Abstract: The present invention provides compositions that include an extract of human feces, and methods for using such compositions, including methods for replacing or supplementing or modifying a subject's colon microbiota, and methods for treating a disease, pathological condition, and/or iatrogenic condition of the colon.

Abstract: A method for preparing placenta membrane tissue grafts for medical use, includes obtaining a placenta from a subject, cleaning the placenta, separating the chorion tissue from the amniotic membrane, mounting a selected layer of either the chorion tissue or the amniotic membrane onto a drying fixture, dehydrating the selected layer on the drying fixture, and cutting the selected layer into a plurality of tissue grafts. Preferably, the drying fixture includes grooves or raised edges that define the outer contours of each desired tissue graft, after they are cut, and further includes raised or indented logos that emboss the middle area of the tissue grafts during dehydration and that enables an end user to distinguish the top from the bottom side of the graft. The grafts are comprised of single layers of amnion or chorion, multiple layers of amnion or chorion, or multiple layers of a combination of amnion and chorion.

Abstract: The invention provides a particle consisting essentially of micronized ESM and having a mean particle diameter of less than 100 ?m for use in promoting the healing of a chronic wound at risk of, or in which there is, (i) an inappropriate level of matrix-metalloproteinase (MMP) activity against extracellular matrix (ECM) proteins and/or peptide growth or differentiation factors, and/or (ii) an excessive inflammatory response. The invention further provides pharmaceutical compositions, wound dressings and implantable medical devices comprising the micronized ESM-containing particles for use in said treatments. The invention still further provides methods for manufacturing the micronized ESM-containing particles and the compositions, dressings and implantable medical devices comprising the same.

Abstract: The present invention relates to an agent for effectively suppressing an increase in a blood acetaldehyde level. More specifically, the present invention relates to an alcohol metabolism promoter comprising glycogen obtained from a Veneroida bivalve.

Abstract: An improved method for the manufacture of a medicament, which method includes the use of tissues, larval forms or derivatives of insects that have been

Abstract: Provided are a prophylactic or therapeutic agent for a peptic ulcer, a food additive for prevention and treatment of a peptic ulcer, an iNOS expression inhibitor, and a COX-2 expression inhibitor, all of which have little side effects. The prophylactic or therapeutic agent contains a Euglena-derived material as an active ingredient. The Euglena-derived material may be Euglena, paramylon, or an acid-treated paramylon. The prophylactic or therapeutic agent is useful for the prevention or treatment of a peptic ulcer induced by psychological stress. The peptic ulcer may be a gastric ulcer. The food additive contains a Euglena-derived material as an active ingredient.

Abstract: A media supplement for culturing anaerobic bacteria is provided which comprises a filtrate of effluent from a chemostat vessel in which a target bacterial ecosystem has been cultured. Methods of using the supplement for culturing or isolating anaerobic microbial strains or communities, particularly anaerobic bacteria from the human gut, are also provided.

Abstract: The invention provides compositions comprising bacterial strains for treating and preventing inflammatory and autoimmune diseases.

Abstract: The present invention comprises methods and composition for control of plant pathogens. Isolated bacteria, deposited with ATCC under the Budapest Treaty, are effective to control plant pathogens.

Abstract: A food composition for alleviating hangovers, the food composition contains, as an active ingredient, at least one strain selected from the group consisting of Lactococcus chungangensis, Lactococcus fujiensis, Lactococcus lactis subsp. cremoris, Lactococcus lactis subsp. lactis, and Lactococcus raffinolactis, or a culture liquid thereof culture medium, wherein functional cream cheese is prepared using five species of Lactococcus strains above having the ability to decompose ethanol and acetaldehyde.

Abstract: The present invention relates to bacteriophage therapy. More particularly, the present invention relates to novel bacteriophages having a high specificity against Pseudomonas aeruginosa strains, their manufacture, components thereof, compositions comprising the same and the uses thereof in phage therapy.

Abstract: A method of treating cancer in a subject is disclosed, the method comprising administration of an oncolytic herpes simplex virus and administration of lymphocyte cells modified to express a chimeric antigen receptor (CAR) or modified to express a T cell receptor (TCR).

Abstract: Modified and improved oncolytic viruses (and methods of use thereof) are disclosed. More particularly, modified and oncolytic human herpesviruses (and methods of use thereof) are disclosed, which include a modified amino acid sequence that includes a deletion in a region that represents the amino terminus of glycoprotein K. The modified and oncolytic human herpesviruses include a deletion of amino acid residues 31-68, relative to the wild type amino acid sequence of glycoprotein K in human herpesviruses. Isolated vector constructs that encode such oncolytic viruses are also disclosed. In addition, methods for using such oncolytic viruses to treat cancers are disclosed.

Abstract: The present invention is directed to compositions and methods for the treatment of patients with cephalotaxines, for example, homoharringtonine. The invention is also directed to improvements in the purity, manufacturing process, formulation and administration of homoharringtonine for the treatment of cancer and other aberrant cellular diseases. The invention also provides methods and compositions for antiparasitic, antifungal, antiviral and antibacterial treatments.

Abstract: The present invention relates to a microemulsion comprising: 1-98 wt % of at least one polar lipid selected from polyglycerol fatty acid esters; 1-98 wt % of at least one emollient, not being a polyglycerolfatty acid ester; 0.1-3 wt % of at least one polar solvent; and 0-10 wt % of a surfactant, not being a polyglycerol fatty acid ester. The present invention further relates to said microemulsion for use as a medicament, and for use in the treatment and prevention of dry mucosa or prevention of airborne particles reaching topical mucosal membranes of a mammal. The present invention also relates to a liquid composition comprising said microemulsion, and an applicator device comprising said microemulsion.

Abstract: The present invention relates to pharmaceutical compositions with mucoadhesive and sustained release characteristics containing the association of the extract or fractions of Curcuma longa L. with curcuminoid content greater than 5% and Bidens pilosa (Bd) extract, which has an important proliferative and anti-inflammatory effect, for the treatment of inflammatory diseases of the oral cavity (stomatitis) and of the gastrointestinal tract, as, for example, mucositis induced by radiotherapy and/or chemotherapy and aphthous lesions. Additionally, inflammatory skin lesions and vaginal mucositis. These are compositions obtained from a liquid base formulation containing an aqueous-based solvent system. The subject of the present invention is, therefore, to obtain pharmaceutical preparations, to develop their obtainment processes and to establish their uses.

Abstract: Described herein is the design and construction of a class of lipoprotein targeting protease inhibitors. Small peptides with protease inhibitor activity are conjugated to hydrophobic, lipoprotein targeting molecules using, for instance, amine reactive chemistry. Methods of use of the resultant lipoprotein targeting protease inhibitor (antiprotease) molecules are also described. Also described is the production and use of protease inhibitor enriched HDL particles, as well as A1AT-peptide-enriched HDL particles, and their use in various therapeutic contexts.

Abstract: The present invention provides methods for producing a lyophilized degarelix product which, upon reconstitution with water for injection in an amount of 20 mg/ml, shows a viscosity of up to 15 mPas. The present invention also provides a lyophilized degarelix drug substance which shows, upon dissolution in water in an amount of 20 mg/ml, a viscosity of up to 3.2 mPas, and processes for providing this lyophilized degarelix drug substance.

Abstract: Embodiments are directed to a method of treating acute radiation syndrome comprising administering to a subject following exposure to radiation a PIF peptide. Some embodiments describe a method of treating acute radiation syndrome following radiation exposure comprising transplanting bone marrow that has been exposed to a PIF peptide prior to transplantation into a subject. Other embodiments describe a method of increasing engraftment of a transplanted organ, tissue, or cell by pre-exposing the organ, tissue, or cell to a PIF peptide.

Abstract: The invention provides methods and compositions for use of desmopressin in combination with an alpha-adrenergic receptor antagonist. The methods and compositions are useful in the treatment of nocturia and other urinary frequency disorders.

Abstract: The invention provides compositions and methods for preventing or treating an ischemia-reperfusion injury, such as occurs during acute myocardial infarction and organ transplant in a mammalian subject. The methods comprise administering to the subject an effective amount of an aromatic-cationic peptide or a pharmaceutically acceptable salt thereof, and one or more additional active agents such as cyclosporine.

Abstract: Provided in the present invention are a YAP protein inhibiting polypeptide and application thereof. In particular, the present invention obtains a key binding site of YAP protein and TEAD, screens a polypeptide with best YAP inhibitory activity and modifies the polypeptide, such as adding a disulfide linkage, replacing an amino acid, removing and/or adding (for example, adding a cell-penetrating element), and finally screens and verifies the obtaining of a series of polypeptides with YAP protein activity inhibiting effect and good stability. Experiments show that the polypeptide of the present invention can effectively inhibit the binding activity between YAP protein and TEAD, thus providing good therapeutic effect on digestive tract tumors (especially liver cancer).

Abstract: Certain embodiments are directed to compositions and methods for treating conditions associated Med12 mutations. Certain embodiments are directed to a peptide comprising all or part of an amino acid sequence that is at least 90% identical to the ammo acid sequence of MAAFGILSYEHRPLKRPRLGPPDVYPQDPKQKEDELTALNVKQGFNNQPAVSGDEHGSAKNVSFNPAKISSNFSSIIAEKLRCNTLPDT (SEQ ID NO:1). In certain aspects a peptide can comprise 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 consecutive amino acids that is 90, 95, or 100% identical SEQ ID NO:1. In certain embodiments a peptide described herein can be comprised in a pharmaceutical composition. Certain aspects are directed to an expression vector encoding a peptide as described herein.

Abstract: Provided herein are compositions and methods for the treatment of bone disorders through the maspin-based inhibition of osteoclastogenesis and osteoclast activity and the promotion of bone formation.

Abstract: The instant disclosure relates to methods and compositions for the treatment of Gaucher disease, particularly type II and III neuronopathic Gaucher disease (nGD). The methods include the step of administering to an individual in need thereof an effective amount of a ryanodine receptor inhibitor or a pharmaceutically acceptable salt thereof.

Abstract: The invention relates to the use of IL-22 in prevention and therapy of infections in particular related to viral infections in individuals who are unable to respond to viral exposure with enhanced IL-22 gene expression or protein production.

Abstract: The present invention relates generally to a method of reducing unwanted airway tissue mucus secretion in a mammal and to agents useful for same. More particularly, the present invention relates to a method of reducing airway tissue mucus hypersecretion in a mammal by downregulating the functional level of activin or upregulating the functional level of follistatin. The method of the present invention is useful, inter alia, in the treatment and/or prophylaxis of conditions characterised by airway tissue mucus dysfunction, such as overproduction of mucus or decreased mucus clearance, and where a reduction in mucus secretion levels would thereby alleviate the condition.

Abstract: A method for treating a microbial infection in a subject includes administering to the subject a pharmaceutical composition which has a therapeutically effective amount of an antimicrobial peptide containing a derivative of P-113.

Abstract: Pseudomonas aeruginosa flagellin protein recruits the mammalian host sialidase enzyme neuraminidase-1 (NEU1) to remove sialic acid residues from the extracellular domain of the mammalian cell-surface protein MUC1 (MUC1-ED), thereby exposing a cryptic binding site on the MUC1-ED protein backbone for flagellin binding. NEU1-driven MUC1-ED desialylation rapidly increases P. aeruginosa adhesion to the airway epithelium. MUC1-ED desialylation also increases MUC1-ED cleavage and shedding from the cell surface, where desialylated, shed MUC1-ED competitively blocks P. aeruginosa adhesion to cell-associated MUC1-ED. Presented herein are data showing that exogenously-administered, deglycosylated MUC1-ED peptides reduced adhesion of P. aeruginosa to airway epithelial cells. Also presented are data showing that administration of P. aeruginosa to mice in combination with deglycosylated MUC1-ED decreased P. aeruginosa recovered from the lungs at 48 hr and 72 hr post-infection.

Abstract: The present invention relates to treating and/or preventing heart failure or one or more individual heart failure phenotypes in mammals using placental growth factor 2 (PlGF-2).

Abstract: Provided is a method of treating a bladder cancer in an animal or human comprising: administering to an animal or human patient a therapeutic composition comprising a first fusion protein capable of specifically binding to an epidermal growth factor receptor (EGFR) on the surface of a cancer cell and comprising an epidermal growth factor (EGF) polypeptide conjugated to a bacterial toxin polypeptide and a second fusion protein comprising an anthrax Lethal Factor N-terminus (LFN) conjugated to a Diptheria Toxin A (DTA) catalytic domain.

Abstract: Provided is a method for treating a peripheral nervous system damage or injury, or for regenerating peripheral nervous system tissue that involves administering to a subject in need thereof a vector that comprises polynucleotide sequences that encode a modified vascular endothelia growth factor (VEGF) and a fibroblast growth factor (FGF2) and further a polynucleotide that encodes resistance to kanamycin. A gene-therapeutic structure encoding modified vascular endothelial growth factors (VEGF) and (FGF-2) is also provided. The gene-therapeutic structure can be administered directly to a damaged nerve and paraneural tissues both in intraoperative and post-operative period to stimulate peripheral nerve regeneration. The structure and method significantly advance existing methods for reconstructive treatment for damaged peripheral nerves.

Abstract: The application provides new compositions and methods for stimulating the production of natural killer (NK) cells in a subject. NK cells can be selectively expanded with a combination of stimulating ligands. Methods and compositions for the administration of stimulatory ligands modified to self-insert into tumor cells, thereby stimulating an increase in the number of NK cells in proximity to a tumor, are also described.

Abstract: Methods and compositions for treating frailty in mammals, preferably humans, are provided. The methods generally involve modulation of the OST-PTP signaling pathway or the PTP-1B signaling pathway involving gamma-carboxylase and osteocalcin, e.g., by administration of undercarboxylated/uncarboxylated osteocalcin. The methods comprise alleviating at least one of: muscle wasting or a lung disorder while also alleviating at least one of: a metabolic disorder, a male reproductive disorder, or a cognitive disorder.

Abstract: The present disclosure relates to methods and pharmaceutical compositions for the treatment of prostate cancers. In particular, the present invention relates to an OX1R agonist for use in the treatment of prostate cancer in a subject in need thereof.

Abstract: This invention relates to stable non-aqueous single phase viscous vehicles and to formulations utilizing such vehicles. The formulations comprise at least one beneficial agent uniformly suspended in the vehicle. The formulation is capable of being stored at temperatures ranging from cold to body temperature for long periods of time. The formulations are capable of being uniformly delivered from drug delivery systems at an exit shear rate of between about 1 to 1×107 reciprocal second.

Abstract: The present disclosure provides means and methods for promoting gastric emptying. In particular, the present disclosure provides the use of insulin or a composition comprising same for promoting gastric emptying and for treating gastric disorders, particularly disorders characterized by delayed gastric emptying. The insulin or composition comprising same are to be administered enterally.

Abstract: The present invention relates to a long acting insulin analogue for use in reducing the risk of hypoglycaemia in a patient suffering from diabetes and requiring high amounts of delivered insulin, wherein the long acting insulin analogue is administered to said patient and in an amount of greater than 80 U/administration.

Abstract: The present invention provides a technique for treating retinal epithelium and/or nerves. More specifically, the present invention is an agent for the treatment or prevention of retinal disease or the like and/or a disease, disorder, or ophthalmological state of the nerves, the agent including at least one factor selected from the group consisting of laminin and fragments thereof, wherein the problem is solved by also providing a technique characterized in that this agent is administered together with retinal pigment epithelial cells and/or nerve cells. Specifically, the present invention can include laminin 411 (?4?1?1), laminin 511 (?5?1?1), laminin 521 (?5?2?1), or fragments of these.

Abstract: The invention relates to a powdered milk product includes angiogenin and/or angiogenin hydrolysate in an amount of 1.4 to 24 mg/15 g, and cystatin and/or cystatin hydrolysate in the mass ratio to the angiogenin and/or angiogenin hydrolysate of 0.03 to 1.3.

Abstract: The invention provides methods for treating primary disorders of mood and affect, including depressive disorders, anxiety and sleep disorders and CNS disorders comprising the administration of a neurotoxin.

Abstract: There is provided a method for treating or reducing the effects of fructose intolerance and health problems associated with excessive fructose intake by administration of glucose isomerase. Other embodiments are also disclosed.

Abstract: The invention provides methods for enhancing the delivery of viral vectors to the eye of a subject by administering a proteasome inhibitor or and a viral vector ending a gene of interest to the eye.

Abstract: The invention provides for the synthesis of more effective generators of a T-cell immune response by providing peptide derivatives that are MHC class I-restricted antigens. The peptide derivatives of the present invention are prepared or derived from a parent peptide of 8 to 11 amino acid residues in length, wherein the peptide derivative contains a non-natural amino acid substituted in place of a naturally-occurring amino acid residue at one or more primary anchor positions in the parent peptide or at position 6, position 7, or the C-terminus.

Abstract: Vaccine compositions including a yeast comprising an immunostimulatory polypeptide and optionally an antigenic polypeptide are provided herein. The immunostimulatory polypeptide and the antigenic polypeptide are expressed or displayed on the surface of the yeast vaccine composition. Methods of using the vaccine composition to vaccinate subjects are also provided.

Abstract: The present invention relates to a peptide vaccine composition OSE-2101 for treatment of brain metastasis in HLA-A2 positive patients.

Abstract: The present application relates to arenaviruses with rearrangements of their open reading frames (“ORF”) in their genomes. In particular, described herein is a modified arenavirus genomic segment, wherein the arenavirus genomic segment is engineered to carry a viral ORF in a position other than the wild-type position of the ORF. Also described herein are trisegmented arenavirus particles comprising one L segment and two S segments or two L segments and one S segment. The arenavirus, described herein may be suitable for vaccines and/or treatment of diseases and/or for the use in immunotherapies.

Abstract: The current application provides for exogenous immune receptors that do not require any additional selection marker genes and/or any additional silicide genes. The disclosure allows for the production of engineered T cells that can be enriched for in an untouched manner, i.e., the engineered T cells do not require any interaction with any outside agent and can be selected for by eliminating T cells that express the endogenous alpha beta T cell receptor. Engineered T cells with an exogenous immune receptor are provided that can be differentiated from endogenous T cell receptor and now can be eliminated, i.e. depleted, with a selective antibody that specifically targets the exogenous immune receptor.

Abstract: A method of treating a patient who has non-small cell lung carcinoma (NSCLC), lung cancer, gastric cancer, and/or glioblastoma includes administering to said patient a composition containing a population of activated T cells that selectively recognize cells in the patient that aberrantly express a peptide. A pharmaceutical composition contains activated T cells that selectively recognize cells in a patient that aberrantly express a peptide, and a pharmaceutically acceptable carrier, in which the T cells bind to the peptide in a complex with an MHC class I molecule, and the composition is for treating the patient who has NSCLC, lung cancer, gastric cancer, and/or glioblastoma. A method of treating a patient who has NSCLC, lung cancer, gastric cancer, and/or glioblastoma includes administering to said patient a composition comprising a peptide in the form of a pharmaceutically acceptable salt, thereby inducing a T-cell response to the NSCLC, lung cancer, gastric cancer, and/or glioblastoma.

Abstract: This invention provides methods and compositions for modulating movement of eukaryotic cells with migratory capacity. More specifically, the invention provides fugetactic agents and methods for the use thereof in enhancing an immune response.