the score is at least 10. In another embodiment, the score is at least 11. In another embodiment, the score is at least 12. In another embodiment, the score is at least 13. In another embodiment, the score is at least 14. In another embodiment, the score is at least 15. In another embodiment, the score is at least 16. In another embodiment, the score is at least 17. In another embodiment, the score is at least 18. In another embodiment, the score is at least 19. In another embodiment, the score is at least 20. In another embodiment, the score is at least 21. In another embodiment, the score is at least 22. In another embodiment, the score is at least 22. In another embodiment, the score is at least 24. In another embodiment, the score is at least 24. In another embodiment, the score is at least 25. In another embodiment, the score is at least 26. In another embodiment, the score is at least 27. In another embodiment, the score is at least 28. In another embodiment, the score is at least 29. In another embodiment, the score is at least 30. In another embodiment, the score is at least 32. In another embodiment, the score is at least 35. In another embodiment, the score is at least 38. In another embodiment, the score is at least 40. In another embodiment, the score is at least 45. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the PEST-like sequence is identified using any other method or algorithm known in the art, e.g the CaSPredictor (Garay-Malpartida H M, Occhiucci J M, Alves J, Belizario J E. Bioinformatics. 2005 June; 21 Suppl 1:i169-76). In another embodiment, the following method is used:
A PEST index is calculated for each stretch of appropriate length (e.g. a 30-35 AA stretch) by assigning a value of 1 to the AA Ser, Thr, Pro, Glu, Asp, Asn, or Gln. The coefficient value (CV) for each of the PEST residue is 1 and for each of the other AA (non-PEST) is 0.
Each method for identifying a PEST-like sequence represents a separate embodiment of the present invention.
In another embodiment, “PEST-like sequence peptide” or “PEST-like sequence-containing peptide” refers to a peptide containing a PEST-like sequence, as defined hereinabove.
“Fusion to a PEST-like sequence” refers, in another embodiment, to fusion to a protein fragment comprising a PEST-like sequence. In another embodiment, the term includes cases wherein the protein fragment comprises surrounding sequence other than the PEST-like sequence. In another embodiment, the protein fragment consists of the PEST-like sequence. Each possibility represents a separate embodiment of the present invention.
As provided herein, recombinant Listeria strains expressing PEST-like sequence-antigen fusions induce anti-tumor immunity (Example 5) and generate antigen-specific, tumor-infiltrating T cells (Example 6).
In another embodiment, “homology” refers to identity greater than 70% to a KLK3 sequence set forth in a sequence selected from SEQ ID No: 25-40. In another embodiment, “homology” refers to identity to one of SEQ ID No: 25-40 of greater than 72%. In another embodiment, the homology is greater than 75%. In another embodiment, “homology” refers to identity to a sequence of greater than 78%. In another embodiment, the homology is greater than 80%. In another embodiment, the homology is greater than 82%. In another embodiment, “homology” refers to identity to a sequence of greater than 83%. In another embodiment, the homology is greater than 85%. In another embodiment, the homology is greater than 87%. In another embodiment, “homology” refers to identity to a sequence of greater than 88%. In another embodiment, the homology is greater than 90%. In another embodiment, the homology is greater than 92%. In another embodiment, “homology” refers to identity to a sequence of greater than 93%. In another embodiment, the homology is greater than 95%. In another embodiment, “homology” refers to identity to a sequence of greater than 96%. In another embodiment, the homology is greater than 97%. In another embodiment, the homology is greater than 98%. In another embodiment, the homology is greater than 99%. Each possibility represents a separate embodiment of the present invention.
In another embodiment, “homology” refers to identity greater than 70% to an FOLH1 sequence set forth in a sequence selected from SEQ ID No: 41-45. In another embodiment, “homology” refers to identity to one of SEQ ID No: 41-45 of greater than 72%. In another embodiment, the homology is greater than 75%. In another embodiment, “homology” refers to identity to a sequence of greater than 78%. In another embodiment, the homology is greater than 80%. In another embodiment, the homology is greater than 82%. In another embodiment, “homology” refers to identity to a sequence of greater than 83%. In another embodiment, the homology is greater than 85%. In another embodiment, the homology is greater than 87%. In another embodiment, “homology” refers to identity to a sequence of greater than 88%. In another embodiment, the homology is greater than 90%. In another embodiment, the homology is greater than 92%. In another embodiment, “homology” refers to identity to a sequence of greater than 93%. In another embodiment, the homology is greater than 95%. In another embodiment, “homology” refers to identity to a sequence of greater than 96%. In another embodiment, the homology is greater than 97%. In another embodiment, the homology is greater than 98%. In another embodiment, the homology is greater than 99%. Each possibility represents a separate embodiment of the present invention.
In another embodiment, “homology” refers to identity greater than 70% to an LLO sequence set forth in a sequence selected from SEQ ID No: 17-19. In another embodiment, “homology” refers to identity to one of SEQ ID No: 17-19 of greater than 72%. In another embodiment, the homology is greater than 75%. In another embodiment, “homology” refers to identity to a sequence of greater than 78%. In another embodiment, the homology is greater than 80%. In another embodiment, the homology is greater than 82%. In another embodiment, “homology” refers to identity to a sequence of greater than 83%. In another embodiment, the homology is greater than 85%. In another embodiment, the homology is greater than 87%. In another embodiment, “homology” refers to identity to a sequence of greater than 88%. In another embodiment, the homology is greater than 90%. In another embodiment, the homology is greater than 92%. In another embodiment, “homology” refers to identity to a sequence of greater than 93%. In another embodiment, the homology is greater than 95%. In another embodiment, “homology” refers to identity to a sequence of greater than 96%. In another embodiment, the homology is greater than 97%. In another embodiment, the homology is greater than 98%. In another embodiment, the homology is greater than 99%. Each possibility represents a separate embodiment of the present invention.
In another embodiment, “homology” refers to identity greater than 70% to an ActA sequence set forth in a sequence selected from SEQ ID No: 14-16. In another embodiment, “homology” refers to identity to one of SEQ ID No: 14-16 of greater than 72%. In another embodiment, the homology is greater than 75%. In another embodiment, “homology” refers to identity to a sequence of greater than 78%. In another embodiment, the homology is greater than 80%. In another embodiment, the homology is greater than 82%. In another embodiment, “homology” refers to identity to a sequence of greater than 83%. In another embodiment, the homology is greater than 85%. In another embodiment, the homology is greater than 87%. In another embodiment, “homology” refers to identity to a sequence of greater than 88%. In another embodiment, the homology is greater than 90%. In another embodiment, the homology is greater than 92%. In another embodiment, “homology” refers to identity to a sequence of greater than 93%. In another embodiment, the homology is greater than 95%. In another embodiment, “homology” refers to identity to a sequence of greater than 96%. In another embodiment, the homology is greater than 97%. In another embodiment, the homology is greater than 98%. In another embodiment, the homology is greater than 99%. Each possibility represents a separate embodiment of the present invention.
In another embodiment, “homology” refers to identity greater than 70% to a PEST-like sequence set forth in a sequence selected from SEQ ID No: 1-7 and 20-21. In another embodiment, “homology” refers to identity to one of SEQ ID No: 1-7 and 20-21 of greater than 72%. In another embodiment, the homology is greater than 75%. In another embodiment, “homology” refers to identity to a sequence of greater than 78%. In another embodiment, the homology is greater than 80%. In another embodiment, the homology is greater than 82%. In another embodiment, “homology” refers to identity to a sequence of greater than 83%. In another embodiment, the homology is greater than 85%. In another embodiment, the homology is greater than 87%. In another embodiment, “homology” refers to identity to a sequence of greater than 88%. In another embodiment, the homology is greater than 90%. In another embodiment, the homology is greater than 92%. In another embodiment, “homology” refers to identity to a sequence of greater than 93%. In another embodiment, the homology is greater than 95%. In another embodiment, “homology” refers to identity to a sequence of greater than 96%. In another embodiment, the homology is greater than 97%. In another embodiment, the homology is greater than 98%. In another embodiment, the homology is greater than 99%. Each possibility represents a separate embodiment of the present invention.
Methods of identifying corresponding sequences in related proteins are well known in the art, and include, for example, AA sequence alignment. Each method represents a separate embodiment of the present invention.
In another embodiment of the present invention, “nucleic acids” or “nucleotide” refers to a string of at least two base-sugar-phosphate combinations. The term includes, in one embodiment, DNA and RNA. “Nucleotides” refers, in one embodiment, to the monomeric units of nucleic acid polymers. RNA may be, in one embodiment, in the form of a tRNA (transfer RNA), snRNA (small nuclear RNA), rRNA (ribosomal RNA), mRNA (messenger RNA), anti-sense RNA, small inhibitory RNA (siRNA), micro RNA (miRNA) and ribozymes. The use of siRNA and miRNA has been described (Caudy A A et al, Genes & Devel 16: 2491-96 and references cited therein). DNA may be in form of plasmid DNA, viral DNA, linear DNA, or chromosomal DNA or derivatives of these groups. In addition, these forms of DNA and RNA may be single, double, triple, or quadruple stranded. The term also includes, in another embodiment, artificial nucleic acids that may contain other types of backbones but the same bases. In one embodiment, the artificial nucleic acid is a PNA (peptide nucleic acid). PNA contain peptide backbones and nucleotide bases and are able to bind, in one embodiment, to both DNA and RNA molecules. In another embodiment, the nucleotide is oxetane modified. In another embodiment, the nucleotide is modified by replacement of one or more phosphodiester bonds with a phosphorothioate bond. In another embodiment, the artificial nucleic acid contains any other variant of the phosphate backbone of native nucleic acids known in the art. The use of phosphothiorate nucleic acids and PNA are known to those skilled in the art, and are described in, for example, Neilsen P E, Curr Opin Struct Biol 9:353-57; and Raz N K et al Biochem Biophys Res Commun. 297:1075-84. The production and use of nucleic acids is known to those skilled in art and is described, for example, in Molecular Cloning, (2001), Sambrook and Russell, eds. and Methods in Enzymology: Methods for molecular cloning in eukaryotic cells (2003) Purchio and G. C. Fareed. Each nucleic acid derivative represents a separate embodiment of the present invention.
Protein and/or peptide homology for any amino acid sequence listed herein is determined, in one embodiment, by methods well described in the art, including immunoblot analysis, or via computer algorithm analysis of amino acid sequences, utilizing any of a number of software packages available, via established methods. Some of these packages may include the FASTA, BLAST, MPsrch or Scanps packages, and may employ the use of the Smith and Waterman algorithms, and/or global/local or BLOCKS alignments for analysis, for example. Each method of determining homology represents a separate embodiment of the present invention.
In another embodiment, the present invention provides a kit comprising a reagent utilized in performing a method of the present invention. In another embodiment, the present invention provides a kit comprising a composition, tool, or instrument of the present invention.
In another embodiment, the ActA or LLO fragment is attached to the KLK3 or FOLH1 peptide by chemical conjugation. In another embodiment, paraformaldehyde is used for the conjugation. In another embodiment, the conjugation is performed using any suitable method known in the art. Each possibility represents another embodiment of the present invention.
In another embodiment, the KLK3 expressing tumor targeted by methods and compositions of the present invention is a KLK3-expressing prostate cancer. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing prostate carcinoma. In another embodiment, the KLK3-expressing tumor is a KLK3-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the FOLH1-expressing tumor targeted by methods and compositions of the present invention is an FOLH1-expressing prostate cancer. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing prostate carcinoma. In another embodiment, the FOLH1-expressing tumor is an FOLH1-expressing adenocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the KLK3- or FOLH1-expressing tumor is a breast cancer. In another embodiment, the cancer is a melanoma. In another embodiment, the cancer is a glioma tumor. In another embodiment, the cancer is an ovarian neoplasm. In another embodiment, the cancer is a mammary carcinoma. In another embodiment, the cancer is an ependymoma.
In another embodiment, the cancer is a melanoma. In another embodiment, the cancer is a sarcoma. In another embodiment, the cancer is a carcinoma. In another embodiment, the cancer is a lymphoma. In another embodiment, the cancer is a leukemia. In another embodiment, the cancer is mesothelioma. In another embodiment, the cancer is a glioma. In another embodiment, the cancer is a germ cell tumor. In another embodiment, the cancer is a choriocarcinoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the cancer is pancreatic cancer. In another embodiment, the cancer is ovarian cancer. In another embodiment, the cancer is gastric cancer. In another embodiment, the cancer is a carcinomatous lesion of the pancreas. In another embodiment, the cancer is pulmonary adenocarcinoma. In another embodiment, the cancer is colorectal adenocarcinoma. In another embodiment, the cancer is pulmonary squamous adenocarcinoma. In another embodiment, the cancer is gastric adenocarcinoma. In another embodiment, the cancer is an ovarian surface epithelial neoplasm (e.g. a benign, proliferative or malignant variety thereof). In another embodiment, the cancer is an oral squamous cell carcinoma. In another embodiment, the cancer is non small-cell lung carcinoma. In another embodiment, the cancer is an endometrial carcinoma. In another embodiment, the cancer is a bladder cancer. In another embodiment, the cancer is a head and neck cancer. In another embodiment, the cancer is a prostate carcinoma.
In another embodiment, the cancer is an acute myelogenous leukemia (AML). In another embodiment, the cancer is a myelodysplastic syndrome (MDS). In another embodiment, the cancer is a non-small cell lung cancer (NSCLC). In another embodiment, the cancer is a Wilms' tumor. In another embodiment, the cancer is a leukemia. In another embodiment, the cancer is a lymphoma. In another embodiment, the cancer is a desmoplastic small round cell tumor. In another embodiment, the cancer is a mesothelioma (e.g. malignant mesothelioma). In another embodiment, the cancer is a gastric cancer. In another embodiment, the cancer is a colon cancer. In another embodiment, the cancer is a lung cancer. In another embodiment, the cancer is a germ cell tumor. In another embodiment, the cancer is an ovarian cancer. In another embodiment, the cancer is a uterine cancer. In another embodiment, the cancer is a thyroid cancer. In another embodiment, the cancer is a hepatocellular carcinoma. In another embodiment, the cancer is a thyroid cancer. In another embodiment, the cancer is a liver cancer. In another embodiment, the cancer is a renal cancer. In another embodiment, the cancer is a kaposis. In another embodiment, the cancer is a sarcoma. In another embodiment, the cancer is another carcinoma or sarcoma. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the cancer is any other KLK3 or FOLH1-expressing cancer known in the art. Each type of cancer represents a separate embodiment of the present invention.
As provided herein, enhanced cell mediated immunity was demonstrated for fusion proteins comprising an antigen and truncated LLO containing the PEST-like amino acid sequence, SEQ ID NO: 1. The ΔLLO used in some of the Examples was 416 amino acids long (following cleavage of the signal peptide), as 88 residues from the carboxy terminus which is inclusive of the activation domain containing cysteine 484 were truncated. However, it is apparent from the present disclosure that other ΔLLO without the activation domain, and in particular cysteine 484, are efficacious in methods of the present invention. In another embodiment fusion of KLK3 or FOLH1 to any non-hemolytic LLO protein or fragment thereof, ActA protein or fragment thereof, or PEST-like amino AA enhances cell-mediated and anti-tumor immunity of the resulting vaccine.
As provided herein, fusion of an antigen to a non-hemolytic truncated form of listeriolysin O (LLO) enhanced immunogenicity. An LM vector that expresses and secretes a fusion product of Human Papilloma Virus (HPV) strain 16 E7 and LLO was a more potent cancer immunotherapeutic for HPV-immortalized tumors than LM secreting the E7 protein alone. Further, a recombinant vaccinia virus that carries the gene for the fusion protein LLO-E7 is a more potent cancer immunotherapeutic for HPV-immortalized tumors than an isogenic strain of vaccinia that carries the gene for E7 protein alone. In comparison, a short fusion protein Lm-AZ/-E7 comprising the E7 antigen fused to the promoter, signal sequence and the first 7 AA residues of LLO was an ineffective anti-tumor immunotherapeutic. This short fusion protein terminates directly before the PEST-like sequence and does not contain it.
“Fusion protein” refers, in another embodiment, to a protein comprising 2 or more proteins linked together by peptide bonds or other chemical bonds. In another embodiment, the proteins are linked together directly by a peptide or other chemical bond. In another embodiment, the proteins are linked together with one or more amino acids (e.g. a “spacer”) between the two or more proteins. Each possibility represents a separate embodiment of the present invention.
Fusion proteins comprising a KLK3 or FOLH1 peptide are, in another embodiment, prepared by any suitable method. In another embodiment, a fusion protein is prepared by cloning and restriction of appropriate sequences or direct chemical synthesis by methods discussed below. In another embodiment, subsequences are cloned and the appropriate subsequences cleaved using appropriate restriction enzymes. The fragments are then ligated, in another embodiment, to produce the desired DNA sequence. In another embodiment, DNA encoding the KLK3 or FOLH1 peptide is produced using DNA amplification methods, for example polymerase chain reaction (PCR). First, the segments of the native DNA on either side of the new terminus are amplified separately. The 5′ end of the one amplified sequence encodes the peptide linker, while the 3′ end of the other amplified sequence also encodes the peptide linker. Since the 5′ end of the first fragment is complementary to the 3′ end of the second fragment, the 2 fragments (after partial purification, e.g. on LMP agarose) can be used as an overlapping template in a third PCR reaction. The amplified sequence will contain codons, the segment on the carboxy side of the opening site (now forming the amino sequence), the linker, and the sequence on the amino side of the opening site (now forming the carboxyl sequence). The KLK3 or FOLH1 peptide-encoding gene is then ligated into a plasmid.
In another embodiment, the KLK3 or FOLH1 peptide is conjugated to the truncated ActA protein, truncated LLO protein, or PEST-like sequence by any of a number of means well known to those of skill in the art. In another embodiment, the KLK3 or FOLH1 peptide is conjugated, either directly or through a linker (spacer), to the ActA protein or LLO protein. In another embodiment, wherein both the KLK3 or FOLH1 peptide and the ActA protein or LLO protein are polypeptides, the chimeric molecule is recombinantly expressed as a single-chain fusion protein.
In another embodiment, wherein the KLK3 or FOLH1 peptide and/or the ActA protein, LLO protein, or PEST-like sequence is relatively short (i.e., less than about 50 AA), they are synthesized using standard chemical peptide synthesis techniques. Where both molecules are relatively short, in another embodiment, the chimeric molecule is synthesized as a single contiguous polypeptide. In another embodiment, the KLK3 or FOLH1 peptide and the ActA protein, LLO protein, or PEST-like sequence are synthesized separately and then fused by condensation of the amino terminus of one molecule with the carboxyl terminus of the other molecule thereby forming a peptide bond. In another embodiment, the KLK3 or FOLH1 peptide and the ActA protein, LLO protein, or PEST-like sequence are each condensed with one end of a peptide spacer molecule, thereby forming a contiguous fusion protein.
In another embodiment, the peptides and proteins of the present invention are readily prepared by standard, well-established solid-phase peptide synthesis (SPPS) as described by Stewart et al. in Solid Phase Peptide Synthesis, 2nd Edition, 1984, Pierce Chemical Company, Rockford, Ill.; and as described by Bodanszky and Bodanszky (The Practice of Peptide Synthesis, 1984, Springer-Verlag, New York). At the outset, a suitably protected amino acid residue is attached through its carboxyl group to a derivatized, insoluble polymeric support, such as cross-linked polystyrene or polyamide resin. “Suitably protected” refers to the presence of protecting groups on both the alpha-amino group of the amino acid, and on any side chain functional groups. Side chain protecting groups are generally stable to the solvents, reagents and reaction conditions used throughout the synthesis, and are removable under conditions which will not affect the final peptide product. Stepwise synthesis of the oligopeptide is carried out by the removal of the N-protecting group from the initial amino acid, and couple thereto of the carboxyl end of the next amino acid in the sequence of the desired peptide. This amino acid is also suitably protected. The carboxyl of the incoming amino acid can be activated to react with the N-terminus of the support-bound amino acid by formation into a reactive group such as formation into a carbodiimide, a symmetric acid anhydride or an “active ester” group such as hydroxybenzotriazole or pentafluorophenly esters.
Examples of solid phase peptide synthesis methods include the BOC method which utilized tert-butyloxcarbonyl as the alpha-amino protecting group, and the FMOC method which utilizes 9-fluorenylmethyloxcarbonyl to protect the alpha-amino of the amino acid residues, both methods of which are well-known by those of skill in the art.
Incorporation of N- and/or C-blocking groups can also be achieved using protocols conventional to solid phase peptide synthesis methods. For incorporation of C-terminal blocking groups, for example, synthesis of the desired peptide is typically performed using, as solid phase, a supporting resin that has been chemically modified so that cleavage from the resin results in a peptide having the desired C-terminal blocking group. To provide peptides in which the C-terminus bears a primary amino blocking group, for instance, synthesis is performed using a p-methylbenzhydrylamine (MBHA) resin so that, when peptide synthesis is completed, treatment with hydrofluoric acid releases the desired C-terminally amidated peptide. Similarly, incorporation of an N-methylamine blocking group at the C-terminus is achieved using N-methylaminoethyl-derivatized DVB, resin, which upon HF treatment releases a peptide bearing an N-methylamidated C-terminus. Blockage of the C-terminus by esterification can also be achieved using conventional procedures. This entails use of resin/blocking group combination that permits release of side-chain peptide from the resin, to allow for subsequent reaction with the desired alcohol, to form the ester function. FMOC protecting group, in combination with DVB resin derivatized with methoxyalkoxybenzyl alcohol or equivalent linker, can be used for this purpose, with cleavage from the support being effected by TFA in dicholoromethane. Esterification of the suitably activated carboxyl function e.g. with DCC, can then proceed by addition of the desired alcohol, followed by deprotection and isolation of the esterified peptide product.
Incorporation of N-terminal blocking groups can be achieved while the synthesized peptide is still attached to the resin, for instance by treatment with a suitable anhydride and nitrile. To incorporate an acetyl blocking group at the N-terminus, for instance, the resin coupled peptide can be treated with 20% acetic anhydride in acetonitrile. The N-blocked peptide product can then be cleaved from the resin, deprotected and subsequently isolated.
In another embodiment, to ensure that the peptide obtained from either chemical or biological synthetic techniques is the desired peptide, analysis of the peptide composition is conducted. In another embodiment, amino acid composition analysis is conducted using high resolution mass spectrometry to determine the molecular weight of the peptide. Alternatively, or additionally, the amino acid content of the peptide can be confirmed by hydrolyzing the peptide in aqueous acid, and separating, identifying and quantifying the components of the mixture using HPLC, or an amino acid analyzer. Protein sequencers, which sequentially degrade the peptide and identify the amino acids in order, may also be used to determine definitely the sequence of the peptide.
In another embodiment, prior to its use, the peptide is purified to remove contaminants. In this regard, it will be appreciated that the peptide will be purified so as to meet the standards set out by the appropriate regulatory agencies and guidelines. Any one of a number of a conventional purification procedures may be used to attain the required level of purity including, for example, reversed-phase high-pressure liquid chromatography (HPLC) using an alkylated silica column such as C4-,C8- or C18-silica. A gradient mobile phase of increasing organic content is generally used to achieve purification, for example, acetonitrile in an aqueous buffer, usually containing a small amount of trifluoroacetic acid. Ion-exchange chromatography can be also used to separate peptides based on their charge.
Solid phase synthesis in which the C-terminal AA of the sequence is attached to an insoluble support followed by sequential addition of the remaining amino acids in the sequence is used, in another embodiment, for the chemical synthesis of the polypeptides of this invention. Techniques for solid phase synthesis are described by Barany and Merrifield in Solid-Phase Peptide Synthesis; pp. 3-284 in The Peptides: Analysis, Synthesis, Biology. Vol. 2: Special Methods in Peptide Synthesis, Part A., Merrifield, et al. J. Am. Chem. Soc., 85: 2149-2156 (1963), and Stewart et al., Solid Phase Peptide Synthesis, 2nd ed. Pierce Chem. Co., Rockford, Ill. (1984).
In another embodiment, peptides of the present invention can incorporate AA residues which are modified without affecting activity. For example, the termini may be derivatized to include blocking groups, i.e. chemical substituents suitable to protect and/or stabilize the N- and C-termini from “undesirable degradation”, a term meant to encompass any type of enzymatic, chemical or biochemical breakdown of the compound at its termini which is likely to affect the function of the compound, i.e. sequential degradation of the compound at a terminal end thereof.
In another embodiment, blocking groups include protecting groups conventionally used in the art of peptide chemistry which will not adversely affect the in vivo activities of the peptide. For example, suitable N-terminal blocking groups can be introduced by alkylation or acylation of the N-terminus. Examples of suitable N-terminal blocking groups include C1-C5 branched or unbranched alkyl groups, acyl groups such as formyl and acetyl groups, as well as substituted forms thereof, such as the acetamidomethyl (Acm) group. Desamino analogs of amino acids are also useful N-terminal blocking groups, and can either be coupled to the N-terminus of the peptide or used in place of the N-terminal reside. Suitable C-terminal blocking groups, in which the carboxyl group of the C-terminus is either incorporated or not, include esters, ketones or amides. Ester or ketone-forming alkyl groups, particularly lower alkyl groups such as methyl, ethyl and propyl, and amide-forming amino groups such as primary amines (—NH2), and mono- and di-alkyl amino groups such as methyl amino, ethylamino, dimethylamino, diethylamino, methylethylamino and the like are examples of C-terminal blocking groups. Descarboxylated amino acid analogues such as agmatine are also useful C-terminal blocking groups and can be either coupled to the peptide's C-terminal residue or used in place of it. Further, it will be appreciated that the free amino and carboxyl groups at the termini can be removed altogether from the peptide to yield desamino and descarboxylated forms thereof without affect on peptide activity.
In another embodiment, other modifications are incorporated without adversely affecting the activity. In another embodiment, such modifications include, but are not limited to, substitution of one or more of the amino acids in the natural L-isomeric form with amino acids in the D-isomeric form. Thus, the peptide may include one or more D-amino acid resides, or may comprise amino acids which are all in the D-form. Retro-inverso forms of peptides in accordance with the present invention are also contemplated, for example, inverted peptides in which all amino acids are substituted with D-amino acid forms.
In another embodiment, acid addition salts peptides of the present invention are utilized as functional equivalents thereof. In another embodiment, a peptide in accordance with the present invention treated with an inorganic acid such as hydrochloric, hydrobromic, sulfuric, nitric, phosphoric, and the like, or an organic acid such as an acetic, propionic, glycolic, pyruvic, oxalic, malic, malonic, succinic, maleic, fumaric, tataric, citric, benzoic, cinnamie, mandelic, methanesulfonic, ethanesulfonic, p-toluenesulfonic, salicyclic and the like, to provide a water soluble salt of the peptide is suitable for use in the invention.
In another embodiment, modifications (which do not normally alter primary sequence) include in vivo, or in vitro chemical derivatization of polypeptides, e.g., acetylation, or carboxylation. Also included are modifications of glycosylation, e.g., those made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing or in further processing steps; e.g., by exposing the polypeptide to enzymes which affect glycosylation, e.g., mammalian glycosylating or deglycosylating enzymes. Also embraced are sequences which have phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
In another embodiment polypeptides are modified using ordinary molecular biological techniques so as to improve their resistance to proteolytic degradation or to optimize solubility properties or to render them more suitable as a therapeutic agent. Analogs of such polypeptides include those containing residues other than naturally occurring L-amino acids, e.g., D-amino acids or non-naturally occurring synthetic amino acids. The peptides of the invention are not limited to products of any of the specific exemplary processes listed herein.
In another embodiment, the chimeric fusion proteins of the present invention are synthesized using recombinant DNA methodology. Generally this involves creating a DNA sequence that encodes the fusion protein, placing the DNA in an expression cassette, such as the plasmid of the present invention, under the control of a particular promoter/regulatory element, and expressing the protein.
DNA encoding a fusion protein of the present invention are prepared, in another embodiment, by any suitable method, including, for example, cloning and restriction of appropriate sequences or direct chemical synthesis by methods such as the phosphotriester method of Narang et al. (1979, Meth. Enzymol. 68: 90-99); the phosphodiester method of Brown et al. (1979, Meth. Enzymol 68: 109-151); the diethylphosphoramidite method of Beaucage et al. (1981, Tetra. Lett., 22: 1859-1862); and the solid support method of U.S. Pat. No. 4,458,066.
Chemical synthesis produces a single stranded oligonucleotide. This is converted, in another embodiment, into double stranded DNA by hybridization with a complementary sequence, or by polymerization with a DNA polymerase using the single strand as a template. One of skill in the art would recognize that while chemical synthesis of DNA is limited to sequences of about 100 bases, longer sequences may be obtained by the ligation of shorter sequences.
In another embodiment, “isolated nucleic acid” includes an RNA or a DNA sequence encoding a fusion protein of the invention, and any modified forms thereof, including chemical modifications of the DNA or RNA which render the nucleotide sequence more stable when it is cell free or when it is associated with a cell. Chemical modifications of nucleotides may also be used to enhance the efficiency with which a nucleotide sequence is taken up by a cell or the efficiency with which it is expressed in a cell. Such modifications are detailed elsewhere herein. Any and all combinations of modifications of the nucleotide sequences are contemplated in the present invention.
In another embodiment, the present invention provides an isolated nucleic acid encoding a KLK3 or FOLH1 peptide operably linked to a non-hemolytic LLO, truncated ActA protein, or PEST-like sequence, wherein the isolated nucleic acid further comprises a promoter/regulatory sequence, such that the nucleic acid is preferably capable of directing expression of the protein encoded by the nucleic acid. Thus, the invention encompasses expression vectors and methods for the introduction of exogenous DNA into cells with concomitant expression of the exogenous DNA in the cells such as those described, for example, in Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
In another embodiment, a nucleotide of the present invention is operably linked to a promoter/regulatory sequence that drives expression of the encoded peptide in the Listeria strain. Promoter/regulatory sequences useful for driving constitutive expression of a gene are well known in the art and include, but are not limited to, for example, the PhlyA, PActA, and p60 promoters of Listeria, the Streptococcus bac promoter, the Streptomyces griseus sgiA promoter, and the B. thuringiensis phaZ promoter. Thus, it will be appreciated that the invention includes the use of any promoter/regulatory sequence that is capable of driving expression of the desired protein operably linked thereto.
Expressing a KLK3 or FOLH1 peptide operably linked to a non-hemolytic LLO, truncated ActA protein, or PEST-like sequence using a vector allows the isolation of large amounts of recombinantly produced protein. It is well within the skill of the artisan to choose particular promoter/regulatory sequences and operably link those promoter/regulatory sequences to a DNA sequence encoding a desired polypeptide. Such technology is well known in the art and is described, for example, in Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
In another embodiment, the present invention provides a vector comprising an isolated nucleic acid encoding a KLK3 or FOLH1 peptide operably linked to a non-hemolytic LLO, truncated ActA protein, or PEST-like sequence. The incorporation of a desired nucleic acid into a vector and the choice of vectors is well-known in the art as described in, for example, Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
In another embodiment, the present invention provides cells, viruses, proviruses, and the like, containing such vectors. Methods for producing cells comprising vectors and/or exogenous nucleic acids are well-known in the art. See, for example, Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York), and in Ausubel et al. (1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York).
In another embodiment, the nucleic acids encoding a KLK3 or FOLH1 peptide operably linked to a non-hemolytic LLO, truncated ActA protein, or PEST-like sequence are cloned into a plasmid vector. In another embodiment, a recombinant Listeria strain is transformed with the plasmid vector. Each possibility represents a separate embodiment of the present invention.
Once armed with the present invention, it is readily apparent to one skilled in the art that other nucleic acids encoding a KLK3 or FOLH1 peptide operably linked to a non-hemolytic LLO, truncated ActA protein, or PEST-like sequence can be obtained by following the procedures described herein in the experimental details section for the generation of other fusion proteins as disclosed herein (e.g., site-directed mutagenesis, frame shift mutations, and the like), and procedures in the art.
Methods for the generation of derivative or variant forms of fusion proteins are well known in the art, and include, inter alia, using recombinant DNA methodology well known in the art such as, for example, that described in Sambrook et al. (1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, New York) and Ausubel et al. (1997, Current Protocols in Molecular Biology, Green & Wiley, New York), and elsewhere herein.
In another embodiment, the present invention provides a nucleic acid encoding a KLK3 or FOLH1 peptide operably linked to a non-hemolytic LLO, truncated ActA protein, or PEST-like sequence, wherein a nucleic acid encoding a tag polypeptide is covalently linked thereto. That is, the invention encompasses a chimeric nucleic acid wherein the nucleic acid sequence encoding a tag polypeptide is covalently linked to the nucleic acid encoding a KLK3 or FOLH1 peptide-containing protein. Such tag polypeptides are well known in the art and include, for instance, green fluorescent protein (GFP), myc, myc-pyruvate kinase (myc-PK), His6, maltose biding protein (MBP), an influenza virus hemagglutinin tag polypeptide, a flag tag polypeptide (FLAG), and a glutathione-S-transferase (GST) tag polypeptide. However, the invention should in no way be construed to be limited to the nucleic acids encoding the above-listed tag polypeptides. Rather, any nucleic acid sequence encoding a polypeptide which may function in a manner substantially similar to these tag polypeptides should be construed to be included in the present invention.
The present invention also provides for analogs of ActA, LLO, and PEST-like sequences of the present invention, fragments thereof, proteins, or peptides. Analogs differ, in another embodiment, from naturally occurring proteins or peptides by conservative amino acid sequence differences, by modifications which do not affect sequence, or by both.
In another embodiment, the present invention provides a KLK3 peptide with enhanced immunogenicity. In another embodiment, the present invention provides an FOLH1 peptide with enhanced immunogenicity. That is, as the data disclosed herein demonstrate, a KLK3 or FOLH1 peptide fused to a truncated ActA protein, non-hemolytic LLO protein, or PEST-like sequence, when administered to an animal, results in a clearance of existing tumors and the induction of antigen-specific cytotoxic lymphocytes capable of infiltrating tumor or infected cells. When armed with the present disclosure, and the methods and compositions disclosed herein, the skilled artisan will readily realize that the present invention in amenable to treatment and/or prevention of a multitude of diseases.
In another embodiment, a commercially available plasmid is used in the present invention. Such plasmids are available from a variety of sources, for example, Invitrogen (Carlsbad, Calif.), Stratagene (La Jolla, Calif.), Clontech (Palo Alto, Calif.), or can be constructed using methods well known in the art. A commercially available plasmid such as pCR2.1 (Invitrogen, Carlsbad, Calif.), which is a prokaryotic expression vector with a prokaryotic origin of replication and promoter/regulatory elements to facilitate expression in a prokaryotic organism.
The present invention further comprises transforming such a Listeria strain with a plasmid comprising (a) a KLK3 or FOLH1 peptide; and (b) an isolated nucleic acid encoding a truncated ActA protein, truncated LLO protein, or PEST-like sequence. In another embodiment, if an LM vaccine strain comprises a deletion in the prfA gene or the actA gene, the plasmid comprises a prfA or actA gene in order to complement the mutation, thereby restoring function to the L. monocytogenes vaccine strain. As described elsewhere herein, methods for transforming bacteria are well known in the art, and include calcium-chloride competent cell-based methods, electroporation methods, bacteriophage-mediated transduction, chemical, and physical transformation techniques (de Boer et al, 1989, Cell 56:641-649; Miller et al, 1995, FASEB J., 9:190-199; Sambrook et al. 1989, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York; Ausubel et al., 1997, Current Protocols in Molecular Biology, John Wiley & Sons, New York; Gerhardt et al., eds., 1994, Methods for General and Molecular Bacteriology, American Society for Microbiology, Washington, D.C.; Miller, 1992, A Short Course in Bacterial Genetics, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.).
The plasmid of the present invention comprises, in another embodiment, a promoter/regulatory sequence operably linked to a gene encoding a fusion protein.
Plasmids and other expression vectors useful in the present invention are described elsewhere herein, and can include such features as a promoter/regulatory sequence, an origin of replication for gram negative and/or gram positive bacteria, and an isolated nucleic acid encoding a fusion protein. Further, the isolated nucleic acid encoding a fusion protein will have its own promoter suitable for driving expression of such an isolated nucleic acid. Promoters useful for driving expression in a bacterial system are well known in the art, and include bacteriophage lambda, the bla promoter of the beta-lactamase gene of pBR322, and the CAT promoter of the chloramphenicol acetyl transferase gene of pBR325. Further examples of prokaryotic promoters include the major right and left promoters of bacteriophage lambda (PL and PR), the trp, recA, lacZ, lacd, and gal promoters of E. coli, the alpha-amylase (Ulmanen et al, 1985. J. Bacteriol. 162:176-182) and the S28-specific promoters of B. subtilis (Gilman et al, 1984 Gene 32:11-20), the promoters of the bacteriophages of Bacillus (Gryczan, 1982, In: The Molecular Biology of the Bacilli, Academic Press, Inc., New York), and Streptomyces promoters (Ward et al, 1986, Mol. Gen. Genet. 203:468-478). Additional prokaryotic promoters contemplated in the present invention are reviewed in, for example, Glick (1987, J. Ind. Microbiol. 1:277-282); Cenatiempo, (1986, Biochimie, 68:505-516); and Gottesman, (1984, Ann Rev. Genet. 18:415-442). Further examples of promoter/regulatory elements contemplated in the present invention include, but are not limited to the Listerial prfA promoter (GenBank Acc. No. Y07639), the Listerial hly promoter (GenBank Acc. No. X15127), and the Listerial p60 promoter (GenBank Acc. No. AY126342), or fragments thereof.
In another embodiment, a Listeria strain of methods and compositions of the present invention contains an integrated gene encoding a peptide that comprises a KLK3 peptide. In another embodiment, the Listeria strain contains an integrated gene encoding a peptide that comprises a FOLH1 peptide.
In another embodiment, a Listeria strain of methods and compositions of the present invention is created using a site-specific integration vector. In another embodiment, a Listeria strain containing an integrated gene is created using homologous recombination. In another embodiment, a Listeria strain containing an integrated gene is created using any other method known in the art of integrating a gene into the Listeria chromosome. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the integration vector comprises a PSA attPP′ site. In another embodiment, the integration vector comprises a gene encoding a PSA integrase. In another embodiment, the integration vector comprises a U153 attPP′ site. In another embodiment, the integration vector comprises a gene encoding a U153 integrase. In another embodiment, the integration vector comprises an A118 attPP′ site. In another embodiment, the integration vector comprises a gene encoding an A118 integrase. In another embodiment, the integration vector comprises any other attPP′ site known in the art. In another embodiment, the integration vector comprises any other phage integrase known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, a Listeria strain of methods and compositions of the present invention contains a mutation or auxotrophy in a metabolic gene. In another embodiment, a plasmid carrying a KLK3 peptide or FOLH1 peptide contains a metabolic gene that complements the mutation or auxotrophy. In another embodiment, a KLK3 peptide- or FOLH1 peptide-encoding integration vector or construct used for integration into the Listeria chromosome contains a gene that complements the mutation or auxotrophy. In another embodiment, the metabolic gene is used for selection instead of an antibiotic resistance gene. In another embodiment, the metabolic gene is used for selection in addition to an antibiotic resistance gene. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic gene is a gene encoding an amino acid metabolism enzyme. In another embodiment, the metabolic enzyme is an alanine racemase (dal) enzyme. In another embodiment, the metabolic enzyme is D-amino acid transferase enzyme (dat).
In another embodiment, the metabolic enzyme metabolizes an amino acid (AA) that is used for a bacterial growth process. In another embodiment, the product AA is used for a replication process. In another embodiment, the product AA is used for cell wall synthesis. In another embodiment, the product AA is used for protein synthesis. In another embodiment, the product AA is used for metabolism of a fatty acid. In another embodiment, the product AA is used for any other growth or replication process known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic enzyme catalyzes the formation of an AA used in cell wall synthesis. In another embodiment, the metabolic enzyme catalyzes synthesis of an AA used in cell wall synthesis. In another embodiment, the metabolic enzyme is involved in synthesis of an AA used in cell wall synthesis. In another embodiment, the AA is used in cell wall biogenesis. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic enzyme is a synthetic enzyme for D-glutamic acid, a cell wall component.
In another embodiment, the metabolic enzyme is encoded by an alanine racemase gene (dal) gene. D-glutamic acid synthesis is controlled in part by the dal gene, which is involved in the conversion of D-glu+ pyr to alpha-ketoglutarate+D-ala, and the reverse reaction.
In another embodiment, the dal protein of methods and compositions of the present invention has the sequence:
In another embodiment, the dal protein is homologous to SEQ ID No: 56. In another embodiment, the dal protein is a variant of SEQ ID No: 56. In another embodiment, the dal protein is an isomer of SEQ ID No: 56. In another embodiment, the dal protein is a fragment of SEQ ID No: 56. In another embodiment, the dal protein is a fragment of a homologue of SEQ ID No: 56. In another embodiment, the dal protein is a fragment of a variant of SEQ ID No: 56. In another embodiment, the dal protein is a fragment of an isomer of SEQ ID No: 56.
In another embodiment, the dal protein any other Listeria dal protein known in the art. In another embodiment, the dal protein is any other gram-positive dal protein known in the art. In another embodiment, the dal protein any other dal protein known in the art. Each possibility represents a separate embodiment of the present invention.
The dat protein of methods and compositions of the present invention is encoded, in another embodiment, by the sequence:
In another embodiment, the dat protein is homologous to SEQ ID No: 57. In another embodiment, the dat protein is a variant of SEQ ID No: 57. In another embodiment, the dat protein is an isomer of SEQ ID No: 57. In another embodiment, the dat protein is a fragment of SEQ ID No: 57. In another embodiment, the dat protein is a fragment of a homologue of SEQ ID No: 57. In another embodiment, the dat protein is a fragment of a variant of SEQ ID No: 57. In another embodiment, the dat protein is a fragment of an isomer of SEQ ID No: 57.
In another embodiment, the dat protein any other Listeria dat protein known in the art. In another embodiment, the dat protein is any other gram-positive dat protein known in the art. In another embodiment, the dat protein any other dat protein known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic enzyme is a D-glutamic acid synthesis gene. In another embodiment, the metabolic enzyme is encoded by dga. In another embodiment, the metabolic enzyme is encoded by an alr (alanine racemase) gene. In another embodiment, the metabolic enzyme is any other enzyme known in the art that is involved in alanine synthesis.
In another embodiment, the metabolic enzyme is encoded by serC, a phosphoserine aminotransferase. In another embodiment, the metabolic enzyme is encoded by asd (aspartate beta-semialdehyde dehydrogenase), involved in synthesis of the cell wall constituent diaminopimelic acid. In another embodiment, the metabolic enzyme is encoded by gsaB-glutamate-1-semialdehyde aminotransferase, which catalyzes the formation of 5-aminolevulinate from (S)-4-amino-5-oxopentanoate. In another embodiment, the metabolic enzyme is encoded by HemL, which catalyzes the formation of 5-aminolevulinate from (S)-4-amino-5-oxopentanoate. In another embodiment, the metabolic enzyme is encoded by aspB, an aspartate aminotransferase that catalyzes the formation of oxalozcetate and L-glutamate from L-aspartate and 2-oxoglutarate. In another embodiment, the metabolic enzyme is encoded by argF-1, involved in arginine biosynthesis. In another embodiment, the metabolic enzyme is encoded by aroE, involved in amino acid biosynthesis. In another embodiment, the metabolic enzyme is encoded by aroB, involved in 3-dehydroquinate biosynthesis. In another embodiment, the metabolic enzyme is encoded by aroD, involved in amino acid biosynthesis. In another embodiment, the metabolic enzyme is encoded by aroC, involved in amino acid biosynthesis. In another embodiment, the metabolic enzyme is encoded by hisB, involved in histidine biosynthesis. In another embodiment, the metabolic enzyme is encoded by hisD, involved in histidine biosynthesis. In another embodiment, the metabolic enzyme is encoded by hisG, involved in histidine biosynthesis. In another embodiment, the metabolic enzyme is encoded by metX, involved in methionine biosynthesis. In another embodiment, the metabolic enzyme is encoded by proB, involved in proline biosynthesis. In another embodiment, the metabolic enzyme is encoded by argR, involved in arginine biosynthesis. In another embodiment, the metabolic enzyme is encoded by argJ, involved in arginine biosynthesis. In another embodiment, the metabolic enzyme is encoded by thil, involved in thiamine biosynthesis. In another embodiment, the metabolic enzyme is encoded by LMOf2365_1652, involved in tryptophan biosynthesis. In another embodiment, the metabolic enzyme is encoded by aroA, involved in tryptophan biosynthesis. In another embodiment, the metabolic enzyme is encoded by ilvD, involved in valine and isoleucine biosynthesis. In another embodiment, the metabolic enzyme is encoded by ilvC, involved in valine and isoleucine biosynthesis. In another embodiment, the metabolic enzyme is encoded by leuA, involved in leucine biosynthesis. In another embodiment, the metabolic enzyme is encoded by dapF, involved in lysine biosynthesis. In another embodiment, the metabolic enzyme is encoded by thrB, involved in threonine biosynthesis (all GenBank Accession No. NC_002973).
In another embodiment, the metabolic enzyme is a tRNA synthetase. In another embodiment, the metabolic enzyme is encoded by the trpS gene, encoding tryptophanyltRNA synthetase. In another embodiment, the metabolic enzyme is any other tRNA synthetase known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the host strain bacteria is Δ(trpS aroA), and both markers are contained in the integration vector.
In another embodiment, the metabolic enzyme is encoded by murE, involved in synthesis of diaminopimelic acid (GenBank Accession No: NC_003485).
In another embodiment, the metabolic enzyme is encoded by LMOf2365_2494, involved in teichoic acid biosynthesis.
In another embodiment, the metabolic enzyme is encoded by WecE (Lipopolysaccharide biosynthesis protein rffA; GenBank Accession No: AE014075.1). In another embodiment, the metabolic enzyme is encoded by amiA, an N-acetylmuramoyl-L-alanine amidase. In another embodiment, the metabolic enzyme is aspartate aminotransferase. In another embodiment, the metabolic enzyme is histidinol-phosphate aminotransferase (GenBank Accession No. NP_466347). In another embodiment, the metabolic enzyme is the cell wall teichoic acid glycosylation protein GtcA.
In another embodiment, the metabolic enzyme is a synthetic enzyme for a peptidoglycan component or precursor. In another embodiment, the component is UDP-N-acetylmuramyl-pentapeptide. In another embodiment, the component is UDP-N-acetylglucosamine. In another embodiment, the component is MurNAc-(pentapeptide)-pyrophosphoryl-undecaprenol. In another embodiment, the component is GlcNAc-β-(1,4)-MurNAc-(pentapeptide)-pyrophosphoryl-undecaprenol. In another embodiment, the component is any other peptidoglycan component or precursor known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic enzyme is encoded by murG. In another embodiment, the metabolic enzyme is encoded by murD. In another embodiment, the metabolic enzyme is encoded by murA-1. In another embodiment, the metabolic enzyme is encoded by murA-2 (all set forth in GenBank Accession No. NC_002973). In another embodiment, the metabolic enzyme is any other synthetic enzyme for a peptidoglycan component or precursor. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic enzyme is a trans-glycosylase. In another embodiment, the metabolic enzyme is trans-peptidase. In another embodiment, the metabolic enzyme is a carboxy-peptidase. In another embodiment, the metabolic enzyme is any other class of metabolic enzyme known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the metabolic enzyme is any other Listeria monocytogenes metabolic enzyme known in the art.
In another embodiment, the metabolic enzyme is any other Listeria metabolic enzyme known in the art.
In another embodiment, the metabolic enzyme is any other gram-positive bacteria metabolic enzyme known in the art.
In another embodiment, the metabolic enzyme is any other metabolic enzyme known in the art. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the integration vector is any other site-specific integration vector known in the art that is capable of infecting Listeria. Each possibility represents a separate embodiment of the present invention.
In another embodiment, the present invention provides methods for enhancing the immunogenicity of a KLK3 or FOLH1 antigen via fusion of the antigen to a non-hemolytic truncated form of LLO (“ΔLLO”). In another embodiment, the antigen is fused to a PEST-like sequence. In another embodiment, the PEST-like amino acid sequence is SEQ ID NO: 1, of LLO. The present invention further provides methods and compositions for enhancing the immunogenicity of a KLK3 or FOLH1 antigen by fusing the antigen to a truncated ActA protein, truncated LLO protein, or fragment thereof. As demonstrated by the data disclosed herein, an antigen fused to an ActA protein elicits an immune response that clears existing tumors and results in the induction of antigen-specific cytotoxic lymphocytes.
In another embodiment, fusion proteins of the present invention are produced recombinantly via transcription and translation, in a bacterium, of a plasmid or nucleotide molecule that encodes both a KLK3 peptide and a non-KLK3 peptide. In another embodiment, a fusion protein is produced recombinantly via transcription and translation, in a bacterium, of a plasmid or nucleotide molecule that encodes both a FOLH1 peptide and a non-FOLH1 peptide/In another embodiment, the plasmid or nucleotide is transcribed and/or translated in vitro. In another embodiment, the antigen is chemically conjugated to the truncated form of LLO comprising the PEST-like AA sequence of L. monocytogenes or a PEST-like AA sequence derived from another prokaryotic organism. “Antigen” refers, in another embodiment, to the native KLK3 or FOLH1 gene product or truncated versions of these that include identified T cell epitopes. In another embodiment, these fusion proteins are then incorporated into vaccines for administration to a subject, to invoke an enhanced immune response against the antigen of the fusion protein. In other embodiments, the fusion proteins of the present invention are delivered as DNA vaccines, RNA vaccines or replicating RNA vaccines. As will be apparent to those of skill in the art upon this disclosure, vaccines comprising the fusion proteins of the present invention are particularly useful in the prevention and treatment of infectious and neoplastic diseases.
The present invention further comprises a method of administering to an animal or human an effective amount of a composition comprising a vaccine of the present invention. The composition comprises, among other things, a pharmaceutically acceptable carrier. In another embodiment, the composition includes a Listeria vaccine strain comprising a truncated ActA protein, truncated LLO protein, or fragment thereof, fused to a KLK3 or FOLH1 peptide, and a pharmaceutically acceptable carrier.
In another embodiment, the present invention provides a kit that comprises a composition, including a KLK3 or FOLH1 peptide fused to a truncated LLO protein, truncated ActA protein, or a PEST-like sequence and/or a Listeria vaccine strain comprising same, an applicator, and an instructional material which describes use of the compound to perform the methods of the invention. Although model kits are described below, the contents of other useful kits will be apparent to the skilled artisan in light of the present disclosure. Each of these kits is contemplated within the present invention.
In another embodiment, the present invention provides a kit for eliciting an enhanced immune response to an antigen, the kit comprising a KLK3 or FOLH1 peptide fused to a truncated ActA protein, truncated LLO protein, or PEST-like sequence, and a pharmaceutically acceptable carrier, said kit further comprising an applicator, and an instructional material for use thereof.
In another embodiment, the present invention provides a kit for eliciting an enhanced immune response to an antigen. The kit is used in the same manner as the methods disclosed herein for the present invention. In another embodiment, the kit is used to administer a Listeria vaccine strain comprising a KLK3 or FOLH1 peptide fused to a truncated ActA protein, LLO protein, or PEST-like sequence. In another embodiment, the kit comprises an applicator and an instructional material for the use of the kit. These instructions simply embody the examples provided herein.
In another embodiment, the invention includes a kit for eliciting an enhanced immune response to an antigen. The kit is used in the same manner as the methods disclosed herein for the present invention. Briefly, the kit may be used to administer an antigen fused to an ActA protein, LLO protein, or PEST-like sequence. Additionally, the kit comprises an applicator and an instructional material for the use of the kit. These instructions simply embody the examples provided herein.
EXPERIMENTAL DETAILS SECTION Example 1: LLO-Antigen Fusions Induce Anti-Tumor Immunity Materials and Experimental Methods (Examples 1-2) Cell linesThe C57BL/6 syngeneic TC-1 tumor was immortalized with HPV-16 E6 and E7 and transformed with the c-Ha-ras oncogene. TC-1 expresses low levels of E6 and E7 and is highly tumorigenic. TC-1 was grown in RPMI 1640, 10% FCS, 2 mM L-glutamine, 100 U/ml penicillin, 100 μg/ml streptomycin, 100 μM nonessential amino acids, 1 mM sodium pyruvate, 50 micromolar (mcM) 2-ME, 400 microgram (mcg)/ml G418, and 10% National Collection Type Culture-109 medium at 37° with 10% CO2. C3 is a mouse embryo cell from C57BL/6 mice immortalized with the complete genome of HPV 16 and transformed with pEJ-ras. EL-4/E7 is the thymoma EL-4 retrovirally transduced with E7.
L. monocytogenes Strains and Propagation
Listeria strains used were Lm-LLO-E7 (hly-E7 fusion gene in an episomal expression system;
To generate pGG-55, the LLO-E7 plasmid, E7 was amplified by PCR using the primers 5′-GGCTCGAGCATGGAGATACACC-3′ (SEQ ID No: 8; XhoI site is underlined) and 5′-GGGGACTAGTTTATGGTTTCTGAGAACA-3′ (SEQ ID No: 9; SpeI site is underlined) and ligated into pCR2.1 (Invitrogen, San Diego, Calif.). E7 was excised from pCR2.1 by XhoI/SpeI digestion and ligated into pDP-2028 (Ikonomidis G et al. Delivery of a viral antigen to the class I processing and presentation pathway by Listeria monocytogenes. J Exp Med. 1994 Dec. 1; 180(6):2209-18). The hly-E7 fusion gene and the pluripotential transcription factor prfA were amplified and subcloned into pAM401, a multicopy shuttle plasmid (Wirth R et al, J Bacteriol, 165: 831, 1986), generating pGG-55. The hly promoter and gene fragment were amplified using primers 5′-GGGGGCTAGCCCTCCTTTGATTAGTATATTC-3′ (SEQ ID No: 10; NheI site is underlined) and 5′-CTCCCTCGAGATCATAATTTACTTCATC-3′ (SEQ ID No: 11; XhoI site is underlined). The prfA gene was PCR amplified using primers 5′-GACTACAAGGACGATGACCGACAAGTGATAACCCGGGATCTAAATAAATCCGTTT-3′ (SEQ ID No: 12; XbaI site is underlined) and 5′-CCCGTCGACCAGCTCTTCTTGGTGAAG-3′ (SEQ ID No: 13; SalI site is underlined).
In the resulting plasmid, pGG-55, the hly promoter drives the expression of the first 441 AA of the hly gene product, including the subsequently cleaved signal sequence, which is joined by the XhoI site to the E7 gene, yielding a hly-E7 fusion gene that is transcribed and secreted as LLO-E7. This LLO fragment lacks the hemolytic C-terminus and has the sequence set forth in SEQ ID No: 18. It is referred to below as “ΔLLO,” and is merely an exemplary ΔLLO of many that could be used with methods and compositions of the present invention. Transformation of a prfA-negative strain of Listeria, XFL-7 (provided by Dr. Hao Shen, University of Pennsylvania), with pGG-55 selected for the retention of the plasmid in vivo (
Lm-E7 was generated by introducing an expression cassette containing the hly promoter and signal sequence driving the expression and secretion of E7 into the orfZ domain of the LM genome. E7 was amplified by PCR using the primers 5′-GCGGATCCCATGGAGATACACCTAC-3′ (SEQ ID No: 22; BamHI site is underlined) and 5′-GCTCTAGATTATGGTTTCTGAG-3′ (SEQ ID No: 23; XbaI site is underlined). E7 was then ligated into the pZY-21 shuttle vector. LM strain 10403S was transformed with the resulting plasmid, pZY-21-E7, which includes an expression cassette inserted in the middle of a 1.6-kb sequence that corresponds to the orfX, Y, Z domain of the LM genome. The homology domain allows for insertion of the E7 gene cassette into the orfZ domain by homologous recombination. Clones were screened for integration of the E7 gene cassette into the orfZ domain. Bacteria were grown in brain heart infusion medium with (Lm-LLO-E7 and Lm-LLO-NP) or without (Lm-E7 and ZY-18) chloramphenicol (20 μg/ml). Bacteria were frozen in aliquots at −80° C. Expression was verified by Western blotting (
Listeria strains were grown in Luria-Bertoni medium at 37° C. and were harvested at the same optical density measured at 600 nm. The supernatants were TCA precipitated and resuspended in 1× sample buffer supplemented with 0.1 N NaOH. Identical amounts of each cell pellet or each TCA-precipitated supernatant were loaded on 4-20% Tris-glycine SDS-PAGE gels (NOVEX, San Diego, Calif.). The gels were transferred to polyvinylidene difluoride and probed with an anti-E7 monoclonal antibody (mAb) (Zymed Laboratories, South San Francisco, Calif.), then incubated with HRP-conjugated anti-mouse secondary Ab (Amersham Pharmacia Biotech, Little Chalfont, U.K.), developed with Amersham ECL detection reagents, and exposed to Hyperfilm (Amersham Pharmacia Biotech).
Measurement of Tumor GrowthTumors were measured every other day with calipers spanning the shortest and longest surface diameters. The mean of these two measurements was plotted as the mean tumor diameter in millimeters against various time points. Mice were sacrificed when the tumor diameter reached 20 mm. Tumor measurements for each time point are shown only for surviving mice.
Effects of Listeria Recombinants on Established Tumor GrowthSix- to 8-wk-old C57BL/6 mice (Charles River) received 2×105 TC-1 cells s.c. on the left flank. One week following tumor inoculation, the tumors had reached a palpable size of 4-5 mm in diameter. Groups of 8 mice were then treated with 0.1 LD50 i.p. Lm-LLO-E7 (107 CFU), Lm-E7 (106 CFU), Lm-LLO-NP (107 CFU), or Lm-Gag (5×105 CFU) on days 7 and 14.
51Cr Release AssayC57BL/6 mice, 6-8 wk old, were immunized i.p. with 0.1LD50 Lm-LLO-E7, Lm-E7, Lm-LLO-NP, or Lm-Gag. Ten days post-immunization, spleens were harvested. Splenocytes were established in culture with irradiated TC-1 cells (100:1, splenocytes:TC-1) as feeder cells; stimulated in vitro for 5 days, then used in a standard 51Cr release assay, using the following targets: EL-4, EL-4/E7, or EL-4 pulsed with E7 H-2b peptide (RAHYNIVTF). E:T cell ratios, performed in triplicate, were 80:1, 40:1, 20:1, 10:1, 5:1, and 2.5:1. Following a 4-h incubation at 37° C., cells were pelleted, and 50 μl supernatant was removed from each well. Samples were assayed with a Wallac 1450 scintillation counter (Gaithersburg, Md.). The percent specific lysis was determined as [(experimental counts per minute−spontaneous counts per minute)/(total counts per minute−spontaneous counts per minute)]×100.
TC-1-Specific ProliferationC57BL/6 mice were immunized with 0.1 LD50 and boosted by i.p. injection 20 days later with 1 LD50 Lm-LLO-E7, Lm-E7, Lm-LLO-NP, or Lm-Gag. Six days after boosting, spleens were harvested from immunized and naive mice. Splenocytes were established in culture at 5×105/well in flat-bottom 96-well plates with 2.5×104, 1.25×104, 6×103, or 3×103 irradiated TC-1 cells/well as a source of E7 Ag, or without TC-1 cells or with 10 μg/ml Con A. Cells were pulsed 45 h later with 0.5 μCi [3H]thymidine/well. Plates were harvested 18 h later using a Tomtec harvester 96 (Orange, Conn.), and proliferation was assessed with a Wallac 1450 scintillation counter. The change in counts per minute was calculated as experimental counts per minute—no Ag counts per minute.
Flow Cytometric AnalysisC57BL/6 mice were immunized intravenously (i.v.) with 0.1 LD50 Lm-LLO-E7 or Lm-E7 and boosted 30 days later. Three-color flow cytometry for CD8 (53-6.7, PE conjugated), CD62 ligand (CD62L; MEL-14, APC conjugated), and E7 H-2Db tetramer was performed using a FACSCalibur® flow cytometer with CellQuest® software (Becton Dickinson, Mountain View, Calif.). Splenocytes harvested 5 days after the boost were stained at room temperature (rt) with H-2Db tetramers loaded with the E7 peptide (RAHYNIVTF) or a control (HIV-Gag) peptide. Tetramers were used at a 1/200 dilution and were provided by Dr. Larry R. Pease (Mayo Clinic, Rochester, Minn.) and by the National Institute of Allergy and Infectious Diseases Tetramer Core Facility and the National Institutes of Health AIDS Research and Reference Reagent Program. Tetramer+, CD8+, CD62Llow cells were analyzed.
Depletion of Specific Immune ComponentsCD8+ cells, CD4+ cells and IFN were depleted in TC-1-bearing mice by injecting the mice with 0.5 mg per mouse of mAb: 2.43, GK1.5, or xmg1.2, respectively, on days 6, 7, 8, 10, 12, and 14 post-tumor challenge. CD4+ and CD8+ cell populations were reduced by 99% (flow cytometric analysis). CD25+ cells were depleted by i.p. injection of 0.5 mg/mouse anti-CD25 mAb (PC61, provided by Andrew J. Caton) on days 4 and 6. TGF was depleted by i.p. injection of the anti-TGF-mAb (2G7, provided by H. I. Levitsky), into TC-1-bearing mice on days 6, 7, 8, 10, 12, 14, 16, 18, and 20. Mice were treated with 107 Lm-LLO-E7 or Lm-E7 on day 7 following tumor challenge.
Adoptive TransferDonor C57BL/6 mice were immunized and boosted 7 days later with 0.1 LD50 Lm-E7 or Lm-Gag. The donor splenocytes were harvested and passed over nylon wool columns to enrich for T cells. CD8+ T cells were depleted in vitro by incubating with 0.1 μg 2.43 anti-CD8 mAb for 30 min at rt. The labeled cells were then treated with rabbit complement. The donor splenocytes were >60% CD4+ T cells (flow cytometric analysis). TC-1 tumor-bearing recipient mice were immunized with 0.1 LD50 7 days post-tumor challenge. CD4+-enriched donor splenocytes (107) were transferred 9 days after tumor challenge to recipient mice by i.v. injection.
B16F0-Ova Experiment24 C57BL/6 mice were inoculated with 5×105 16F0-Ova cells. On days 3, 10 and 17, groups of 8 mice were immunized with 0.1 LD50 Lm-OVA (106 cfu), Lm-LLO-OVA (108 cfu) and eight animals were left untreated.
StatisticsFor comparisons of tumor diameters, mean and SD of tumor size for each group were determined, and statistical significance was determined by Student's t test. p<0.05 was considered significant.
ResultsLm-E7 and Lm-LLO-E7 were compared for their abilities to impact on TC-1 growth. Subcutaneous tumors were established on the left flank of C57BL/6 mice. Seven days later tumors had reached a palpable size (4-5 mm). Mice were vaccinated on days 7 and 14 with 0.1 LD50 Lm-E7, Lm-LLO-E7, or, as controls, Lm-Gag and Lm-LLO-NP. Lm-LLO-E7 induced complete regression of 75% of established TC-1 tumors, while the other 2 mice in the group controlled their tumor growth (
In other experiments, similar results were obtained with 2 other E7-expressing tumor cell lines: C3 and EL-4/E7. To confirm the efficacy of vaccination with Lm-LLO-E7, animals that had eliminated their tumors were re-challenged with TC-1 or EL-4/E7 tumor cells on day 60 or day 40, respectively. Animals immunized with Lm-LLO-E7 remained tumor free until termination of the experiment (day 124 in the case of TC-1 and day 54 for EL-4/E7).
A similar experiment was performed with the chicken ovalbumin antigen (OVA). Mice were immunized with either Lm-OVA or Lm-LLO-OVA, then challenged with either an EL-4 thymoma engineered to express OVA or the very aggressive murine melanoma cell line B16F0-Ova, which has very low MHC class I expression. In both cases, Lm-LLO-OVA, but not Lm-OVA, induced the regression of established tumors. For example, at the end of the B16F0 experiment (day 25), all the mice in the naive group and the Lm-OVA group had died. All the Lm-LLO-OVA mice were alive, and 50% of them were tumor free. (
Thus, expression of an antigen gene as a fusion protein with ΔLLO enhances the immunogenicity of the antigen.
Example 2: Lm-LLO-E7 Treatment Elicits TC-1 Specific Splenocyte ProliferationTo measure induction of T cells by Lm-E7 with Lm-LLO-E7, TC-1-specific proliferative responses of splenocytes from rLm-immunized mice, a measure of antigen-specific immunocompetence, were assessed. Splenocytes from Lm-LLO-E7-immunized mice proliferated when exposed to irradiated TC-1 cells as a source of E7, at splenocyte: TC-1 ratios of 20:1, 40:1, 80:1, and 160:1 (
Lm-LLO-NP was prepared as depicted in
In order to confirm the generality of the finding that fusing LLO to an antigen confers enhanced immunity, Lm-LLO-NP and Lm-NP (isogenic with the Lm-E7 vectors, but expressing influenza antigen) were constructed, and the vectors were compared for ability to induce tumor regression, with Lm-Gag (isogenic with Lm-NP except for the antigen expressed) as a negative control. As depicted in
The WR strain of vaccinia was used as the recipient and the fusion gene was excised from the Listerial plasmid and inserted into pSC11 under the control of the p75 promoter. This vector was chosen because it is the transfer vector used for the vaccinia constructs Vac-SigE7Lamp and Vac-E7 and would therefore allow direct comparison with Vac-LLO-E7. In this way all three vaccinia recombinants would be expressed under control of the same early/late compound promoter p7.5. In addition, SC11 allows the selection of recombinant viral plaques to TK selection and beta-galactosidase screening.
The following modifications were made to allow expression of the gene product by vaccinia: (a) the T5XT sequence that prevents early transcription by vaccinia was removed from the 5′ portion of the LLO-E7 sequence by PCR; and (b) an additional XmaI restriction site was introduced by PCR to allow the final insertion of LLO-E7 into SC11. Successful introduction of these changes (without loss of the original sequence that encodes for LLO-E7) was verified by sequencing. The resultant pSCl 1-E7 construct was used to transfect the TK-ve cell line CV1 that had been infected with the wild-type vaccinia strain, WR. Cell lysates obtained from this co-infection/transfection step contain vaccinia recombinants that were plaque-purified 3 times. Expression of the LLO-E7 fusion product by plaque purified vaccinia was verified by Western blot using an antibody directed against the LLO protein sequence. In addition, the ability of Vac-LLO-E7 to produce CD8+ T cells specific to LLO and E7 was determined using the LLO (91-99) and E7 (49-57) epitopes of Balb/c and C57/BL6 mice, respectively. Results were confirmed in a chromium release assay.
ResultsTo determine whether enhancement of immunogenicity by fusion of an antigen to LLO requires a Listeria vector, a vaccinia vector expressing E7 as a fusion protein with a non-hemolytic truncated form of LLO (ΔLLO) was constructed. Tumor rejection studies were performed with TC-1 following the protocol described for Example 1. Two experiments were performed with differing delays before treatment was started. In one experiment, treatments were initiated when the tumors were about 3 mm in diameter (
These results show that (a) fusion of ΔLLO-antigen fusions are immunogenic not only in the context of Listeria, but also in other contexts; and (b) the immunogenicity of ΔLLO-antigen fusions compares favorably with other accepted vaccine approaches.
Example 5: actA-Antigen and Pest-Antigen Fusions Confer Anti-Tumor Immunity Materials and Experimental Methods Construction of Lm-PEST-E7, Lm-ΔPEST-E7, and Lm-E7epi (FIG. 8A)Lm-PEST-E7 is identical to Lm-LLO-E7, except that it contains only the promoter and PEST sequence of the hly gene, specifically the first 50 AA of LLO. To construct Lm-PEST-E7, the hly promoter and PEST regions were fused to the full-length E7 gene using the SOE (gene splicing by overlap extension) PCR technique. The E7 gene and the hly-PEST gene fragment were amplified from the plasmid pGG-55, which contains the first 441 AA of LLO, and spliced together by conventional PCR techniques. To create a final plasmid, pVS16.5, the hly-PEST-E7 fragment and the prfA gene were subcloned into the plasmid pAM401, which includes a chloramphenicol resistance gene for selection in vitro, and the resultant plasmid was used to transform XFL-7.
Lm-ΔPEST-E7 is a recombinant Listeria strain that is identical to Lm-LLO-E7 except that it lacks the PEST sequence. It was made essentially as described for Lm-PEST-E7, except that the episomal expression system was constructed using primers designed to remove the PEST-containing region (bp 333-387) from the hly-E7 fusion gene. Lm-E7epi is a recombinant strain that secretes E7 without the PEST region or LLO. The plasmid used to transform this strain contains a gene fragment of the hly promoter and signal sequence fused to the E7 gene. This construct differs from the original Lm-E7, which expressed a single copy of the E7 gene integrated into the chromosome. Lm-E7epi is completely isogenic to Lm-LLO-E7, Lm-PEST-E7, and Lm-ΔPEST-E7 except for the form of the E7 antigen expressed.
Construction of Lm-actA-E7Lm-actA-E7 is a recombinant strain of LM, comprising a plasmid that expresses the E7 protein fused to a truncated version of the actA protein. Lm-actA-E7 was generated by introducing a plasmid vector pDD-1 constructed by modifying pDP-2028 into LM. pDD-1 comprises an expression cassette expressing a copy of the 310 bp hly promoter and the hly signal sequence (ss), which drives the expression and secretion of actA-E7; 1170 bp of the actA gene that comprises 4 PEST sequences (SEQ ID No: 16) (the truncated ActA polypeptide consists of the first 390 AA of the molecule, SEQ ID No: 15); the 300 bp HPV E7*gene; the 1019 bp prfA*gene (controls expression of the virulence genes); and the CAT gene (chloramphenicol resistance gene) for selection of transformed bacteria clones. (
The hly promoter (pHly) and gene fragment were PCR amplified from pGG-55 (Example 1) using the primers 5′-GGGGTCTAGACCTCCTTTGATTAGTATATTC-3′ (Xba I site is underlined; SEQ ID NO: 46) and 5′-ATCTTCGCTATCTGTCGCCGCGGCGCGTGCTTCAGTTTGTTGCGC-′3 (Not I site is underlined; the first 18 nucleotides are the ActA gene overlap; SEQ ID NO: 47). The actA gene was PCR amplified from the LM 10403s wildtype genome using primer 5′-GCGCAACAAACTGAAGCAGCGGCCGCGGCGACAGATAGCGAAGAT-3′ (NotI site is underlined; SEQ ID NO: 48) and primer 5′-TGTAGGTGTATCTCCATGCTCGAGAGCTAGGCGATCAATTTC-3′ (XhoI site is underlined; SEQ ID NO: 49). The E7 gene was PCR amplified from pGG55 (pLLO-E7) using primer 5′-GGAATTGATCGCCTAGCTCTCGAGCATGGAGATACACCTACA-3′ (XhoI site is underlined; SEQ ID NO: 50) and primer 5′-AAACGGATTTATTTAGATCCCGGGTTATGGTTTCTGAGAACA-3′ (XmaI site is underlined; SEQ ID NO: 51). The prfA gene was PCR amplified from the LM 10403s wild-type genome using primer 5′-TGTTCTCAGAAACCATAACCCGGGATCTAAATAAATCCGTTT-3′ (XmaI site is underlined; SEQ ID NO: 52) and primer 5′-GGGGGTCGACCAGCTCTTCTTGGTGAAG-3′ (SalI site is underlined; SEQ ID NO: 53). The hly promoter was fused to the actA gene (pHly-actA) was PCR generated and amplified from purified pHly DNA and purified actA DNA using the upstream pHly primer (SEQ ID NO: 46) and downstream actA primer (SEQ ID NO: 49).
The E7 gene fused to the prfA gene (E7-prfA) was PCR generated and amplified from purified E7 DNA and purified prfA DNA using the upstream E7 primer (SEQ ID NO: 50) and downstream prfA gene primer (SEQ ID NO: 53).
The pHly-actA fusion product fused to the E7-prfA fusion product was PCR generated and amplified from purified fused pHly-actA DNA product and purified fused E7-prfA DNA product using the upstream pHly primer (SEQ ID NO: 46) and downstream prfA gene primer (SEQ ID NO: 53) and ligated into pCRII (Invitrogen, La Jolla, Calif.). Competent E. coli (TOP10'F, Invitrogen, La Jolla, Calif.) were transformed with pCRII-ActAE7. After lysis and isolation, the plasmid was screened by restriction analysis using BamHI (expected fragment sizes 770 bp and 6400 bp (or when the insert was reversed into the vector: 2500 bp and 4100 bp)) and BstXI (expected fragment sizes 2800 bp and 3900 bp) and also screened with PCR analysis using the upstream pHly primer (SEQ ID NO: 46) and the downstream prfA gene primer (SEQ ID NO: 53).
The pHly-ActA-E7-PrfA DNA insert was excised from pCRII by double digestion with Xba I and Sal I and ligated into pDP-2028 also digested with Xba I and Sal I. After transforming TOP10′F competent E. coli (Invitrogen, La Jolla, Calif.) with expression system pActAE7, chloramphenicol resistant clones were screened by PCR analysis using the upstream pHly primer (SEQ ID NO: 46) and the downstream PrfA gene primer (SEQ ID NO: 53). A clone carrying pHly-ActA-E7 was grown in brain heart infusion medium with 20 mcg (microgram)/ml(milliliter) chloramphenicol (Difco, Detroit, Mich.), and pActAE7 was isolated from the bacteria cell using a midiprep DNA purification system kit (Promega, Madison, Wis.). Penicillin-treated Listeria strain XFL-7 was transformed with pActAE7, and clones were selected for the retention of the plasmid in vivo. Clones were grown in brain heart infusion with chloramphenicol (20 mcg/ml) at 37° C. Bacteria were frozen in aliquots at −80° C.
ResultsTo compare the anti-tumor immunity induced by Lm-ActA-E7 versus Lm-LLO-E7, 2×105 TC-1 tumor cells were implanted subcutaneously in mice and allowed to grow to a palpable size (approximately 5 millimeters [mm]). Mice were immunized i.p. with one LD50 of either Lm-ActA-E7 (5×108 CFU), (crosses) Lm-LLO-E7 (108 CFU) (squares) or Lm-E7 (106 CFU) (circles) on days 7 and 14. By day 26, all of the animals in the Lm-LLO-E7 and Lm-ActA-E7 were tumor free and remained so, whereas all of the naive animals (triangles) and the animals immunized with Lm-E7 grew large tumors (
In addition, Lm-LLO-E7, Lm-PEST-E7, Lm-ΔPEST-E7, and Lm-E7epi were compared for their ability to cause regression of E7-expressing tumors. S.c. TC-1 tumors were established on the left flank of 40 C57BL/6 mice. After tumors had reached 4-5 mm, mice were divided into 5 groups of 8 mice. Each groups was treated with 1 of 4 recombinant LM vaccines, and 1 group was left untreated. Lm-LLO-E7 and Lm-PEST-E7 induced regression of established tumors in 5/8 and 3/8 cases, respectively. There was no statistical difference between the average tumor size of mice treated with Lm-PEST-E7 or Lm-LLO-E7 at any time point. However, the vaccines that expressed E7 without the PEST sequences, Lm-ΔPEST-E7 and Lm-E7epi, failed to cause tumor regression in all mice except one (
500 mcl (microliter) of MATRIGEL®, comprising 100 mcl of 2×105 TC-1 tumor cells in phosphate buffered saline (PBS) plus 400 mcl of MATRIGEL® (BD Biosciences, Franklin Lakes, N.J.) were implanted subcutaneously on the left flank of 12 C57BL/6 mice (n=3). Mice were immunized intraperitoneally on day 7, 14 and 21, and spleens and tumors were harvested on day 28. Tumor MATRIGELs were removed from the mice and incubated at 4° C. overnight in tubes containing 2 milliliters (ml) of RP 10 medium on ice. Tumors were minced with forceps, cut into 2 mm blocks, and incubated at 37° C. for 1 hour with 3 ml of enzyme mixture (0.2 mg/ml collagenase-P, 1 mg/ml DNAse-1 in PBS). The tissue suspension was filtered through nylon mesh and washed with 5% fetal bovine serum+0.05% of NaN3 in PBS for tetramer and IFN-gamma staining.
Splenocytes and tumor cells were incubated with 1 micromole (mcm) E7 peptide for 5 hours in the presence of brefeldin A at 107 cells/ml. Cells were washed twice and incubated in 50 mcl of anti-mouse Fc receptor supernatant (2.4 G2) for 1 hour or overnight at 4° C. Cells were stained for surface molecules CD8 and CD62L, permeabilized, fixed using the permeabilization kit Golgi-Stop® or Golgi-Plug® (Pharmingen, San Diego, Calif.), and stained for IFN-gamma. 500,000 events were acquired using two-laser flow cytometer FACSCalibur and analyzed using Cellquest Software (Becton Dickinson, Franklin Lakes, N.J.). Percentages of IFN-gamma secreting cells within the activated (CD62Llow) CD8+ T cells were calculated.
For tetramer staining, H-2Db tetramer was loaded with phycoerythrin (PE)-conjugated E7 peptide (RAHYNIVTF, SEQ ID NO: 24), stained at rt for 1 hour, and stained with anti-allophycocyanin (APC) conjugated MEL-14 (CD62L) and FITC-conjugated CD8β at 4° C. for 30 min. Cells were analyzed comparing tetramer+ CD8+ CD62Llow cells in the spleen and in the tumor.
ResultsTo analyze the ability of Lm-ActA-E7 to enhance antigen specific immunity, mice were implanted with TC-1 tumor cells and immunized with either Lm-LLO-E7 (1×107 CFU), Lm-E7 (1×106 CFU), or Lm-ActA-E7 (2×108 CFU), or were untreated (naïve). Tumors of mice from the Lm-LLO-E7 and Lm-ActA-E7 groups contained a higher percentage of IFN-gamma-secreting CD8+ T cells (
In another experiment, tumor-bearing mice were administered Lm-LLO-E7, Lm-PEST-E7, Lm-ΔPEST-E7, or Lm-E7epi, and levels of E7-specific lymphocytes within the tumor were measured. Mice were treated on days 7 and 14 with 0.1 LD50 of the 4 vaccines. Tumors were harvested on day 21 and stained with antibodies to CD62L, CD8, and with the E7/Db tetramer. An increased percentage of tetramer-positive lymphocytes within the tumor were seen in mice vaccinated with Lm-LLO-E7 and Lm-PEST-E7 (
Thus, Lm-LLO-E7, Lm-ActA-E7, and Lm-PEST-E7 are each efficacious at induction of tumor-infiltrating CD8+ T cells and tumor regression.
Example 7: Creation and Verifcation of Listeria-LLO-PSA Constructs Materials and Experimental Methods Subcloning of LLO-PSAA truncated PSA open reading frame (GenBank Accession Number NM_001648), lacking its secretory signal sequence, the first 24 AA, was amplified using the primers: Adv60-PSA(XhoI-no ATG)F: gtgCTCGAGattgtgggaggctgggagtg (SEQ ID No: 58) and Adv61-PSA(SpeI-Stop)R: gatACTAGTttaggggttggccacgatgg (SEQ ID No: 59) and was subcloned in-frame with the first 441 amino acids of LLO (
There is one AA difference between this PSA and the sequence in NM_001648, at position N 221 Y). pGG55-LLO-PSA was electroporated into L. monocytogenes XFL-7 (Example 1).
Growth and Storage of Bacterial Vaccine StrainsRecombinant Listeria-PSA was grown in an animal product free medium (Modified Terrific Broth), in the presence of 34 μg/ml chloramphenicol and 250 μg/ml streptomycin at 37° C. in a shaker incubator. After reaching an optical density (OD600) of 0.5, which indicated a logarithmic growth phase, bacteria were collected by centrifugation, and the pellet was washed 2 times in Phosphate Buffered Saline (PBS) and resuspended in PBS containing 2% glycerol, then aliquoted and stored at −80° C. One aliquot was thawed 1 day later and titrated to determine bacterial titer (Colony Forming Units/ml). Listeria vaccines stored in this manner are stable for up to 1 year. These aliquots were then thawed, diluted at 1×107 CFU/dose and used for the immunogenicity studies as follows.
Verification of Expression and Secretion of LLO-PSAFour colonies of Lm-PSA were grown in Brain Heart infusion broth in the presence of 34 μg/ml chloramphenicol for 8 hours. Proteins in the culture broth were precipitated with 10% TCA, separated by SDS-PAGE, transferred to PVDF membranes, and blotted as indicated in the legend to
Lm-PSA was grown and passaged for 7 consecutive days in modified terrific broth containing 34 μg/ml chloramphenicol. Plasmid DNA was purified from the bacteria at different time points during passaging and tested for integrity and the presence of PSA gene by amplification of PSA gene by PCR or EcoRI/HindIII restriction mapping of the plasmid.
ResultsA Listeria strain was created that expresses a non-hemolytic LLO fused to a truncated PSA (kallikrein-related peptidase 3). The resulting recombinant Listeria strain secretes a protein of the predicted size for LLO-PSA (75 Kd), which is detected by both anti-LLO and anti-PSA antibodies, showing that LLO-PSA protein was expressed and secreted (
To test the in vitro stability of Lm-PSA, the strain was grown and passaged for 7 consecutive days in modified terrific broth. After this time, the bacteria retained the plasmid, the plasmid contained the PSA gene and there were no deletions or re-arrangements in the plasmid, indicating plasmid stability (
To test the in vivo stability of Lm-PSA, the strain was passaged twice through mice. The plasmid was then sequenced by Genewiz™ and found to have the following sequence:
The sequence matches exactly the predicted sequence of the PSA cloned into pGG55. LLO-PSA open reading frame is underlined; lower case letters indicate the sequence of PSA alone.
Example 8: Listeria-LLO-PSA Constructs Elicit Antigen-Specific Cytotoxic T Lymphocytes Materials and Experimental Methods CTL AssaysMale C57BL/6 mice were immunized i.p. with either 0.1 LD50 of Lm-PSA or 0.1 LD50 of Lm-HPV16E7E6TM and boosted 1 time after 2 weeks. Spleens were harvested 6 days after the boost. Isolated splenocytes were prepared and stimulated for 5 days with mitomycin-treated, PSA-vaccinia infected, MC57G cells as feeders. In the first experiment, a CTL assay was performed using PSA H2Db peptide (1 μM, HCIRNKSVIL; SEQ ID No: 60)-pulsed EL4 cells as targets labeled with 100 μM of europium (Sigma), using the following E:T ratios: 25:1, 8:1, 2.8:1, 0.9:1, 0.3:1, 0.1:1 and 0.03:1. After 4 hour incubation of mixed targets and effectors, cells were separated from the culture supernatant by centrifugation. Released europium from lysed cells in the supernatant was determined as follows: 10 μl of the supernatant was added to 100 μl Europium enhancement solution (Delfia). Absorbance was read at 590 nm using Victor II spectrophotometer (Perkin Elmer). Maximum release of Europium was determined from the supernatant of labeled target cells with 1% triton X-100 and the spontaneous release was determined from the target cells incubated in the absence of effector cells. In the second experiment, E:T ratio was kept constant at 25:1, and the peptide concentrations was varied as indicated. Percent specific lysis was determined as [(experimental release −spontaneous release)/(maximum release −spontaneous release)]×100.
Cytokine Secretion AssaysMale C57BL/6 mice were immunized with either Lm-PSA or Listeria expressing different fragments of Wilm' s tumor antigen (negative control) or left un-immunized. Mice were boosted 1 time after two weeks and the spleens were harvested 6 days after the boost. Isolated splenocytes were prepared and stimulated in vitro overnight in the presence of 1 μM PSA H2Db peptide. IFN-γ secretion by isolated splenocytes was determined by ELISpot assay.
ResultsTo test the immunogenicity of LLO-PSA, 6-8 weeks old C57BL/6 mice (Jackson laboratories) were immunized i.p. with either Lm-PSA (0.1 LD50, 1×107 CFU/dose) or Lm-HPV16E7E6TM (negative control, 0.1 LD50, 1×106 CFU/dose) or left un-immunized. Splenocytes from vaccinated mice were tested for ability to recognize and lyse PSA peptide presenting cells in vitro in a CTL assay. Splenocytes from the immunized mice were able to recognize and lyse PSA-peptide pulsed tumor cells with high efficiency (
In additional assays, mice were immunized with Lm-PSA or strains expressing fragments of Wilm's tumor antigen (negative control), and cytokine secretion was determined, in response to incubation with the PSA peptide. Splenocytes from the vaccinated mice exhibited high levels of IFN-γ secretion (
Thus, PSA-expressing LM strains and LLO-PSA fusions are efficacious in the induction of antigen-specific CTL that are capable of target cell lysis and IFN-γ secretion. Accordingly, PSA-expressing LM strains and LLO-PSA fusions are efficacious in therapeutic and prophylactic vaccination against PSA-expressing prostate cancer.
Example 9: Listeria-LLO-PSA Constructs Provide Tumor Protection Materials and Experimental Methods Cell Culture, Materials, and ReagentsTRAMP-C1 mouse prostate adenocarcinoma cells derived from a C57BL/6 mouse prostate tumor was purchased from ATCC. This cell line is negative for PSA expression. Cells were maintained in Dulbecco's modified Eagle's medium with 4 mM L-glutamine adjusted to contain 1.5 g/L sodium bicarbonate and 4.5 g/L glucose supplemented with 0.005 mg/ml bovine insulin and 10 nM dehydroisoandrosterone, 90%; fetal bovine serum, 5%; Nu-Serum IV, 5%. The gene encoding the full-length human PSA protein, including its signal sequence, was subcloned into a pUV6/v5 plasmid (Invitrogen). After confirmation of the correct sequence, the plasmid was linearized and transfected into TRAMP-C1 cells using Lipofectamine 2000™ (Invitrogen). Positive clones were selected in the presence of 10 μg/ml blasticidin. Several stably expressing PSA clones were isolated and tested for the secretion of human PSA into the cell culture medium.
Subcutaneous Tumor InoculationTwo different clones of PSA-expressing TRAMP-C1 cells were resuspended at 5×106 cells per 200 mcl dose. Male C57BL/6 mice (8 per group, 6-8 weeks old) were inoculated s.c. in the left flank.
Tumor Regression Studies7 days after tumor inoculation, mice are immunized with either 0.1 LD50 of Lm-PSA (107 CFU), 0.1 LD50 of Lm-HPV16E7, or PBS. Two boosts are administered on days 15 and 25 post-tumor inoculation. Tumors are monitored for 90 days. Tumor size is defined as the mean of two perpendicular diameters.
Orthotopic Injection of Prostate Tumor CellsSix-week-old male C57BL/6 mice are anesthetized with 2% isoflurane. In a sterile field, a lower midline incision is made to access the prostate. The left lobe of the dorsal prostate is injected with 1×105 TRAMPC-1/PSA tumor cells from a single-cell suspension in PBS, using a 27-gauge needle fitted on a 50-0 Hamilton syringe. Mice are sutured, and sutures are removed 10 days after surgery. Seven days later, mice are immunized i.v. with Lm-PSA, LmHPV16E7 or PBS. Mice are sacrificed at different time points, prostates are removed surgically and weighed for determination of the tumor growth.
Tumor Protection StudiesC57BL/6 mice are immunized and boosted with Lm-PSA, LmHPV16E7, or PBS, as described in the previous Example. Seven days after the boost, mice are injected s.c. with 5×106 TRAMPC-1/PSA tumor cells. Growth of the tumors is monitored by measuring with a caliper for 90 days.
Inhibition of Prostate Cancer MetastasesFor orthotopic tumor inoculation, 8-10 week old C57BL/6 male mice (Jackson labs) are anesthetized with isoflurane. A low abdominal skin incision cranial to the prepucial glands is made, and the seminal vesicles are carefully exteriorized to expose the dorso-lateral prostate. Using a 29 gauge insulin syringe, 5×105 TRAMPC-1/PSA cells suspended in PBS are injected into the dorso-lateral prostate in a 20 μL volume. The seminal vesicles and prostate are held for one minute to allow the injected cells to settle into the gland and then gently replaced into the abdominal cavity. Body wall and skin wounds closed are closed with 5-0 PDS and 5-0 nylon, respectively.
Tumors are allowed to develop for 50 days. The primary tumor is removed during necropsy and fixed in formalin, and then paraffin embedded, sectioned and stained with H&E. Enlarged lymph nodes from the paralumbar region are visualized under surgical microscopy and then dissected out, fixed, embedded, and histologically analyzed for prostate cancer cells.
Tissue ImmunostainingFormalin-fixed prostate tumor tissues are paraffin embedded, sectioned, applied to Plus Slides™ (VWR Corp), and then stained using a Dako autostainer system. Slides are pre-treated with 3.0% hydrogen peroxide for 10 minutes, then rinsed and treated with a 10 μg/mL solution of proteinase K solution for 3 minutes to enhance antigen retrieval. Non-specific binding sites are blocked by addition of normal goat serum for 30 minutes, and then a 10 μg/mL solution of rabbit anti-human PSA antibody (Sigma) or rabbit anti-human Proliferating Cell Nuclear Antigen (AB15497, AbCam antibodies) is applied to the tissue for 30 minutes. Primary antibody is removed by washing, and appropriate horseradish peroxidase-labeled secondary antibody is applied for a 30-minute period and detected using NovaRed™ substrate (Vector Labs, Burlingame, Calif.) in an 8-minute incubation. Slides are counter-stained with hematoxylin before drying.
Cells from slides of primary and lymph node sections are scored as either positive or negative for human PSA. Four regions of each slide were randomly selected, and 20 cells from each region are scored. PSA staining in tumors is compared to lymph node metastases from the same mouse.
Listeria StrainsListeria vaccines are prepared and stored as described in the previous Example.
ResultsListeria vaccines described in the previous Example are used in tumor protection experiments in an orthotopic prostate carcinoma animal model. Mice are immunized with either Lm-PSA, LmHPV16E7, or PBS, then injected with TRAMPC-1 Lm-PSA protects mice from tumor formation.
In additional experiments, mice are first injected with TRAMPC-1/PSAprostate cancer cells, vaccinated with Lm-PSA, LmHPV16E7, or PBS 4 days later, and boosted with the same vaccine. Lm-PSA impedes growth of prostate metastases.
Thus, PSA-producing LM strains and LLO-PSA fusions induce tumor protection.
Example 10: Listeria-LLO-Folate Hydrolase 1 (FOLH1) Constructs Elicit Antigen-Specific Cytotoxic T Lymphocytes Materials and Experimental Methods Growth and Storage of Bacterial Vaccine StrainsRecombinant Listeria-LLO-FOLH1 is grown and maintained as described for Listeria-PSA in Example 7 above.
ResultsA gene encoding a truncated FOLH1, which contains the complete open reading frame of FOLH1, except for its secretion signal sequence, is fused to a gene encoding a truncated non-hemolytic fragment of Listeriolysin 0, in a similar manner to that described for KLK3 in Example 7 above. The gene is cloned into Listeria plasmid pGG55 and electroporated into LM XFL-7. LLO-FOLH1 protein is thus expressed and secreted episomally from this recombinant Listeria strain.
To test the immunogenicity of LLO-FOLH1, mice re immunized with either Lm-LLO-FOLH1 or LmWT1A (irrelevant antigen control) or PBS (negative control), as described for LLO-KLK3 in Example 7 above. Following culture with vaccinia-PSA infected stimulator cells with for 5 days, splenocytes from the vaccinated mice are able to recognize and lyse FOLH1-peptide pulsed tumor cells with high efficiency in a CTL assay. In addition, the splenocytes exhibit high levels of IFN-γ secretion, in response to incubation with the FOLH1 peptide.
Thus, FOLH1-expressing LM strains and LLO-FOLH1 fusions are efficacious in the induction of antigen-specific CTL that are capable of target cell lysis and IFN-γ secretion. Accordingly, FOLH1-expressing LM strains and LLO-FOLH1 fusions are efficacious in therapeutic and prophylactic vaccination against PSA-expressing prostate cancer.
Example 11: Listeria-LLO-FOLH1 Constructs Provide Tumor ProtectionListeria vaccines described in the previous Example are used in tumor protection experiments in the orthotopic prostate carcinoma animal model described in Example 9 above. Mice are immunized with either Lm-FOLH1, LmWT1A, or PBS, then injected with PC3M-LN4 or 22Rv1 cells. Lm-FOLH1 protects mice from tumor formation.
In additional experiments, mice are first injected with PC-3M prostate cancer cells, as described for Example 9 above, vaccinated with Lm-FOLH1, LmWT1A, or PBS 4 days later, and boosted with the same vaccine. Lm-FOLH1 impedes growth of prostate metastases.
Thus, FOLH1-producing LM strains and Lm-FOLH1 fusions induce tumor protection.
Claims
1. A recombinant Listeria strain expressing a folate hydrolase 1 (FOLH1) peptide, wherein either (a) the sequence of said FOLH1 peptide is a sequence selected from the group consisting of SEQ ID No: 41, 43, 44, and 45; or (b) said FOLH1 peptide is an immunogenic fragment of a larger FOLH1 peptide, wherein the sequence of said larger FOLH1 peptide is selected from the group consisting of SEQ ID No: 41, 43, 44, and 45.
2. The recombinant Listeria strain of claim 1, wherein said FOLH1 peptide is in the form of a fusion peptide, wherein said fusion peptide further comprises a non-FOLH1 peptide, wherein said non-FOLH1 peptide enhances the immunogenicity of said fragment.
3. The recombinant Listeria strain of claim 1, wherein said non-FOLH1 peptide is selected from the group consisting of a listeriolysin (LLO) peptide, an ActA peptide, and a PEST-like sequence peptide.
4. The recombinant Listeria strain of claim 1, wherein said FOLH1 peptide does not contain an FOLH1 signal sequence.
5. An immunogenic composition comprising the recombinant Listeria strain of claim 1 and an adjuvant.
6. The recombinant Listeria strain of claim 1, wherein said recombinant Listeria strain is a recombinant Listeria monocytogenes strain.
7. The recombinant Listeria strain of claim 1, wherein said recombinant Listeria strain has been passaged through an animal host.
8. The recombinant Listeria strain of claim 1, wherein said Listeria strain is an auxotrophic Listeria strain.
9. The recombinant Listeria strain of claim 8, wherein said auxotrophic Listeria strain is a dal/dat mutant.
10. The recombinant Listeria strain of claim 9, wherein said auxotrophic Listeria strain comprises an episomal expression vector comprising a metabolic enzyme that complements the auxotrophy of said auxotrophic Listeria strain.
11. The recombinant Listeria strain of claim 10, wherein said auxotrophic Listeria further comprises a deletion in the endogenous actA gene.
12. The recombinant Listeria strain of claim 10, wherein said metabolic enzyme is an alanine racemase enzyme.
13. The recombinant Listeria strain of claim 10, wherein said metabolic enzyme is a D-amino acid transferase enzyme.
14. A method of inducing an anti-FOLH1 immune response in a subject, comprising administering to said subject a composition comprising the recombinant Listeria strain of claim 1, thereby inducing an anti-FOLH1 immune response in a subject.
15. A method of treating a folate hydrolase 1 (FOLH1)-expressing prostate cancer in a subject, the method comprising the step of administering to said subject a composition comprising the recombinant Listeria strain of claim 1, whereby said subject mounts an immune response against said FOLH1 protein-expressing prostate cancer, thereby treating an FOLH1 protein-expressing prostate cancer in a subject.
16. A method of protecting a human subject against a folate hydrolase 1 (FOLH1) protein-expressing prostate cancer, the method comprising the step of administering to said human subject a composition comprising the recombinant Listeria strain of claim 1, whereby said subject mounts an immune response against said FOLH1 protein, thereby protecting a human subject against an FOLH1 protein-expressing prostate cancer.
17. A recombinant polypeptide comprising a folate hydrolase 1 (FOLH1) peptide operatively linked to a non-FOLH1 peptide, wherein said non-FOLH1 peptide is selected from the group consisting of a listeriolysin (LLO) peptide, an ActA peptide, and a PEST-like amino acid sequence.
18. An immunogenic composition comprising the recombinant polypeptide of claim 17 and an adjuvant.
19. A nucleotide molecule encoding the recombinant polypeptide of claim 17.
20. An immunogenic composition comprising the nucleotide molecule of claim 20 and an adjuvant.
21. A recombinant vector comprising the nucleotide molecule of claim 19.
22. A method of inducing an anti-FOLH1 immune response in a subject, comprising administering to said subject an immunogenic composition comprising the recombinant polypeptide of claim 17, thereby inducing an anti-FOLH1 immune response in a subject.
23. A method of treating an FOLH1 protein-expressing prostate cancer in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising the recombinant polypeptide of claim 17, whereby said subject mounts an immune response against said FOLH1 protein-expressing prostate cancer, thereby treating an FOLH1 protein-expressing prostate cancer in a subject.
24. A method of protecting a human subject against an FOLH1 protein-expressing prostate cancer, the method comprising the step of administering to said human subject an immunogenic composition comprising the recombinant polypeptide of claim 17, whereby said subject mounts an immune response against said FOLH1 protein, thereby protecting a human subject against an FOLH1 protein-expressing prostate cancer.
25. A method of inducing an anti-FOLH1 immune response in a subject, comprising administering to said subject an immunogenic composition comprising the nucleotide molecule of claim 19, thereby inducing an anti-FOLH1 immune response in a subject.
26. A method of treating an FOLH1 protein-expressing prostate cancer in a subject, the method comprising the step of administering to said subject an immunogenic composition comprising the nucleotide molecule of claim 19, whereby said subject mounts an immune response against said FOLH1 protein-expressing prostate cancer, thereby treating an FOLH1 protein-expressing prostate cancer in a subject.
27. A method of protecting a human subject against an FOLH1 protein-expressing prostate cancer, the method comprising the step of administering to said human subject an immunogenic composition comprising the nucleotide molecule of claim 19, whereby said subject mounts an immune response against said FOLH1 protein, thereby protecting a human subject against an FOLH1 protein-expressing prostate cancer.
28. A recombinant Listeria strain expressing: a kallikrein-related peptidase 3 (KLK3) peptide, wherein the sequence of the KLK3 peptide comprises a sequence selected from the sequences set forth in SEQ ID NO: 27, 29-32, 34, and 36-39, or a sequence greater than 97% identical thereto, wherein the KLK3 peptide is in the form of a fusion peptide and further comprises a non-KLK3 peptide, wherein the non-KLK3 peptide is selected from an ActA peptide and a PEST-like sequence peptide and wherein the non-KLK3 enhances the immunogenicity of the fusion peptide.
29. The recombinant Listeria strain of claim 28, wherein said ActA peptide comprises a sequence selected from the sequences set forth in SEQ ID NO: 1-5, 14, 15 or 61, or a sequence greater than 97% identical thereto.
30. The recombinant Listeria strain of claim 28, wherein the KLK3 peptide does not contain a KLK3 signal sequence.
31. The recombinant Listeria strain of claim 28, wherein the KLK3 peptide contains a KLK3 signal sequence.
32. The recombinant Listeria strain of claim 28, wherein the recombinant Listeria strain is an auxotrophic Listeria or a recombinant Listeria monocytogenes strain.
33. The recombinant Listeria strain of claim 28, wherein the auxotrophic Listeria strain is a dal/dat mutant and further comprises a deletion in the endogenous ActA gene.
34. The recombinant Listeria strain of claim 32, wherein the auxotrophic Listeria strain comprises an episomal expression vector comprising a metabolic enzyme that complements the auxotrophy of the auxotrophic Listeria strain.
35. The recombinant Listeria strain of claim 34, wherein the metabolic enzyme is an alanine racemase enzyme or a D-amino acid transferase enzyme.
36. The recombinant Listeria strain of claim 28, wherein the recombinant Listeria strain has been passaged through an animal host.
37. A recombinant polypeptide comprising a kallikrein-related peptidase 3 (KLK3) peptide operatively linked to a non-KLK3 peptide, wherein the sequence of the KLK3 peptide comprises a sequence selected from the sequences set forth in SEQ ID NO: 27, 29-32, 34, and 36-39, or a sequence greater than 97% identical thereto; wherein the non-KLK3 peptide is selected from an ActA peptide, and a PEST-like amino acid sequence.
38. The recombinant polypeptide of claim 37, wherein said ActA peptide comprises a sequence selected from the sequences set forth in SEQ ID NO: 1-5, 14, 15 or 61, or a sequence greater than 97% identical thereto.
39. A nucleotide molecule encoding the recombinant polypeptide of claim 37.
40. An immunogenic composition comprising the recombinant Listeria strain of claim 28.
41. An immunogenic composition comprising the recombinant polypeptide of claim 37.
42. An immunogenic composition comprising the recombinant the nucleotide molecule of claim 39, and an adjuvant.
43. A recombinant vector comprising the nucleotide molecule of claim 39.
44. A method of producing the recombinant polypeptide of claim 37, the method comprising the step of chemically conjugating a polypeptide comprising the KLK3 peptide to a polypeptide comprising the non-KLK3 peptide wherein the non-KLK3 peptide is selected from an ActA peptide and a PEST-like sequence peptide.
45. A method of inducing an anti-KLK3 immune response in a subject, comprising administering to the subject the recombinant Listeria strain of claim 28.
46. A method of inducing an anti-KLK3 immune response in a subject the immunogenic composition comprising the recombinant polypeptide of claim 39.
47. A method of treating a kallikrein-related peptidase 3 (KLK3)-expressing prostate cancer in a subject, comprising administering to the subject the recombinant Listeria strain of claim 28.
48. A method of treating a kallikrein-related peptidase 3 (KLK3)-expressing prostate cancer in a subject, comprising administering the recombinant polypeptide of claim 37.
49. A method of protecting a human subject against a kallikrein-related peptidase 3 (KLK3)-expressing prostate cancer, comprising administering to the subject the recombinant Listeria strain of claim 28.
50. A method of protecting a human subject against a kallikrein-related peptidase 3 (KLK3)-expressing prostate cancer, comprising administering to the subject the recombinant polypeptide of claim 37.
Type: Application
Filed: Dec 22, 2016
Publication Date: Apr 13, 2017
Applicants: THE TRUSTEES OF THE UNIVERSITY OF PENNSYLVANIA (Philadelphia, PA), ADVAXIS, INC. (Princeton, NJ)
Inventors: Yvonne PATERSON (Philadelphia, PA), John ROTHMAN (Lebanon, NJ), Vafa SHAHABI (Valley Forge, PA)
Application Number: 15/388,503