Patents Issued in February 13, 2018
-
Patent number: 9889152Abstract: Herein provided are dosage forms (variously referred to as “formulations”) comprising a PPI that is released from the dosage form as a first and a second dose. Each dose of PPI is present in an amount sufficient to raise the plasma levels of the PPI to at least 100 ng/ml.Type: GrantFiled: November 11, 2015Date of Patent: February 13, 2018Assignee: Takeda Pharmaceuticals U.S.A., Inc.Inventors: Rajneesh Taneja, Majid Vakilynejad
-
Patent number: 9889153Abstract: Electrolytic acid or alkaline water having a NMR half line width using 170 of from about 45 to less than 51 Hz, and an oxide reduction potential of from ?1000 to +200 mV, or from +600 to +1300 mV, topical compositions that contain such water, uses for such water to hydrate skin, deliver drugs and treat various skin and mucosal conditions, and methods and apparatus for manufacturing the water.Type: GrantFiled: July 19, 2016Date of Patent: February 13, 2018Assignee: APR NANOTECHNOLOGIES s.a.Inventors: Yongge Chen, Roberto De Noni
-
Patent number: 9889154Abstract: Compositions that include a clay such as kaolin dispersed in a liquid such as water may be useful for promoting the clotting of blood. The compositions may be in a liquid, gel, paste, foam, or another form. Uses may include treating a traumatic injury such as in injury caused by a bullet, an explosive, a blade etc., or an injury caused during a medical procedure such as surgery.Type: GrantFiled: January 14, 2016Date of Patent: February 13, 2018Assignee: Z-MEDICA, LLCInventors: Giacomo Basadonna, Brent A. Johnson
-
Patent number: 9889155Abstract: An object of the present invention is to provide an agent that potentiates the antitumor effect of an anticancer agent by allowing efficient accumulation of the anticancer agent in tumor tissue. The administration of carbonate apatite with the anticancer agent allows efficient accumulation of the anticancer agent in the tumor tissue to dramatically potentiate the antitumor effect of the anticancer agent.Type: GrantFiled: February 20, 2015Date of Patent: February 13, 2018Inventors: Hirofumi Yamamoto, Masaki Mori
-
Patent number: 9889156Abstract: A method for treating noise-induced hearing loss (NIHL) includes the step administering a composition to the mammal, wherein the composition consists essentially of a biologically effective amount of vitamin A, vitamin E, vitamin C, a vasodilator comprising magnesium, and, optionally, a withanolide, and/or resveratrol.Type: GrantFiled: September 22, 2016Date of Patent: February 13, 2018Assignee: THE REGENTS OF THE UNIVERSITY OF MICHIGANInventors: Josef M. Miller, José M. Juiz Gómez, Juan C. Alvarado-Romero, Verónica Fuentes-Santamaria
-
Patent number: 9889157Abstract: The present invention provides, among other things, compositions and methods suitable for the treatment of hyperphosphatemia based on phosphate-binding magnesium salts. In some embodiments, the present invention provides compositions and methods suitable for the treatment of hyperphosphatemia based on the combination of phosphate-binding magnesium and calcium salts.Type: GrantFiled: April 3, 2017Date of Patent: February 13, 2018Assignee: Cypress Pharmaceuticals, Inc.Inventors: Robert L. Lewis, Charles E. Day
-
Patent number: 9889158Abstract: The proposed compositions and methods for preparation thereof relate to pharmacology, medicine, veterinary science and pharmaceutical industry. The compositions can be used for preparing infusion solutions of antimicrobial (antibacterial and antifungal) preparations increasing therapeutic efficiency thereof. The compositions include nanostructured colloidal silica and are efficient when treating overwhelming sepsis of tested animals, provoked by Staphylococcus aureus, Escherichia coli, Pseudomonas aeruginosa and Candida albicans. The pharmaceutical compositions have a proven and significant clinically important potentiating impact on therapeutic efficiency of the infusion solutions, when treating inflammatory diseases, in comparison with traditional solvents.Type: GrantFiled: October 12, 2012Date of Patent: February 13, 2018Inventor: Viktor Lvovich Limonov
-
Patent number: 9889159Abstract: The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.Type: GrantFiled: July 14, 2016Date of Patent: February 13, 2018Assignee: IMMATICS BIOTECHNOLOGIES GMBHInventors: Heiko Schuster, Janet Peper, Philipp Wagner, Hans-Georg Rammensee
-
Patent number: 9889160Abstract: Disclosed herein is a genetically-modified cell comprising in its genome a modified human T cell receptor alpha constant region gene, wherein the cell has reduced cell-surface expression of the endogenous T cell receptor. The present disclosure further relates to methods for producing such a genetically-modified cell, and to methods of using such a cell for treating a disease in a subject.Type: GrantFiled: May 26, 2017Date of Patent: February 13, 2018Assignee: Precision BioSciences, Inc.Inventors: Derek Jantz, James Jefferson Smith, Michael G. Nicholson, Daniel T. MacLeod, Victor Bartsevich, Jeyaraj Antony
-
Patent number: 9889161Abstract: Disclosed herein is a genetically-modified cell comprising in its genome a modified human T cell receptor alpha constant region gene, wherein the cell has reduced cell-surface expression of the endogenous T cell receptor. The present disclosure further relates to methods for producing such a genetically-modified cell, and to methods of using such a cell for treating a disease in a subject.Type: GrantFiled: May 26, 2017Date of Patent: February 13, 2018Assignee: Precision BioSciences, Inc.Inventors: Derek Jantz, James Jefferson Smith, Michael G. Nicholson, Daniel T. MacLeod, Victor Bartsevich, Jeyaraj Antony
-
Patent number: 9889162Abstract: The present invention concerns the field of nutritional compositions and concerns a nutritional composition, especially an infant formula containing whey protein/milk protein concentrate solids rich in phospholipids, rich in MFGM for use in the prophylaxis and prevention of infectious morbidity, especially otitis. At the same time the use of antipyretics has diminished.Type: GrantFiled: June 26, 2014Date of Patent: February 13, 2018Assignee: HERO AGInventors: Bo Lönnerdal, Olle Hernell, Lars-Börje Sjöberg, Catharina Tennefors
-
Patent number: 9889163Abstract: Krill oil compositions are disclosed as having high amounts of phospholipids, astaxanthin esters and/or omega-3 contents. The krill oils are obtained from krill meal using supercritical fluid extraction in a two stage process. Stage 1 removes the neutral lipid by extracting with neat supercritical CO2 or CO2 plus approximately 5% of a co-solvent. Stage 2 extracts the actual krill oils by using supercritical CO2 in combination with approximately 20% ethanol. The krill oil materials obtained are compared with commercially available krill oil and found to be more bioeffective in a number of areas such as anti-inflammation, anti-oxidant effects, improving insulin resistances and improving blood lipid profile.Type: GrantFiled: May 8, 2017Date of Patent: February 13, 2018Assignee: AKER BIOMARINE ANTARCTIC ASInventors: Inge Bruheim, Snorre Tilseth, Daniele Mancinelli
-
Patent number: 9889164Abstract: Genetically programmed microorganisms, such as bacteria, pharmaceutical compositions thereof, and methods of modulating and treating a disease and/or disorder are disclosed.Type: GrantFiled: May 13, 2016Date of Patent: February 13, 2018Assignee: Synlogic, Inc.Inventors: Dean Falb, Paul F. Miller, Jonathan W. Kotula, Vincent M. Isabella, Suman Machinani, Adam B. Fisher, Yves Millet
-
Patent number: 9889165Abstract: Described herein are compositions and methods of treatment for acne and other skin disorders involving the use of probiotics. In certain aspects, microbes included in the probiotics have been engineered or selected for the treatment of specific skin disorders.Type: GrantFiled: April 21, 2017Date of Patent: February 13, 2018Assignee: NAKED BIOME, INC.Inventors: Emma Taylor, David Hanzel
-
Patent number: 9889166Abstract: A composition for a medical device is described. The composition comprises a specific mucoadherent gelling complex composed of EPS, exopolysaccharides of bacterial origin produced in situ in the gastrointestinal tract by specific selected bacterial strains, in association with vegetable gums and/or animal and/or vegetable gelatines. The complex is capable of establishing a complete barrier effect of a mechanical type extending throughout the whole gastrointestinal tract and can be used as a medication for the prevention and treatment of all pathologies connected to a deficiency in the barrier effect in the gastrointestinal area due to a low production of mucus, such as, by way of non-exhaustive example, intestinal permeability and bacterial translocation.Type: GrantFiled: July 30, 2013Date of Patent: February 13, 2018Assignee: PROBIOTICAL S.P.A.Inventor: Giovanni Mogna
-
Patent number: 9889167Abstract: Disclosed are novel Lactobacillus plantarum strains as well as a composition containing the novel Lactobacillus plantarum strains or a culture thereof.Type: GrantFiled: April 13, 2016Date of Patent: February 13, 2018Assignee: AMOREPACIFIC CORPORATIONInventors: Il Young Kwack, Se Jin You, Tae Hun Park, Bum Jin Lee, Kye Ho Shin, Jin Oh Chung, Jun Cheol Cho
-
Patent number: 9889168Abstract: The invention relates to pneumoviral virions comprising a viral genome that has a mutation in a gene coding for a protein that is essential for infectivity of the pneumovirus, whereby the mutation causes a virus produced from only the viral genome to lack infectivity, and whereby the virion comprises the protein in a form and in an amount that is required for infectivity of the virion. The invention also relates to methods for producing the pneumoviral virions and for using the virions in the treatment or prevention of pneumoviral infection and disease. A preferred pneumoviral virion is a virion of Respiratory Syncytial Virus in which preferably the gene for the G attachment protein is inactivated and complemented in trans.Type: GrantFiled: July 31, 2015Date of Patent: February 13, 2018Assignee: De Staat der Nederlanden, vert, door de minister van VWSInventors: Willem Luytjes, Myra Noorely Widjojoatmodjo
-
Patent number: 9889169Abstract: Described is a pharmaceutical composition comprising (a) a parvovirus and (b) an Bcl-2 inhibitor and the use of said composition for treatment of cancer, e.g., a solid tumor. Preferred inhibitors are the BH3 mimetics ABT-737 and ABT-199.Type: GrantFiled: December 7, 2015Date of Patent: February 13, 2018Assignees: DEUTSCHES KREBSFORSCHUNGSZENTRUM, RUPRECHT-KARLS-UNIVERSITÄT HEIDELBERGInventors: Antonio Marchini, Junwei Li, Lea Schroeder, Jean Rommelaere, Karsten Geletneky
-
Patent number: 9889170Abstract: A method of preparing nanoparticles from desert date can include providing a metal salt solution comprising metal ions; providing desert date extract solution that comprises a reducing agent, and combining the metal ion solution and the desert date extract solution while stirring at a temperature in the range of 25° C. to 100° C. to produce metal or metal oxide nanoparticles. The metal nanoparticles can be gold nanoparticles. The metal oxide nanoparticles can be zinc oxide nanoparticles. The nanoparticles can be used to inhibit the growth or proliferation of a cancer cell and/or microorganisms.Type: GrantFiled: October 6, 2016Date of Patent: February 13, 2018Assignee: KING SAUD UNIVERSITYInventors: Manal Ahmed Gasmelseed Awad, Rabab Abd El Moneim Khalil El Dib, Awatif Ahmed Hendi, Shaza Mohamed Adel Al-Massarani, Khalid Mustafa Osman Ortashi
-
Patent number: 9889171Abstract: A composition for the topical application on a mammalian skin comprises one or more Brassica plant extracts selected from the group consisting of: Brassica juncea extract, Brassica oleracea italica extract, Brassica oleracea capitata extract, Brassica oleracea botrytis extract, and Brassica oleracea acephala extract. The composition further comprises one or more selected from the group consisting of: Curcuma longa extract, curcuminoids, tetrahydrocurcuminoids, metabolites of curcuminoids or tetrahydrocurcuminoids, and derivatives of curcuminoids or tetrahydrocurcuminoids. The composition further comprises one or more selected from the group consisting of: Camellia oleifera extract, Camellia sinensis extract, green tea extract and white tea extract; Wasabia japonica extract; Bacopa monnieri extract; Silybum marianum extract; and one or both of Piper nigrum extract or tetrahydropiperine.Type: GrantFiled: February 22, 2016Date of Patent: February 13, 2018Assignee: LIFEVANTAGE CORPORATIONInventor: Nathalie Chevreau
-
Patent number: 9889172Abstract: Therapeutic patches are presented including: a non-permeable sealing layer; a pressure sensitive adhesive layer bonded along the non-permeable sealing layer, where the pressure sensitive adhesive layer includes a formulation of a pressure sensitive adhesive and a heat sensitive homeopathic formulation, where the pressure sensitive adhesive layer is processed at a temperature less than approximately 1000 F; and a releasable layer attached along the pressure sensitive adhesive layer. In some embodiments, the therapeutic patch detectably reduces nausea associated symptoms and menstrual cramping. In some embodiments, the pressure sensitive adhesive layer includes at least approximately 15% by weight of the heat sensitive homeopathic formulation. In some embodiments, the pressure sensitive adhesive layer includes at least approximately 5 to 20% by weight of the heat sensitive homeopathic formulation.Type: GrantFiled: August 2, 2015Date of Patent: February 13, 2018Inventor: Nicole Burdock
-
Patent number: 9889173Abstract: The present invention provides a composition for improving macular pigment optical density and preventing or treating age-related macular optical degeneration. The composition comprises lutein, zeaxanthin and tea extracts, wherein the weight ratio of zeaxanthin to lutein is more than or equal to 1. The composition may prevent formation of choroidal neovascularization to achieve effects on comprehensively preventing or treating age-related macular optical degeneration (AMD).Type: GrantFiled: August 8, 2013Date of Patent: February 13, 2018Assignee: Zhejiang Medicine Co., Ltd. Xinchang Pharmaceutical FactoryInventors: Xinde Xu, Lihua Zhang, Xiaoxia Sun
-
Patent number: 9889174Abstract: Disclosed herein are herbal formulations for relief from symptoms of skin disease. The formulations can also be combined with an active or inactive pharmaceutical ingredient, and/or a pharmaceutically acceptable excipient.Type: GrantFiled: June 8, 2015Date of Patent: February 13, 2018Assignee: Haus Bioceuticals, Inc.Inventors: Tomy Yesudas, Philip Alex, Michael Centola, Adam Joshua Payne
-
Patent number: 9889175Abstract: Prophylactic and/or therapeutic antipathogen agents are provided that disrupt or prevent the formation of at least one homotypic and/or heterotypic protein-protein interaction that has at least one CEA-family protein and that is involved in the establishment and colonization of a pathogen in a suitable host.Type: GrantFiled: June 8, 2016Date of Patent: February 13, 2018Inventor: Gal Markel
-
Patent number: 9889176Abstract: The present invention derives from the finding that increased levels of Toll like receptor 4 (TLR4) is associated with liver failure and renal dysfunction and/or brain dysfunction and that by decreasing TLR4 levels in vivo, the kidney and brain consequences of liver disease that are precipitated by superimposed infection or inflammation may be reduced. Accordingly, the invention provides TLR4 antagonists for use in a method of treating an individual suffering from liver disease presenting with renal or brain dysfunction.Type: GrantFiled: August 17, 2011Date of Patent: February 13, 2018Assignee: YAQRIT LIMITEDInventors: Rajiv Jalan, Naina Shah
-
Patent number: 9889177Abstract: The invention relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of FGF19 and/or FGF21, and variants or fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics), having one or more activities, such as bile acid homeostasis modulating activity, and methods for and uses in treatment of bile acid and other disorders.Type: GrantFiled: December 30, 2015Date of Patent: February 13, 2018Assignee: NGM Biopharmaceuticals, Inc.Inventors: Lei Ling, Jian Luo
-
Patent number: 9889178Abstract: The invention relates to variants and fusions of fibroblast growth factor 19 (FGF19), variants and fusions of fibroblast growth factor 21 (FGF21), fusions of FGF19 and/or FGF21, and variants or fusions of FGF19 and/or FGF21 proteins and peptide sequences (and peptidomimetics), having one or more activities, such as bile acid homeostasis modulating activity, and methods for and uses in treatment of bile acid and other disorders.Type: GrantFiled: December 30, 2015Date of Patent: February 13, 2018Assignee: NGM Biopharmaceuticals, Inc.Inventors: Lei Ling, Jian Luo
-
Patent number: 9889179Abstract: The present invention provides a new dosing regimen for administration of FGF-18 in the treatment of a cartilage disorder, such as osteoarthritis or cartilage injury. Specifically provided is a preferred treatment scheme comprising administrations every 3 weeks, 4 weeks or 5 weeks of an FGF-18 compound per treatment cycle. The new dosing regimen can include the co-adminsitration of an anti-inflammatory drug.Type: GrantFiled: February 20, 2015Date of Patent: February 13, 2018Assignee: MERCK PATENT GMBHInventors: Christoph H. Ladel, Hans Guehring
-
Patent number: 9889180Abstract: The present invention relates to a pharmaceutical composition comprising a histone-lysine N-methyltransferase EZH2 (enhancer of zeste homolog 2) inhibitor and an enhancer of interferon-gamma receptor activity. The invention also relates to method of treating a patient having cancer, comprising administration of the pharmaceutical composition.Type: GrantFiled: November 19, 2013Date of Patent: February 13, 2018Assignee: Agency for Science, Technology and ResearchInventors: Qiang Yu, Zhen Ning Wee
-
Patent number: 9889181Abstract: The present invention provides compositions and methods for prevention, amelioration and treatment of gram positive bacteria, particularly Staphylococcal bacteria, with combinations of lysin, particularly Streptococcal lysin, particularly the lysin PlySs2, and one or more antibiotic, including daptomycin, vancomycin, oxacillin, linezolid, or related antibiotic(s).Type: GrantFiled: June 4, 2013Date of Patent: February 13, 2018Assignee: CONTRAFECT CORPORATIONInventors: Raymond Schuch, Robert C. Nowinski, Michael Wittekind, Han Lee, Brent Schneider
-
Patent number: 9889182Abstract: Reagents and methods useful for the synthesis of conjugates comprising guanidinylated cyclic acetals are provided. Also provided are methods for increasing the cellular uptake of various therapeutic compounds and treatment modalities using these conjugates.Type: GrantFiled: September 15, 2010Date of Patent: February 13, 2018Assignee: The Regents of the University of CaliforniaInventors: Jeffrey D. Esko, Yitzhak Tor
-
Patent number: 9889183Abstract: The present disclosure provides a method for treating stroke by administering to a subject an anticoagulant, e.g., recombinant tissue plasminogen activator (rTPA), and a protein kinase C (PKC) activator followed by administration of at least one PKC activator for a duration of treatment. The methods disclosed herein may limit the size of infarction and/or reduce mortality, the disruption of the blood-brain barrier, and/or the hemorrhagic damage due to ischemic stroke compared with rTPA administration alone; and may also extend the therapeutic time window for administering rTPA after a stroke. Also disclosed are kits comprising rTPA and a PKC activator for treating stroke.Type: GrantFiled: August 5, 2015Date of Patent: February 13, 2018Assignee: West Virginia UniversityInventor: Daniel L. Alkon
-
Patent number: 9889184Abstract: Provided is a system for protecting plants from attack by pests, including pathogens such as fungi. Specifically, a plant defensin is provided in conjunction with a protease inhibitor protects a plant from pest attack or reduces severity of an attack.Type: GrantFiled: March 15, 2013Date of Patent: February 13, 2018Assignee: Hexima LimitedInventors: Robyn Louise Heath, Marilyn Anne Anderson, Nicole Louise van der Weerden, James Anthony McKenna, Simon Poon
-
Patent number: 9889185Abstract: The subject matter disclosed herein pertains to the modulation of a bacterial invasion switch and the subsequent use of the bacterium to vaccinate an organism. In one embodiment, the bacterial invasion switch is modulated by changing the proteolysis of ExoR protein. In another embodiment, a mutated bacterium produces a mutant ExoR protein that resists proteolysis.Type: GrantFiled: September 14, 2015Date of Patent: February 13, 2018Assignee: Research Foundation of the City University of New YorkInventors: Haiping Cheng, Shari Walcott, Haiyang Lu, Li Luo, Menghua Yang, Zahra Salehi
-
Patent number: 9889186Abstract: An oral preparation for the prophylaxis or treatment of a disease with infection by a pathogen, containing a killed lactic acid bacterium expressing, on the surface, an antigen of the pathogen, or a microparticulated form thereof, which has an average particle size of 2.68-30 ?m. An oral preparation for inducing cellular immunity to a target antigen, containing a killed lactic acid bacterium expressing the target antigen on the surface or a microparticulated form thereof, which has a particle size of 2.68-30 ?m.Type: GrantFiled: April 18, 2014Date of Patent: February 13, 2018Assignees: MORISHITA JINTAN CO., LTD., BIOLEADERS CORPORATIONInventors: Takashi Nomura, Akiko Temma, Takahiro Nakazawa, Ryuichi Morishita, Il-Han Lee
-
Patent number: 9889187Abstract: The present invention relates to infectious DNA clones, infectious chimeric DNA clones of porcine circovirus (PCV), vaccines and means of protecting pigs against viral infection or postweaning multisystemic wasting syndrome (PMWS) caused by PCV2. The new chimeric infectious DNA clone and its derived, avirulent chimeric virus are constructed from the nonpathogenic PCV1 in which the immunogenic ORF gene of the pathogenic PCV2 replaces a gene of the nonpathogenic PCV1, preferably in the same position. The chimeric virus advantageously retains the nonpathogenic phenotype of PCV1 but elicits specific immune responses against the pathogenic PCV2. The invention further embraces the immunogenic polypeptide expression products. In addition, the invention encompasses two mutations in the PCV2 immunogenic capsid gene and protein, and the introduction of the ORF2 mutations in the chimeric clones.Type: GrantFiled: November 13, 2015Date of Patent: February 13, 2018Assignees: Virginia Tech Intellectual Properties, Inc., Iowa State University Foundation, Inc.Inventors: Xiang-Jin Meng, Martijn Fenaux, Patrick G. Halbur
-
Patent number: 9889188Abstract: The present invention is directed to a composition and/or plasmid and/or vector vaccine which encodes four fragments of the GP1 Ebola protein attached to the extracellular domain of the potent immunostimulatory protein CD40 ligand, in the configuration of two compositions and/or vaccines that are mixed together, to respectively increase the levels of antibodies and CD8 effector T cells, against the lethal Ebola virus.Type: GrantFiled: November 2, 2016Date of Patent: February 13, 2018Assignee: MICROVAX, LLCInventor: Albert B. Deisseroth
-
Patent number: 9889189Abstract: Disclosed are universal influenza A vaccines capable of providing broader crossprotection. The vaccine contains a fusion protein comprising tandem repeats of heterologous M2e epitope sequences that have been molecularly and genetically designed to provide broad cross-protection. The fusion protein may be incorporated into virus-like particles (VLPs) or a replicating live attenuated influenza virus vaccine, and administered alone or in combination with other influenza vaccines.Type: GrantFiled: October 30, 2013Date of Patent: February 13, 2018Assignee: Georgia State University Research FoundationInventors: Sang-Moo Kang, Min-Chul Kim
-
Patent number: 9889190Abstract: Novel nanoparticle fusion proteins comprising proteins or peptides fused to Dps (DNA binding protein from starved cells) proteins are provided which bring forth distinct advantages for development of new and improved vaccines, diagnostic tests, and other biomedical products.Type: GrantFiled: December 14, 2015Date of Patent: February 13, 2018Assignee: KJ Biosciences LLCInventor: Yawei Ni
-
Patent number: 9889191Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.Type: GrantFiled: August 8, 2016Date of Patent: February 13, 2018Assignee: PepTcell LimitedInventors: Gregory Alan Stoloff, Wilson Romero Caparros-Wanderley
-
Patent number: 9889192Abstract: An immune response in a subject is elicited by a regiment comprising immunization with an attenuated recombinant rabies virus encoding at least one foreign protein antigen, and booster immunization with the at least one foreign protein antigen in a vehicle that does not contain adjuvant. The foreign protein antigen may comprise a prion protein antigen, a cancer-associated antigens, a viral antigen, a bacterial antigens, or a protozoal antigen. The prime/boost regimen produces predominantly IgG 2A/C and IgG 2B antibodies against the foreign protein antigen, indicating a TH1 response. Rabies virus attenuation may be provided, for example, by one or more mutations in the rabies glycoprotein gene which confers attenuation of pathogenicity.Type: GrantFiled: September 24, 2013Date of Patent: February 13, 2018Assignee: THOMAS JEFFERSON UNIVERSITYInventors: Bernhard Dietzschold, Douglas Craig Hooper, Milosz Faber
-
Patent number: 9889193Abstract: The invention relates to a genetically modified infectious measles virus derived from a live-attenuated measles virus strain, in which the gene encoding the viral accessory C protein has been knocked out (MV-deltaC). It concerns in particular the use of said genetically modified infectious MV-deltaC in the treatment of malignant tumor or cancer conditions, and for the preparation of agents or compositions for such treatment.Type: GrantFiled: January 20, 2014Date of Patent: February 13, 2018Assignees: CENTRE NATIONAL DE LA RECHERCHE SCENTIFIQUE (CNRS), INSITUT NATIONAL DE LA SANTE ET DE LA RECHERCHE MEDICALE (INSERM), INSTITUT PASTEUR, UNIVERSITE DE NANTESInventors: Frédéric Tangy, Marc Gregoire, Jean-François Fonteneau, Jean-Baptiste Guillerme, Chantal Combredet
-
Patent number: 9889194Abstract: Described herein are immunogenic compositions for preventing infection with Middle East respiratory syndrome coronavirus (MERS-CoV) wherein the immunogenic compositions comprise at least a portion of the MERS-CoV S protein and an immunopotentiator.Type: GrantFiled: February 28, 2014Date of Patent: February 13, 2018Assignee: New York Blood Center, Inc.Inventors: Shibo Jiang, Lanying Du, Yusen Zhou, Guangyu Zhao
-
Patent number: 9889195Abstract: The present invention provides an immunogenic composition comprising an antigen and a dendritic cell targeting component. A charged group is covalently attached to a dendritic cell ligand and is electrostatically associated with the dendritic cell targeting component.Type: GrantFiled: January 22, 2015Date of Patent: February 13, 2018Assignee: INNAVAC PTY LTDInventors: David Charles Jackson, Weiguang Zeng, Brendon Yew Loong Chua
-
Patent number: 9889196Abstract: A composition includes at least one mineral oil, a surfactant having a hydrophilic property characterized by an HLB value equal to 12 and a divalent inorganic salt intended to be used as an adjuvant in a vaccine composition for the in ovo vaccination of avian species wherein the composition is an oil-in-water emulsion or microemulsion.Type: GrantFiled: November 12, 2014Date of Patent: February 13, 2018Assignee: SOCIETE D'EXPLOITATION DE PRODUITS POUR LES INDUSTRIED CHIMIQUES SEPPICInventors: Juliette Ben Arous, Laurent Dupuis, Hyun Lillehoj
-
Patent number: 9889197Abstract: Diabody molecules and uses thereof in the treatment of a variety of diseases and disorders, including immunological disorders, infectious disease, intoxication and cancers are disclosed. The diabody molecules comprise two polypeptide chains that associate to form at least two epitope binding sites, which may recognize the same or different epitopes on the same or differing antigens. Additionally, the antigens may be from the same or different molecules. The individual polypeptide chains of the diabody molecule may be covalently bound through non-peptide bond covalent bonds, such as disulfide bonding of cysteine residues located within each polypeptide chain. The diabody molecules may further comprise an Fc region, which allows antibody-like functionality to be engineered into the molecule.Type: GrantFiled: July 29, 2011Date of Patent: February 13, 2018Assignee: MacroGenics, Inc.Inventors: Leslie S. Johnson, Ling Huang, Godfrey Jonah Anderson Rainey
-
Patent number: 9889198Abstract: The presently described technology provides a novel class of prodrugs of quetiapine that can be synthesized by chemically conjugating fatty acids to quetiapine. Pharmaceutical compositions and methods of synthesizing conjugates of the present technology are also provided. Methods of treating patients with the compositions of the present technology are also provided.Type: GrantFiled: May 15, 2017Date of Patent: February 13, 2018Assignee: KemPharm, Inc.Inventors: Travis Mickle, Sven Guenther, Sanjib Bera
-
Patent number: 9889199Abstract: Compounds that are PSMA ligands, pharmaceutical compositions comprising these compounds, methods for treating and detecting cancers in a subject, methods for identifying cancer cells in a sample are described herein. Prostate-specific membrane antigen (PSMA) is a 120 kDa protein expressed in prostate tissues and was originally identified by reactivity with a monoclonal antibody designated 7EII-C5 (Horoszewicz et al., 1987, Anticancer Res. 7:927-935; U.S. Pat. No. 5,162,504). PSMA is characterized as a type II transmembrane protein sharing sequence identity with the transferrin receptor (Israeli et al., 1994, Cancer Res. 54:1807-1811).Type: GrantFiled: February 18, 2014Date of Patent: February 13, 2018Assignee: Case Western Reserve UniversityInventors: James Basilion, Xinning Wang, Clemens Burda
-
Patent number: 9889200Abstract: Provided herein are sphingolipid-polyalkylamine phosphoramidites, methods of generating sphingolipid-polyalkylamine-oligonucleotide compounds, pharmaceutical compositions comprising such compounds, and to methods of use thereof in treating cancer.Type: GrantFiled: July 30, 2014Date of Patent: February 13, 2018Assignees: QBI ENTERPRISES LTD., BIO-LAB LTD.Inventors: Sharon Avkin-Nachum, Jean Hildesheim, Tirtsa Kleinman, Jean-Christophe Truffert, Gerald Mathis
-
Patent number: 9889201Abstract: The present application discloses an acid labile lipophilic molecular conjugate of cancer chemotherapeutic agents and methods for reducing or substantially eliminating the side effects of chemotherapy associated with the administration of a cancer chemotherapeutic agent to a patient in need thereof.Type: GrantFiled: April 18, 2016Date of Patent: February 13, 2018Assignee: ARBOR THERAPEUTICS, LLCInventors: James D. McChesney, John T. Henri, Sylesh Kumar Venkataraman, Mahesh Kumar Gundluru