Abstract: Anti-human IL20 monoclonal antibodies that can reduce IL20 mediated activation of both IL20R1/IL20R2 and IL22R1/IL20R2 receptor complexes in one or more species, including humans, are described, as well as antigen-binding molecules such as, e.g., antigen-binding antibody fragments, antibody derivatives, and multi-specific molecules designed or derived from such antibodies, and methods or producing such antibodies or other antigen-binding molecules. Such antibodies or other antigen-binding molecules can be used for treating various diseases and disorders, including autoimmune or inflammatory diseases or disorders.

Abstract: The present invention encompasses methods and compositions for treating an ocular disease, disorder or condition in a mammal. The invention includes a population of mesenchymal stromal cells that possess anti-inflammatory, anti-apoptotic, immune modulatory and anti-tumorigenic properties. The invention includes administration of TSG-6, STC-1, or a combination thereof to the ocular as a treatment for an ocular disease, disorder or condition in a mammal.

Abstract: A method of selecting a genus of therapeutic antibodies includes selecting antibodies with the following criteria; a) do inhibit cell lysis under conditions wherein the alternative pathway is isolated from the classical pathway; and b) do not inhibit cell lysis under conditions wherein the classical pathway is isolated from the alternative pathway; and c) do not inhibit cell lysis under conditions wherein the classical pathway and alternative pathway are active; and d) do inhibit C3b produced exclusively by the alternative pathway;

Abstract: Human monoclonal antibodies that specifically bind to rabies virus, antigen binding portions thereof, and methods of making and using such antibodies and antigen binding portions thereof for treating rabies virus in a subject, are provided herein.

Abstract: The present invention relates to an anti-idiotypic polypeptide scaffold that includes two or more peptide sequences that mimic a discontinuous epitope of a pathogen that is recognized by or induces formation of a broadly neutralizing antibody. Using a fibronectin FNfn10 scaffold bearing two or more modified discontinuous loops, scaffolds that recognize broadly neutralizing antibodies in vitro and from patient serum have been identified. These scaffolds should induce an immune response or mobilize germline specificities to initiate their affinity maturation.

Abstract: The present invention features methods for reversing corticosteroid resistance, as well as for the treatment of respiratory infections, particularly those associated with chronic obstructive pulmonary disease. In one embodiment, the method increases Nrf2 biological activity or expression.

Abstract: The present invention relates, in general, to breast cancer and, in particular, to methods of treating breast cancer comprising administering to a subject in need thereof an agent that modulates signal transduction regulated by ?-arrestin (e.g., ?-arrestin 1). The invention further relates to methods of identifying compounds suitable for use in such methods.

Abstract: Described herein are materials and methods for identifying subjects that would benefit from Notch-targeted therapy.

Abstract: The present application provides the amino acid and nucleic acid sequences of heavy chain and light chain complementarity determining regions of a cancer specific antibody. In addition, the application provides cancer specific antibodies and immunoconjugates comprising the cancer specific antibody attached to a toxin or label, and methods and uses thereof. The application also relates to diagnostic methods and kits using the cancer specific antibodies disclosed herein. Further, the application provides novel cancer-associated epitopes and antigens, and uses thereof.

Abstract: Disclosed is a quickly soluble oral film dosage for masking a nasty taste, in particular, a quickly soluble oral film dosage comprising a stevioside based sweetener and a high potency sweetener in a ratio by weight (w/w) of 1:3 to 3:1, which may efficiently mask a bitter or nasty taste of a medicine and may be quickly dissolved in a mouth without water, thereby improving an aftertaste thereof thus enhancing dosage acceptability of a patient.

Abstract: Novel molecules termed STING which include nucleic acids, polynucleotides, oligonucleotides, peptides, mutants, variants and active fragments thereof, modulate innate and adaptive immunity in a subject. STING compositions are useful for the treatment of an immune-related disorder, including treating and preventing infection by modulating immunity.

Abstract: The methods and compositions described herein are based, in part, on the discovery of a polypeptide of soluble CD23 (sCD23) that binds and sequesters IgE. Thus, the sCD23 peptides, polypeptides and derivatives described herein are useful for treating conditions or disorders involving increased IgE levels such as e.g., allergy, anaphylaxis, inflammation, lymphoma, and certain cancers.

Abstract: The present invention is directed to variants of antigens comprising folate binding protein epitopes as a composition associated with providing immunity against a tumor in an individual. The variant is effective in inducing cytotoxic T-lymphocytes but preferably not to the extent that they become sensitive to silencing by elimination, such as by apoptosis, or by anergy, as in unresponsiveness.

Abstract: POTE has recently been identified as a tumor antigen expressed in a variety of human cancers, including colon, ovarian, breast, prostate, lung and pancreatic cancer. Described herein are immunogenic POTE polypeptides, including modified POTE polypeptides, that bind MHC class I molecules. The immunogenic POTE polypeptides are capable of inducing an immune response against POTE-expressing tumor cells. Thus, provided herein is a method of eliciting an immune response in a subject, such as a subject having a type of cancer that expresses POTE.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-4, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-4 that has the same length as the epitope: SEQ?ID?1 GDTWAGVEAIIRILQQLLFIHFRIGCQHSR SEQ?ID?2 KVGSLQYLALTALITPKKIKPPLPSVKKLTEDRWNKPQKT SEQ?ID?3 EPVPLQLPPLERLTLDCSEDCGTSGTQ SEQ?ID?4 YKGALDLSHFLKEKGGLEGLIYSQKRQDILDLWVYHTQGYFPD wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete HIV virus protein.

Abstract: This invention discloses a method of increasing production of virus-like particles comprising expressing an avian influenza matrix protein. The invention also comprises methods of making and using said VLPs.

Abstract: The present invention relates to new lipopeptide- and lipoprotein molecules and lipopeptide- and lipoprotein-conjugates. In particular, the present invention relates to new lipopeptide- and lipoprotein molecules and lipopeptide- and lipoprotein-conjugates comprising a lipid-containing moiety representing an adjuvant moiety, a peptide or protein moiety whereby said peptide or protein moiety represents at least one antigenic structure, the antigen-moiety, and, optionally, a conjugate moiety, preferably a monodisperse polyethyleneglycol unit. Said compounds are particularly useful for therapeutic or prophylactic vaccination by mucosal or systemic administration, preferably mucosal and systemic vaccination. That is, the present invention relates in another aspect to pharmaceutical compositions comprising the compounds according to the present invention, in particular, said pharmaceutical compositions are vaccines.

Abstract: A vaccine composition for therapeutic use thereof on cancer patients includes a chemical conjugate of human recombining Epidermic Growth Factor (hrEGF) and a combining protein P64k for performing a conjugation reaction which produces said chemical conjugate in a controlled and reproducible manner. The preferred conjugate surprisingly increases the immunogenic activity causing significant increases in the anti-EGF antibody titers in humans, and provides a vaccine preparation with more than one type of effective dose presentation which enables the immunization dose per patient to be increased, but without involving an increase in immunization frequency and/or the number of immunization sites.

Abstract: The present invention pertains to the use of Haemophilus parasuis bacteria of serotype 5 expressing an iron-restriction protein visible on a Western-blot when reacted with serum of a convalescent animal which has recovered from an infection by Haemophilus parasuis bacteria of serotype 4, the said protein not being visible on a Western-blot when Haemophilus parasuis bacteria of serotype 5 grown under iron-replete conditions, are reacted under the same conditions, in a vaccine to protect a subject animal against a disorder arising from Haemophilus parasuis serotype 4 bacteria.

Abstract: The present invention is drawn to compositions and methods to enhance an immune response in order to prevent or treat infections or hyperproliferative diseases such as cancer. More particularly, the composition is an immuno stimulator intracellular signaling peptide fused directly or indirectly to a peptide that leads to multimerization into complexes of three or more units, where the intracelluar signaling peptide must be present in a complex of three or more units in order to stimulate an immune response. Inserting this fusion construct into viruses like HIV-1 or introducing it into dendritic cells or tumor cells is predicted to lead to a positive therapeutic effect in humans, non-human mammals, birds, and fish.

Abstract: A method for inactivating an orthomyxovirus propagated in cell culture and/or inactivating contaminating adventitious agents, comprising at least the following steps: (a) treating an orthomyxovirus-containing fluid with an alkykating agent, and (b) irradiating the orthomyxovirus-containing fluid with UV light.

Abstract: Disclosed herein are compounds and related compositions for the treatment of viral infection, including RNA viral infection, and compounds that can modulate the RIG-I pathway in vertebrate cells, including compounds that can activate the RIG-I pathway.

Abstract: Disclosed herein are compounds and related compositions for the treatment of viral infection, including RNA viral infection, and compounds that can modulate the RIG-I pathway in vertebrate cells, including compounds that can activate the RIG-I pathway.

Abstract: Attenuated pestiviruses, in particular attenuated BVDV, wherein at least one mutation is in the coding sequence for glycoprotein Ems and at least another mutation in the coding sequence for Npro which preferably leads to combined inactivation of the RNase activity residing in glycoprotein Ems in addition to the inactivation of the (hypothesized) immunomodulating activity residing in Npro. Methods for attenuating pestiviruses such as BVDV, nucleic acids encoding the pestiviruses, in particular BVDV, compositions and vaccines comprising the attenuated pestiviruses, in particular BVDV, of the invention.

Abstract: The present application is generally directed to methods for identifying immunogens from organisms and pathogens, and in particular for identifying immunogens which when administered as vaccines elicit a cellular and/or humoral immune response. The present application is also directed to pneumococcal T-cell immunogens, and vaccine compositions comprising one or a combination of pneumococcal immunogens and methods for treating or preventing pneumococcal infections using the vaccines thereof. The present invention also encompasses use of the pneumococcal immunogens for diagnostic purposes to identify a subject with a pneumococcal infection.

Abstract: The present invention provides compositions comprising peptides derived from amino acid sequences (or from combinations thereof) of fusion and other protein regions of various viruses, including but not limited to, severe acute respiratory syndrome coronavirus, herpesvirus saimiri, human herpesvirus 6, Lassa virus, lymphocytic choriomeningitis virus, Mopeia virus, Tacaribe virus, Friend murine leukemia virus; human T lymphotropic virus type 1; herpesvirus ateles; Marburg virus; Sudan Ebola virus; Zaire Ebola virus, and comprising L- and/or D-amino acids and combinations thereof, which affect T cells by acting on the T cell antigen receptor (TCR). More specifically, the peptides act on the TCR??-CD3??-CD3??-?? signaling complex. Yet more specifically, the peptides act on the TCR?/CD3??/?? signaling module of TCR. The present invention further relates to the prevention and therapy of various T cell-related disease states involving the use of these compositions.

Abstract: Provided herein are compounds, compositions and methods for balancing a T-helper cell profile and in particular Th1, Th2, Th17 and Treg cell profiles, and related methods and compositions for treating or preventing an inflammatory condition associated with an imbalance of a T-helper cell profile.

Abstract: A nasal rinse composition comprising about 54 to 90 wt. % of sodium chloride and about 10 to 46 wt. % of sodium bicarbonate, and a kit comprising a packet that contains the rinse composition and a nasal rinse dispenser.

Abstract: Provided is a process for preparing a solubilized and stabilized formulation of a sirolimus derivative, which comprises the steps of a dissolving a sirolimus derivative in a solvent, and bring a solution of the sirolimus derivative into contact with a water-soluble carrier to disperse the sirolimus derivative in the water-soluble carrier, and a formulation of a sirolimus derivative with improved solubility and stability as prepared by the preparation process as above.

Abstract: Calcipotriol monohydrate nanocrystals prepared by the process disclosed herein may be incorporated in a pharmaceutical composition for use in the prevention or treatment of dermal diseases and conditions.

Abstract: A method for treating a surface with a therapeutic agent is disclosed. The method comprises precipitating a therapeutic agent from a hydrophilic polymeric base layer with which the therapeutic agent has been complexed, to form a layer comprising microparticles of the therapeutic agent on the hydrophilic polymeric base layer, the hydrophilic polymeric base layer being grafted to the surface. Devices comprising a surface having a hydrophilic polymeric base layer comprising a hydrophilic polymer grafted to the surface and a layer comprising microparticles of a therapeutic agent disposed on and complexed with the hydrophilic polymeric base layer are also disclosed.

Abstract: Disclosed are synthetic nanocarrier compositions that comprise B cell antigen for desired antibody production and an off-target response attenuating polymeric coating as well as related methods.

Abstract: An orally ingestible energy-boosting device is provided for facilitating a temporary metabolic increase in a user. The device comprises a small container filled with an energy-enhancing substance. All or a portion of the small container is constructed of a water or saliva-soluble film that dissolves when placed in the mouth of a user. When the film dissolves, energy-enhancing substance is released into the mouth where it is absorbed. The small container may come in a variety of shapes and configurations to meet the varied energy boost needs of users.

Abstract: The invention is directed to implants and medical devices having at least one layer which contains at least one nitrocarboxylic acid. These implants and medical devices shall be used for the prophylaxis and treatment of aggressive healing patterns. Furthermore, this invention relates to the use of nitrocarboxylic acids and their pharmaceutically acceptable salts as a therapeutic agent for the prophylaxis and treatment of a pathophysiological or non-physiological healing pattern due to exposure to a physical, chemical or thermal irritant of tissues, cells or organelles.

Abstract: The present invention relates to controlled release pharmaceutical compositions comprising Brivaracetam or its pharmaceutically acceptable derivatives thereof. Further disclosed is a controlled release pharmaceutical composition comprising a core and a coating surrounding the core, wherein the core comprises Brivaracetam or pharmaceutically acceptable derivative thereof and the coating comprises hydrophobic release controlling agent. The controlled release pharmaceutical composition comprises Brivaracetam or pharmaceutically acceptable derivatives thereof and hydrophobic release controlling agent, wherein said composition has dissolution of Brivaracetam at least 80% between about 7 to about 24 hours when measured in 900 ml of pH 6 phosphate buffer solution using USP apparatus type II, at 50 rpm and at 37° C.

Abstract: The present invention relates to improved methods for vaccination of a subject. Particularly, the present invention discloses the use of skin antigen application to amplify and improve a pre-existing immunity against a selected pathogen in a subject. The present invention discloses the use of skin application in combination with conventional vaccination or priming for improved immunization or vaccination of a subject against a selected pathogen.

Abstract: A method for blocking, neutralizing, or killing human immunodeficiency virus (HIV) beginning prior to or during a human encountering an HIV contaminated environment or item includes: identifying a contaminated environment or item that is known or expected to be contaminated with HIV; and administering an effective amount of a barrier-forming composition to an oral or pharyngeal mucosa of the human prior to or during the human encountering the contaminated environment or item. The barrier-forming composition provides a barrier on the mucosa that inhibits the HIV from contacting the mucosa, and provides cidal or static activity against HIV. A method for preventing the transmission of HIV through oral sexual relations, and a sexually transmitted disease prophylactic device are also provided.

Abstract: The present invention provides drug therapy formulations. In some embodiments, the present invention provides combinations of pharmaceutical agents (e.g., stimulant and non-stimulant), pharmaceutical formulations (e.g., nanoparticulate, non-nanoparticulate, etc.), and release profiles (e.g., immediate release, delayed release, sustained release, etc.) to provide therapeutic benefit with reduced side effects.

Abstract: A personal care composition is disclosed comprising abrasive particles. The personal care composition may take a variety of forms such as a leave-on composition or an emulsion and/or may comprise one or more actives or agents.

Abstract: The present application relates to encapsulates, compositions, products comprising such encapsulates, and processes for making and using such encapsulates. Such encapsulates comprise a core comprising a perfume and a shell that encapsulates said core, such encapsulates may optionally comprise a parametric balancing agent, such shell comprising one or more azobenzene moieties.

Abstract: A cosmetic composition in the form of an emulsion comprising at least one aqueous phase and at least one fatty phase, at least one superabsorbent polymer and at least one surfactant of formula (I): Wherein: R1 and R3 denote, independently of each other, an alkyl radical containing from 1 to 25 carbon atoms; R2 denotes a spacer formed from a linear or branched alkylene chain containing from 1 to 12 carbon atoms; X and Y denote, independently of each other, a group —(C2H4O)a—(C3H6O)bZ, in which Z denotes a hydrogen atom or a radical —CH2—COOM, —SO3M, —P(O)(OM)2, —C2H4—SO3M, —C3H6—SO3M or —CH2(CHOH)4CH2OH, in which M, M? represent H or an alkali metal, alkaline-earth metal, ammonium or alkanolammonium ion, a ranges from 0 to 15, b ranges from 0 to 10, and the sum of a+b ranges from 1 to 25; and n ranges from 1 to 10 is provided.

Abstract: The present invention provides composites comprising at least one bioactive agent entrapped within a matrix of at least one metal; wherein said composite controllably releases at least one of said bioactive agent and metal or ion thereof, processes for the preparation of composites of the invention, compositions and products comprising composites of the invention and various uses thereof.

Abstract: A coated granular material of the present invention includes: a water-soluble granular substance; a coating layer applied to at least a surface of the water-soluble granular substance and containing a thermosetting resin A formed from a resin liquid having a molar ratio A of isocyanate groups to hydroxyl groups of 0.5 to 0.99; and a protection layer applied to the coating layer and containing a thermosetting resin B formed from a resin liquid having a molar ratio B of isocyanate groups to hydroxyl groups of 0.75 to 2.0, wherein the molar ratio B of the protection layer is greater than the molar ratio A of the coating layer. The present coated granular material is capable of achieving both of a short-term release pattern and an initial release limiting function and maintaining good quality.

Abstract: Bone cages are disclosed including devices for biocompatible implantation. The structures of bone are useful for providing living cells and tissues as well as biologically active molecules to subjects.

Abstract: The invention relates to specific three layer dosage forms for oral administration of pharmaceutical active substances.

Abstract: The invention provides a novel method of generating fabrics with outstanding antitoxic properties. The antitoxic properties are imparted to the fabric by introducing an active agent such as an antimicrobial or antiviral agent to the fabric. The active agent may be introduced into the fabric at multiple stages of the manufacturing process. For nonwoven fabrics, the active agent can be introduced during web formation and/or during post-processing steps. The fabrics produced in accordance with the present invention have widespread utility. For instance, they can be used as wound dressings, gowns, drapes, air filters, protective clothing and wipes.

Abstract: There is provided pharmaceutical compositions for the treatment of rhinitis by, for example, nasal or ocular administration comprising zwitterionic cetirizine, a polar lipid liposome and a pharmaceutical acceptable aqueous carrier. The compositions are preferably homogeneous in their nature.

Abstract: Processes and compositions for liposomal delivery of therapeuticals prepared by contacting an aqueous solution of an active agent with a solution of liposome-forming components containing one or more DILA2 amino acid compounds or lipids in organic solvent to form an impinging stream. A protocol including flow rates, pH, and an incubation period are used to control formation of liposomal components for therapeutic applications. The impinging stream may be collected and incubated to prepare a liposomal formulation which encapsulates the active agent. The composition can be quenched with buffer and filtered by tangential flow and diafiltration and other means for finishing as a pharmaceutical composition.

Abstract: Disclosed herein are siRNA compositions and methods useful for inhibiting expression of vascular endothelial growth factor (VEGF) isoforms. Diseases which involve angiogenesis stimulated by overexpression of VEGF, such as diabetic retinopathy, age related macular degeneration and many types of cancer, can be treated by administering small interfering RNAs as disclosed.

Abstract: The present invention concerns compositions comprising and methods of identification and use of targeting peptides for placenta or adipose tissue. In certain embodiments, the targeting peptides comprise part or all of SEQ ID NO:5-11, SEQ ID NO:13-22 or SEQ ID NO:144. The peptides may be attached to various therapeutic agents for targeted delivery. Adipose-targeting peptides may be used in methods for weight control, inducing weight loss and treating lipodystrophy syndrome. Adipose-targeting may also be accomplished using other binding moieties selectively targeted to adipose receptors, such as a prohibitin receptor protein complex. Placenta-targeting peptides may be used to interfere with pregnancy, induce labor and/or for targeted delivery of therapeutic agents to placenta and/or fetus. In other embodiments, receptors identified by binding to placenta-targeting peptides may be used to screen compounds for potential teratogenicity.