Abstract: Methods of using substituted 2-anilinopyrimidine derivatives, and pharmaceutically acceptable salts, solvates, or compositions, for the treatment of brain cancers, in particular EGFR-mediated metastatic brain cancer, are disclosed.

Abstract: The invention provides compounds having Formula (I): or a pharmaceutically acceptable salt thereof, as well as pharmaceutical compositions comprising the same, processes for their preparation, and methods of treating and preventing HIV infection by their administration.

Abstract: The present invention relates to polymorphic forms of dasatinib lauryl sulfate salt.

Abstract: In alternative embodiments, provided are compositions and methods for treating, enhancing the drug sensitivity of, and preventing the formation of cancer stems cells, including preventing or slowing the development or generation of a beta-3 (?3)-expressing, or integrin ?3 (ITG-B3)-expressing cancer or tumor cells. In alternative embodiments, provided are methods using histone acetyl transferase inhibitors and/or histone methyl transferase inhibitors to determine therapeutic values in cancer cells that induce an integrin ?3 (ITGB3) polypeptide expression. In alternative embodiments, provided are kits, blister packages, lidded blisters or a blister card or packet, clamshells, trays or shrink wraps, comprising at least one compound, composition or formulation used to practice a method as provided herein, and at least one Growth Factor Inhibitor.

Abstract: Compounds, compositions, and methods of treatment and prevention of HIV, including HIV-1 and HIV-2, Dengue, and Chikungunya infection are disclosed. The compounds are TREM-1 inhibitors. Combinations of these TREM-1 inhibitors and additional antiretroviral compounds, such as NRTI, NNRTI, integrase inhibitors, entry inhibitors, protease inhibitors, JAK inhibitors, macrophage depleting agents, and the like, are also disclosed. In one embodiment, the combinations include a combination of adenine, cytosine, thymidine, and guanine nucleoside antiviral agents, optionally in further combination with at least one additional antiviral agent that works via a different mechanism than a nucleoside analog. This combination has the potential to eliminate the presence of HIV, Dengue, or Chikungunya virus in an infected patient.

Abstract: The present invention relates to a Brk inhibitory compound represented by general formula (I) (wherein, all symbols represent the same meanings as the symbols set forth in the specification), a salt thereof, an N-oxide thereof, a solvate thereof, or a prodrug of any of these.

Abstract: The present invention provides e.g. N-{[2-(piperidin-1-yl)phenyl](phenyl)methyl}-2-(3-oxo-3,4-dihydro-2H-1,4-benzoxazin-7-yl)acetamide derivatives and related compounds as ROR-gamma modulators for treating e.g. autoimmune diseases, autoimmune-related diseases, inflammatory diseases, metabolic diseases, fibrotic diseases or cholestatic diseases, such as e.g. arthitis and asthma.

Abstract: The present invention relates to aryl- or heteroaryl-substituted benzene compounds. The present invention also relates to pharmaceutical compositions containing these compounds and methods of treating cancer by administering these compounds and pharmaceutical compositions to subjects in need thereof. The present invention also relates to the use of such compounds for research or other non-therapeutic purposes.

Abstract: Provided herein is an ophthalmic composition formulated in deuterated water. Also disclosed herein are methods of treating, ameliorating, or reducing ophthalmic conditions or diseases by administering to an eye of an individual in need thereof an effective amount of an ophthalmic composition as described herein.

Abstract: Provided herein is an ophthalmic composition formulated in deuterated water. Also disclosed herein are methods of treating, ameliorating, or reducing ophthalmic conditions or diseases by administering to an eye of an individual in need thereof an effective amount of an ophthalmic composition as described herein.

Abstract: Provided herein are steroid containing compositions suitable for providing therapeutically effective amounts of at least one steroid to individuals. Also provided herein are compositions comprising testosterone and/or testosterone derivatives suitable for providing therapeutically effective and safe amounts of testosterone over periods of time. Further provided are methods of treating andro- and/or testosterone deficiency in individuals by administering to the individuals compositions described herein.

Abstract: The present invention relates to the use of a galactooligosaccharide composition for preventing or reducing the risk of developing metabolic syndrome.

Abstract: The present invention relates to a composition comprising an araloside-based compound and, more particularly, to a composition for external application to skin, the composition comprising, as an active component, an araloside-based compound, including araloside X, araloside V and araloside VII. Thus, the composition restores skin markers damaged by external environmental stress, such as harmful substances or fine dusts, and reduces the expression of skin inflammatory factors to help the recovery of damaged skin, thereby providing effects, such as anti-oxidation, skin trouble suppression, anti-inflammation, or skin barrier improvement.

Abstract: The present invention provides the use of Cimicifugae rhizoma triterpenoid saponin extract, Cimicifugae rhizoma, actein, deoxyactein, or a composition formed by actein and deoxyactein in the preparation of a medicament or a functional health product for autoimmune diseases. The present invention also provides a pharmaceutical composition for autoimmune diseases and a pharmaceutical composition for inhibiting inflammatory cytokines. The invention provides new applications of Cimicifugae rhizoma triterpenoid saponin extract, Cimicifugae rhizoma, actein, deoxyactein, etc., and widens the application field of medicines or functional health products for autoimmune diseases. The raw materials source is plenty, the cost is low, and it has a broad market application value.

Abstract: A nicotinamide riboside composition and preparation method thereof, the icotinamide riboside composition comprises nicotinamide riboside and/or a salt thereof and konjac glucomannan or rebaudioside A. The nicotinamide riboside composition provided by the present invention, used to increase the concentration of NAD in cells, thereby preventing and improving various unhealthy conditions caused by NAD deficiency. is stable in property and easy to store and transport.

Abstract: The invention is directed to a method for treating a cancer patient by administering an agent that depletes intracellular ATP along with a purine analog, such as fludarabine. It is also directed to a method for selecting a patient having cancer cells susceptible to depletion of their intracellular ATP.

Abstract: The present invention provides novel compounds that target thrombocyte activity or aggregation capacity through cellular components for the treatment of diseases associated with Non-Alcoholic Fatty Liver Disease (NAFLD). The invention provides these compounds for treating non-alcoholic steatohepatitis (NASH), a progressed stage of NAFL (non-alcoholic fatty liver), in order to avoid the development of liver cirrhosis and Hepatocellular Carcinoma (HCC). Further provided are pharmaceutical compositions, comprising the compounds of the invention, and methods for screening new NASH therapeuticals.

Abstract: The present invention relates to RNAi agents, e.g., double stranded RNAi agents, targeting the Patatin-Like Phospholipase Domain Containing 3 (PNPLA3) gene, and methods of using such RNAi agents to inhibit expression of a PNPLA3 gene and methods of treating subjects having Nonalcoholic Fatty Liver Disease (NAFLD) and/or a PNPLA3-associated disorder.

Abstract: This application relates to potent oligonucleotides useful for reducing HBsAg expression and treating HBV infections.

Abstract: This application relates to potent oligonucleotides useful for reducing HBsAg expression and treating HBV infections.

Abstract: The present application relates to methods to administer to a patient a hypothermal inhalation gas composition that includes oxygen and a mixture of inert gases. The mixture of inert gases includes a first compound selected from xenon and argon, and a second compound having hypothermal properties, such as helium. In the methods, a gas composition including oxygen and a mixture of inert gases is selected and the gas composition is administered to the patient at an inhalation temperature of a specified range such that the body temperature of the patient is maintained within a specified temperature range.

Abstract: The present invention provides solid compositions of amorphous calcium carbonate (ACC) and a polyphosphate, bisphosphonate or pharmaceutical salts thereof as a stabilizer. Said stabilizers stabilizes the ACC and prevent crystallization to crystalline calcium carbonate ((?( (?) for a long period of time, even in an aqueous suspension. The invention further provides pharmaceutical composition comprising the solid ACC compositions as well their use in treating of certain diseases and conditions.

Abstract: The present invention provides compositions and methods of treating a leukemia, including chronic lymphocytic leukemia, wherein the method comprises administering a stabilized amorphous calcium carbonate to a person in need thereof.

Abstract: Provided herein are topical formulations containing copper ions and methods of treating inflammatory, microbial, and arthritic conditions in various areas of the body using such formulations. Methods of treating osteoarthritis using topical copper ion treatments are provided. Methods of treating and preventing microbial infections using copper ion treatments are further provided, including methods of preventing biofilm. A topical treatment in its basic form comprises a biocompatible copper ion solution or suspension obtained by leaching of the copper ions from copper metal. The copper ion solution or suspension is combined with various carriers to form the copper ion treatment including creams, gels, lotions, foams, pastes, tampons, solutions, suppositories, body wipes, wound dressings, skin patches, and suture material. Methods of making the copper ion solution or suspension from solid copper metal in a biocompatible solution are also provided.

Abstract: Methods for the reversal of hemorrhagic shock or hemorrhagic trauma. Methods for restoring mean arterial pressure to a normal range and reducing trauma adverse risks in a patient through the administration of oxygen reduced blood compositions.

Abstract: In an aspect, the present invention relates generally to the field of treating disease with CAR devices, Smart CAR devices, DE CAR devices, and/or Smart-DE CAR devices. The present invention also relates generally to the genetic modification of cytotoxic T-lymphocytes to reduce target cell killing by apoptosis and/or increase production of lytic proteins at desired times. In an aspect, the invention relates to the use of these genetically modified T-lymphocytes and/or natural killer cells with CAR devices, Smart CAR devices, DE CAR devices, and/or Smart-DE CAR devices to enhance the immune response against a disease.

Abstract: Chimeric antigen receptors containing BCMA antigen binding domains are disclosed. Nucleic acids, recombinant expression vectors, host cells, antigen binding fragments, and pharmaceutical compositions, relating to the chimeric antigen receptors are also disclosed. Methods of treating or preventing cancer in a subject, and methods of making chimeric antigen receptor T cells are also disclosed.

Abstract: The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.

Abstract: The present invention relates to peptides, proteins, nucleic acids and cells for use in immunotherapeutic methods. In particular, the present invention relates to the immunotherapy of cancer. The present invention furthermore relates to tumor-associated T-cell peptide epitopes, alone or in combination with other tumor-associated peptides that can for example serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses, or to stimulate T cells ex vivo and transfer into patients. Peptides bound to molecules of the major histocompatibility complex (MHC), or peptides as such, can also be targets of antibodies, soluble T-cell receptors, and other binding molecules.

Abstract: The present invention provides improved and/or shortened methods for expanding TILs and producing therapeutic populations of TILs, including novel methods for expanding TIL populations in a closed system that lead to improved efficacy, improved phenotype, and increased metabolic health of the TILs in a shorter time period, while allowing for reduced microbial contamination as well as decreased costs. Such TILs find use in therapeutic treatment regimens.

Abstract: The present invention provides improved and/or shortened methods for expanding TILs and producing therapeutic populations of TILs, including novel methods for expanding TIL populations in a closed system that lead to improved efficacy, improved phenotype, and increased metabolic health of the TILs in a shorter time period, while allowing for reduced microbial contamination as well as decreased costs. Such TILs find use in therapeutic treatment regimens.

Abstract: The present invention relates to administration of sweet whey protein (SWP) for promoting the enteric neuronal development in infants, especially preterm, low birth, very low and extremely low birth weight infants as well as in young children up until the age of six. Administration of the SWP according to the invention prevents and treats disorders associated with an immature or impaired enteric nervous system. The disorders are, notably, dysfunctional gastrointestinal motility manifested as slow intestinal transit, intestinal discomfort, hard stools, constipation and/or gastrointestinal reflux, gut barrier dysfunction, food intolerance or necrotizing enterocolitis.

Abstract: The invention provides improved methods for cell therapy. In particular, the invention provides therapeutic compositions of enhanced hematopoietic stem and progenitor cells having improved engraftment and homing properties, and methods of making the therapeutic compositions. The invention further provides methods of improving the efficacy of hematopoietic stem and progenitor cell transplantation including transplanting the therapeutic composition to subjects in need of hematopoietic system reconstitution.

Abstract: The present invention relates to a cell-based composition comprising a suspension of mesenchymal stem cells in crystalloid with a cellular concentration from 0.01 million to 3.0 million cells/ml. The cell-based composition is used in a form of medicament for treatment of diabetes and its associated metabolic disorders and complications.

Abstract: The present application provides an in-vitro committed differentiation method for inducing human induced pluripotent stem cells (hiPSCs) into Leydig cells (LCs) by neural crest stem cells (NCSCs). The hiPS-derived LCs is verified by an animal model to have the capacity of regenerating senile or injured LCs, so that a new treatment for supplementing testosterone is provided for patients suffering from hypogonadism, particularly for patients suffering from late-onset hypogonadism (LOH).

Abstract: The invention relates to the use of a bacterial mixture for the prevention and improvement of the state of ungulates suffering from pathologies involving a parasitic or bacterial infection of the foot, said composition comprising: at least one strain of bacteria of the genus Bacillus, and at least one lactic acid bacterium.

Abstract: The present invention concerns a lactic composition useful for the prevention or treatment of diarrhea such as antibiotic associated diarrhea or “tourista.” The composition according to the invention contains at least a bacterial strain selected from the group consisting of Lactobacillus acidophilus, Lactobacillus acidophilus I-1492, Lactobacillus casei and a mixture of thereof.

Abstract: A method comprising the stages of: olive input, separation of the stone from the olive skin and pulp, with the removal of the whole stone; electric pulsing of the olive paste generated in the previous stage, process of dehydration of the pulsed olive paste up to a humidity of less than 30% in a continuous vacuum drying machine and subsequent separation of the oil by centrifugation of the olive oil, followed by dehydration of the degreased pulp up to a humidity of less than 10%; and lastly, application of supercritical fluids (CO2 with or without modifier) to the degreased and dehydrated pulp, under agitation, pressure, temperature and time conditions, obtaining olive extracts and olive flour. The generation of waste, consumption of water, use of highly toxic solvents and loss of the sensory quality of the oil is avoided, the yields improved and the necessary times reduced.

Abstract: The present disclosure provides an extract of early-harvested Citrus reticulata fruit, and a method for reducing lipid accumulation by using the extract of early-harvested Citrus reticulata fruit. The extract of early-harvested Citrus reticulata fruit includes tetramethylisoscutellarein.

Abstract: The present invention discloses a composition comprising extracts of Cyperus rotundus, standardized to contain 3-5% w/w total stilbenes, extracts of Garcinia sp., standardized to contain 20% w/w garcinol and extracts of Coleus forskohlii standardized to contain not less than 10% w/w forskolin for the therapeutic management of diet induced obesity and weight gain and related conditions like liver dysfunction, NASH, NAFLD, liver cirrhosis, hypercholesterolemia, hyperlipidemia, kidney dysfunction by bringing about a reduction in body weight, increasing lean body mass and by normalizing the levels of liver enzymes, kidney markers and circulating lipids.

Abstract: Methods of treating acromegaly in a subject are described herein. Exemplary methods include orally administering to the subject at least once daily at least one dosage form comprising octreotide, wherein the octreotide in each dosage form is 20 mg, and wherein the administering occurs at least 1 hour before a meal or at least 2 hours after a meal.

Abstract: The invention relates to a healthcare product comprising (i) a component selected from the group of heat shock proteins from alfalfa and heat shock protein hydrolysates from alfalfa, the product further comprising imiquimod or a pharmaceutically acceptable salt or derivative thereof. Further, the invention relates to a healthcare product for use in the prophylactic or therapeutic treatment of a skin disorder. Further, the invention relates to HSP for use for use in preventing the occurrence of a negative-side effect of a treatment with imiquimod, or alleviating such side effect.

Abstract: The present invention relates to stable pharmaceutical compositions which contain polypeptides having at least two antigen-binding domains and are especially suited for subcutaneous administration. The invention provides liquid compositions which minimize the formation of undesired polypeptide aggregates (dimers and/or multimers). The present invention further provides a method for minimizing the aggregation of polypeptides having antigen-binding domains in liquid compositions.

Abstract: The present invention relates to methods of treating or preventing a complement-mediated disease and/or disorder in a subject with a complement C5 polymorphism, including administering to a subject in need thereof a therapeutically or prophylactically effective amount of an agent that a) inhibits the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibits eicosanoid activity. The invention also relates to methods of identifying patient populations with C5 polymorphisms that are treatable with specific agents that a) inhibit the classical complement pathway, the alternative complement pathway and the lectin complement pathway; and/or b) inhibit eicosanoid activity.

Abstract: The present invention relates to a pharmaceutical composition comprising, as an active ingredient, a fusion protein in which a tissue-penetrating peptide is fused to an anti-vascular endothelial growth factor agent, methods of treating eye diseases with the pharmaceutical composition, and a method for preparing an anti-VEGF agent with an improved efficacy and ability to overcome resistance.

Abstract: Disclosed are methods and pharmaceutical compositions for the treatment of kidney cancer. The inventors showed that while Elabela (ELA) is mostly expressed in kidney, its expression is reduced in human kidney cancer. In a xenograft animal model (sub-cutaneous, or sub-capsular injection) Ela inhibits tumor progression. In particular, there is disclosed a method of treating kidney cancer in a subject in need thereof including administering to the subject a therapeutically effective amount of an ELA polypeptide including an amino acid sequence having at least 90% of identity with SEQ ID NO: 1 (QRPVNLTMRRKLRKHNCLQRRCMPLHSRVPFP) wherein the arginine residue (R) at position 9, 10, 20 or 21 is optionally mutated.

Abstract: The present disclosure provides a method of treating diseases or disorders associated with CFTR protein dysfunction, including Cystic Fibrosis, by administering stable, long-lasting vasoactive intestinal peptide therapeutic agents. These agents include one or more elastin-like peptides and can be administered at a low-dose.

Abstract: This disclosure provides a composition containing a conjugate with a modified insulin molecule. The conjugate has an insulin molecule, which can be insulin or an insulin analog, glucagon, GLP-1, GLP-2 or a GLP-1 agonist. The conjugate also contains one or more polymers. Each of the one or more polymers is covalently linked to the insulin molecule. Additionally, each of the one or more polymers is covalently linked to between 0 to 50 copies of a decoy ligand, and to between 0 to 50 copies of a glucose-binding agent, such that the combined total number of glucose-binding agents and decoy ligands covalently linked to each of the one or more polymers is at least 1. The conjugate can reversibly bind to soluble glucose and in which the extent of its glucose-binding controls the extent to which the modified insulin is able to bind to and activate the insulin receptor. Methods of making the conjugate, as well as use of the conjugate in treatment, are also provided.

Abstract: Methods of treating an age-related disorder in a subject are provided. Aspects of the methods include administering to the subject a nucleic acid vector including a coding sequence for telomerase reverse transcriptase (TERT) and/or telomerase RNA (TR). Gene therapy methods are also provided. Aspects of the invention further include compositions, e.g., nucleic acid vectors and kits, etc., that find use in methods of the invention.

Abstract: The present invention provides, among other things, compositions and methods for CNS delivery of Idursulfase-beta, a human recombinant iduronate-2-sulfatase protein, for effective treatment of Hunter Syndrome. The compositions and methods provided by the present invention effectively reduce symptoms not only in brain and spinal cord but also in peripheral tissues including heart, liver, spleen, lung, and kidney.