Abstract: This invention generally relates to substituted imidazopyridine compounds, particularly substituted 4-(imidazo[1,2-a]pyridin-2-yl)benzamide compounds and salts thereof. This invention also relates to pharmaceutical compositions and kits comprising such a compound, uses of such a compound (including, for example, treatment methods and medicament preparations), processes for making such a compound, and intermediates used in such processes.

Abstract: Provided herein are methods of treating a bacterial infection, wherein the methods comprise administering (a) ceftibuten or a pharmaceutically acceptable salt thereof, or a hydrate of the foregoing; and (b) clavulanic acid, or a pharmaceutically acceptable salt thereof. Also provided are pharmaceutical compositions, articles of manufacture, and kits comprising a) ceftibuten or a pharmaceutically acceptable salt thereof, or a hydrate of the foregoing; and (b) clavulanic acid, or a pharmaceutically acceptable salt thereof, and uses thereof.

Abstract: The invention is in the field of immunotherapy. More particularly, the invention provides a composition comprising a Heme Oxygenase-1 (HO-1) and antigens. Also provided herein are methods of administering the compositions of the invention by subcutaneous, intradermal or topical administration in a patient for inducing antigen-specific tolerance.

Abstract: This invention relates to dosage forms for the delivery of drugs across the oral mucosa having improved transmucosal permeability. More specifically, the invention relates to an oral transmucosal dosage form comprising a primary vehicle comprising a crystallization inhibition agent (CIA) system and a drug, and a secondary vehicle. It also relates to methods of designing and making this dosage form, methods of administering this dosage form and methods of packaging the dosage forms.

Abstract: The present invention provides the steroidal compound 3?-ethynyl-3?-hydroxyandrostan-17-one oxime, or a pharmaceutically acceptable salt thereof, for use in treatment of hepatic encephalopathy.

Abstract: The present invention relates to compounds and methods which may be useful as treatments of neuromuscular diseases such as muscular dystrophy, and as inhibitors of NF-?B for the treatment or prevention of muscular wasting disease, including muscular dystrophy.

Abstract: The present application is directed to an aqueous pharmaceutical composition comprising from about 0.4% w/v to less than about 2% w/v of a salt of deoxycholic acid, wherein the composition is maintained at a pH from about 8.1 to about 8.5 such that the composition is stabilized against precipitation. Also disclosed herein, are methods for stabilizing an aqueous pharmaceutical composition comprising from about 0.4% w/v to less than about 2% w/v of a salt of deoxycholic acid against precipitation, said method comprising maintaining pH of the solution from about 8.1 to about 8.5.

Abstract: The present invention relates to bicyclic himbacine derivatives of the formula or a pharmaceutically acceptable salt thereof wherein: R1 is W is and the remaining variables are described herein. The compounds of the invention are effective inhibitors of the PAR-1 receptor. The inventive compounds may be used for the treatment or prophylaxis of disease states such as ASC, secondary prevention of myocardial infarction or stroke, or PAD.

Abstract: A method of treating an MS patient with homosalate, octyl salicylate, or a combination is disclosed.

Abstract: Methods and compositions for using a tetracycline compound to treat bacterial infections are described. In one embodiment, for example, the invention provides a method of treating a subject for an infection, comprising administering to said subject an effective amount of 9-[(2,2-dimethyl-propyl amino)-methyl]-minocycline or a salt thereof, such that said subject is treated, wherein said infection is selected from the group consisting of MSSA, MRSA, B-streptococci, Viridans Streptococci, Enterococcus, or combinations thereof.

Abstract: The invention relates to methods and compositions for improving cognitive function by using a combination of a synaptic vesicle protein 2A (SV2A) inhibitor and an acetylcholinesterase inhibitor (AChEI) or their pharmaceutically acceptable salts, hydrates, solvates, polymorphs thereof. In particular, it relates to the use of a combination of an SV2A inhibitor and an AChEI in treating a central nervous system disorder with cognitive impairment in a subject in need or at risk thereof, including, without limitation, subjects having or at risk for age-related cognitive impairment, Mild Cognitive Impairment (MCI), dementia, Alzheimer's Disease (AD), prodromal AD, post traumatic stress disorder (PTSD), schizophrenia, amyotrophic lateral sclerosis (ALS), and cancer-therapy-related cognitive impairment.

Abstract: Oral dosage forms of osteoclast inhibitors, such as neridronic acid and zoledronic acid, in an acid or a salt form can be used to treat or alleviate pain or related conditions, such as joint pain.

Abstract: The present invention relates to methods for on demand pre-exposure prophylactic treatment of HIV infection. In particular, the present invention relates to a method for on demand pre-exposure prophylactic treatment of a subject at substantial risk for HIV infection comprising administering orally the subject with a combination of a therapeutically effective amount of emtricitabine and tenofovir prior and after to exposure to a potential source of HIV.

Abstract: Oral dosage forms of osteoclast inhibitors, such as zoledronic acid, in an acid or a salt form can be used to treat or alleviate pain or related conditions, such as complex regional pain syndrome.

Abstract: It is disclosed herein that that certain alkylphosphocholine analogs are preferentially taken up by malignant pediatric tumor cells. The alkylphophocholine analogs are compounds having the formula: or salts thereof, wherein n is an integer from 12 to 24; and R2 is —N+(CH3)3. The compounds can be used to treat pediatric solid tumors or to detect pediatric solid tumors. In therapeutic treatment, R1 includes a radioactive iodine isotope that locally delivers therapeutic dosages of radiation to the malignant pediatric tumor cells that preferentially take up the compound. In detection/imaging applications, R1 includes a detection moiety, such as a fluorophore or a radioactive iodine isotope.

Abstract: A composition and method for activating immune cells ex-vivo, or inducing an immune response in a subject including a composition comprising at least one chiral cationic lipid. The chiral cationic lipid in one embodiment comprises a nonsteroidal cationic lipid having a structure represented by formula (I); wherein in R1 is a quaternary ammonium group, Y1 is a spacer chosen from a hydrocarbon chain, an ester, a ketone, and a peptide, C* is a chiral carbon, R2 and R3 are independently chosen from a saturated fatty acid, an unsaturated fatty acid, an ester-linked hydrocarbon, phosphor-diesters, and combinations thereof.

Abstract: Disclosed are methods for treating a disease or condition characterized by decreased expression or reduced function of an ion channel, comprising administering to a subject in need thereof a therapeutically effective amount of a pore-forming polyene macrolide or pore-forming derivative thereof. For example, the pore-forming polyene macrolide may be amphotericin B (AmB), nystatin, or natamycin. The methods can be used to treat cystic fibrosis.

Abstract: Materials, formulations, production methods, and methods for delivery of CFTR mRNA for induction of CFTR expression, including in the mammalian lung are provided. The present invention is particularly useful for treating cystic fibrosis.

Abstract: A method of treating chronic active ulcerative colitis in a subject that is refractory or responds insufficiently or is intolerant to anti-inflammatory therapy, comprises administering to a patient in need thereof an effective exposure of an oligonucleotide comprising the sequence 5?-GGAACAGTTCGTCCATGGC-3? (SEQ ID NO.2), wherein at least one CG dinucleotide is unmethylated. The oligonucleotide is not administered with corticosteroids or glucocorticosteroids.

Abstract: Disclosed herein are oral dosage forms of colesevelam, or a pharmaceutically acceptable salt thereof, adapted to treat upper gastro-intestinal disorders associated with PPI refractory GERD. Also disclosed are the methods of using these oral dosage forms to treat upper gastrointestinal disorders associated with PPI refractory, or PPI resistant, GERD in a patient in need thereof. The oral dosage forms disclosed herein are adapted for the ascribed uses by being comprised of colesevelam, or a pharmaceutically acceptable salt thereof, in a polymeric matrix comprised of one or more hydrophilic polymers such that the oral dosage form erodes upon encountering gastric fluid and has a gastric retention time of three hours or longer, allowing for an extended period of time for the colesevelam to be released in the upper GI and sequester excess bile.

Abstract: The present disclosure provides a pharmaceutical composition comprising of a polyallylamine polymer or pharmaceutically acceptable salts thereof; excipient based hydrous granules and optionally moisture retaining agents. The present disclosure also provides process embodiments for preparation of the pharmaceutical compositions comprising of modified moisture activated granulation technique. Polyallylamine polymers used are Sevelamer, Colesevelam or pharmaceutically acceptable salts thereof, preferably Sevelamer HCl, Sevelamer carbonate or Colesevelam HCl. The Tablet according to the present disclosure comprising of polyallylamine polymer which can be prepared by using modified moisture activated granulation technique, by adding one or more excipient based hydrous granule(s), contacting the said hydrous granule(s) with polyallylamine polymer and optionally adding one or more moisture retaining agents and lubricant(s) resulting in the compression into a tablet form using suitable tools.

Abstract: Polymers having the formula R(LE)x wherein R is a polymeric core having a number average molecular weight of from 5000 to 7,000,000 daltons and having x endgroups, E is an endgroup covalently linked to polymeric core R by linkage L, L is a divalent oligomeric chain, having at least 5 identical repeat units, capable of self-assembly with L chains on adjacent molecules of the polymer, and the moieties (LE)x in the polymer may be the same as or different from one another. Design of monomers, oligomers, or other reactive structures otherwise analogous to known Self Assembled Monolayers but with at least one reactive chemical group capable of binding them to the terminus of a polymer, so that the thiol-free SAM analogue becomes the self-assembling surface modifying endgroup of that polymer. Use of the polymer to fabricate a configured article from the surface-modified polymer or a coating or topical treatment on an article made from another material.

Abstract: Pharmaceutical compositions for and methods of treating an animal, including a human, and methods of preparing such compositions. The pharmaceutical compositions contain crosslinked amine polymers and may be used, for example, to treat diseases or other metabolic conditions in which removal of protons and/or chloride ions from the gastrointestinal tract would provide physiological benefits such as normalizing serum bicarbonate concentrations and the blood pH in an animal, including a human.

Abstract: The present invention relates to pharmaceutical compositions comprising combinations of amino acids, vitamins, and minerals, which prevent the occurrence of adverse effects associated with prolonged use of glucocorticoids (GCs), especially those of particular relevance due to their high frequency and potential debilitating effect for the patient. These effects are steroid myopathy, hyperglycemia and loss of bone mass.

Abstract: The present invention relates to a method for producing a large amount of natural killer cells and the use of natural killer cells obtained by the method as an anticancer agent. The use of the method of the present invention can produce fresh NK cells with high purity within a short time compared to conventional method, and can also produce cold-preserved NK cells and thawed cryopreserved NK cells, which have efficacy comparable with that of the fresh NK cells. Furthermore, it can produce NK cells, which have efficacy comparable with that of the fresh NK cells, from cryopreserved CD3-negative cells. The fresh NK cells, cold-preserved NK cells and cryopreserved NK cells produced by the methods of the present invention can exhibit therapeutic effects against various cancers, including colorectal cancer, lung cancer, liver cancer, pancreatic cancer and leukemia, indicating that these NK cells can be effectively used as cellular therapeutic agents.

Abstract: The present invention encompasses methods and compositions for treating an ocular disease, disorder or condition in a mammal. The invention includes a population of mesenchymal stromal cells that possess anti-inflammatory, anti-apoptotic, immune modulatory and anti-tumorigenic properties. The invention includes administration of TSG-6, STC-1, or a combination thereof to the ocular as a treatment for an ocular disease, disorder or condition in a mammal.

Abstract: Disclosed herein are methods and compositions comprising adherent stromal cells.

Abstract: This disclosure relates generally to new methods of maintaining the expression of hepatic genes in human hepatocytes and method for maintaining the functional hepatic enzyme activity of primary hepatocytes in culture. The disclosure also encompasses new methods of deriving a population of pure hepatocytes without selecting or sorting the cells from the cultured pluripotent cells.

Abstract: This invention pertains to the field of ovarian aging and premature ovarian failure. Specifically, we herein disclose methods for treating these conditions using endothelial progenitor cells alone or in combination with mesenchymal stem cells.

Abstract: This invention relates to preparations derived from amniotic fluid, and more specifically, to an amniotic fluid preparation with specific standardized measure of the biologic activity of a component of the preparation, such as a constituent protein, for use in clinical and research applications. The amniotic fluid preparation with standardized biologic activity resolves problems of establishing efficacy, safety, and reproducibility in the clinical and investigatory use of amniotic fluid-derived preparations for the treatment of a wide range of degenerative illnesses, traumatic injuries, tissue and organ transplantation, and other medical conditions.

Abstract: Methods and compositions for treating ophthalmic disease, reducing retinal neovascularization and retinal vascular leakage using progenitor cells, such as postpartum-derived cells, and conditioned media from the cells, are disclosed.

Abstract: Pharmaceutical compositions containing microbial entities are described herein. The pharmaceutical compositions may optionally contain or be used in conjunction with one or more prebiotics. Uses of the pharmaceutical compositions to treat or prevent disorders of the local or systemic microbiome in a subject are also provided.

Abstract: Provided herein are methods of treatment and/or prevention of cancer by manipulation of commensal microflora. In particular, the amount, identity, presence, and/or ratio of microflora (e.g., gut microflora) in a subject is manipulated to facilitate one or more co-treatments.

Abstract: Provided is a method for treatment and prevention of kidney disease with a composition, wherein the composition comprises a lotus seedpod extract.

Abstract: The present invention provides a topical formulation comprising an active agent, which comprises salvigenin and optionally asiaticoside. The present invention also relates to the use of the topical formulation for the promotion of wound healing.

Abstract: The present invention relates to a pharmaceutical composition and a nutraceutical composition containing a composite extract of Allium sativum, Capsicum annuum, black tea and Psidium guajava as an active ingredient. According to the present invention, the pharmaceutical composition and the nutraceutical composition exhibit an excellent effect of increasing exercise performance ability and enhancing physical strength. Therefore, the composition of the present invention can be very useful in the pharmaceutical field or the nutraceutical field.

Abstract: A composition includes a target pharmaceutical or biological agent, a solution containing the target pharmaceutical or biological agent, and substrate that is soluble in the solution. The substrate is capable of being solidified via a solidification process and the solidification process causes the substrate to become physically or chemically cross-linked, vitrified, or crystallized. As a result of the solidification process, particles are formed. The target pharmaceutical or biological agent within the solution retains proper conformation to ultimately produce a desired effect.

Abstract: The invention relates to therapeutic peptides and uses thereof. In particular, the invention relates to disulphide-linked homodimers useful in the treatment or prevention of diseases and conditions in mammalian subjects (such as diabetes), via transmucosal administration.

Abstract: The invention relates to a peptide comprising the amino acid sequence LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRP, wherein the amino acids in said amino acid sequence are D-amino acid residues, and to methods for the use of this peptide in the treatment of age-related disorders

Abstract: A kit having instructions for use for performing uterine lavage in a female patient includes a uterine lavage catheter configured for insertion into a woman's uterus to remove viable blastocysts from the uterus, and one or more first containers having a sufficient dosage amount of a GnRH antagonist to cause desynchronization of the endometrium of the patient prior to, during and/or following recovery of viable blastocysts from the uterus.

Abstract: The present invention relates to stable pharmaceutical compositions comprising linaclotide or pharmaceutically acceptable salts thereof, as well as to various methods and processes for the preparation and use of the compositions.

Abstract: Provided herein are peptide formulations comprising polymers as stabilizing agents. The peptide formulations can be more stable for prolonged periods of time at temperatures higher than room temperature when formulated with the polymers. The polymers used in the present invention can decrease the degradation of the constituent peptides of the peptide formulations.

Abstract: Disclosed herein are methods of using PRG4 glycoprotein, also known as lubricin, to reduce, inhibit, or down-regulate pro-inflammatory pathways in patients at risk of or suffering from an inflammatory response or allergy symptom through CD44 antagonization, regulating pro-inflammatory cytokine production, inhibiting NF-?B translocation and/or facilitating removal of inflammation-inducing cellular or matrix debris or allergens.

Abstract: The present invention provides a method for the prevention and/or reduction of peri- or postoperative complications following surgical intervention, such as complications following vascular surgery, especially peripheral vascular surgery, comprising administering a therapeutically effective amount of Annexin A5 or a functional analogue or variant thereof to a patient in need of such treatment. Also provided is a pharmaceutical composition comprising a therapeutically effective amount of Annexin A5 or a functional analogue or variant thereof for use in the prevention and/or reduction of peri- or postoperative complications following surgical intervention, such as complications following vascular surgery, especially peripheral vascular surgery.

Abstract: Disclosed are methods to treat allergic conditions, including pulmonary and non-pulmonary conditions, in a subject by administering a composition that inhibits Pim kinase. Also disclosed are methods to treat allergic conditions in a subject by administering a composition that induces expression of Runx3.

Abstract: The invention relates to the use of an extracellular domain of Nogo selected from Nogo-A delta 20 and Nogo-66 for the treatment of glioblastoma, particularly by intravenous or intrathecal administration.

Abstract: The invention relates to vesicles comprising Epidermal Growth Factor (EGF), a cationic surfactant and cholesterol or derivatives thereof. The invention also discloses a procedure for their preparation, based on compressed fluid technology (CFs). The vesicles of the invention are useful in the manufacture of drugs and cosmetics and in tissue engineering.

Abstract: Embodiments of the invention provide swallowable devices, preparations and methods for delivering drugs and other therapeutic agents within the GI tract. Many embodiments provide a swallowable device for delivering the agents. Particular embodiments provide a swallowable device such as a capsule for delivering drugs into the intestinal wall or other GI lumen. Embodiments also provide various drug preparations that are configured to be contained within the capsule, advanced from the capsule into the intestinal wall and degrade to release the drug into the bloodstream to produce a therapeutic effect. The preparation can be operably coupled to delivery means having a first configuration where the preparation is contained in the capsule and a second configuration where the preparation is advanced out of the capsule into the intestinal wall. Embodiments of the invention are particularly useful for the delivery of drugs which are poorly absorbed, tolerated and/or degraded within the GI tract.

Abstract: The invention relates to a matrix in ball form comprising cross-linked fibrinogen, the matrix being free from fibrin, as well as to a method for preparing such a matrix, comprising the following steps: (a) providing an initial composition comprising fibrinogen and a platelet factor, (b) injecting said initial composition into an oil heated to a temperature of 50° C. to 80° C. so as to form an emulsion, (c) mixing the emulsion thus obtained at a temperature of 50° C. to 80° C. until a matrix in ball form is obtained, and (d) isolating the matrix thus obtained. The matrix is used as a cell carrier.

Abstract: The present invention provides use of endostatin or a functional variant thereof in the preparation of a medicament for treating dietary obesity, non-alcoholic fatty liver disease, insulin resistance or glucose intolerance. In the embodiments of the present invention, the functional variant may be YH-16, mES, mYH-16, m003, m007, mZ101, or the like.