24 Amino Acid Residues In Defined Sequence Patents (Class 530/325)
-
Patent number: 8334255Abstract: A compound of the formula X1-M-SEQ ID NO:1, or a derivative thereof, is provided, wherein X1-M- represents an optional group comprising a protein transduction domain conjugated to the N-terminus of the amino acid sequence SEQ ID NO:1. Pharmaceutical compositions comprising and therapeutic methods using the compound are also provided.Type: GrantFiled: December 4, 2007Date of Patent: December 18, 2012Assignees: Thomas Jefferson University, OyaGen Inc.Inventors: Hui Zhang, Harold C. Smith
-
Publication number: 20120316104Abstract: The present invention provides compositions and methods for killing or suppressing growth of Gram-negative bacteria that infect, infest or cause disease in plants, including pathogenic, saprophytic and opportunistic microbes that cause disease in plants and food borne illness in people or in animal feed.Type: ApplicationFiled: June 4, 2012Publication date: December 13, 2012Applicants: Unviersity of Florida Research Foundation, Inc., Integrated Plant Genetics, Inc.Inventors: Dean W. GABRIEL, Joseph D. Reddy
-
Publication number: 20120316113Abstract: The present invention relates to a polypeptide fragments of Fibroblast Growth Factor 2, wherein said fragments are adapted to bind to fibrinogen or to fibrin and/or increase cell proliferation, differentiation or migration. These fragments are suitable for promoting wound healing and/or hemostasis.Type: ApplicationFiled: May 2, 2012Publication date: December 13, 2012Applicants: Baxter Healthcare S.A., Baxter International Inc.Inventors: Heinz Redl, Tatjana Morton
-
Publication number: 20120316114Abstract: The present disclosure provides variants of C-type natriuretic peptide (CNP), pharmaceutical compositions comprising CNP variants, and methods of making CNP variants. The CNP variants are useful as therapeutic agents for the treatment of diseases responsive to CNP, including but not limited to bone-related disorders, such as skeletal dysplasias (e.g., achondroplasia), and vascular smooth muscle disorders (e.g., restenosis and arteriosclerosis).Type: ApplicationFiled: May 8, 2012Publication date: December 13, 2012Applicant: BIOMARIN PHARMACEUTICAL INC.Inventors: Daniel J. Wendt, Shinong Long, Sianna Castillo, Christopher P. Price, Mika Aoyagi-Scharber, Michel C. Vellard, Augustus O. Okhamafe
-
Publication number: 20120315321Abstract: The present invention relates to immunogenic compositions and peptides comprising residues 4-10 (FRHDSGY) of the amyloid peptide Abeta42. The invention further relates to antibodies that bind to the Abeta(4-10) antigenic determinant. The invention provides methods for treating Alzheimer's disease and for reducing the amyloid load in Alzheimers patients. The invention also relates to methods for designing small molecule inhibitors of amyloid deposition.Type: ApplicationFiled: March 29, 2012Publication date: December 13, 2012Applicant: MERCK SHARP & DOHME CORP.Inventors: Peter H. St. George-Hyslop, JoAnne McLaurin
-
Patent number: 8329144Abstract: A peptide analogue which is not more than 50 amino acids in length, and which is capable of being recognized by a T cell receptor that recognizes an epitope comprising sequence 62PQPELPY68 (SEQ ID NO:1), and fusion proteins, pharmaceutical compositions, and kits comprising the same, are provided herewith. Also provided are methods of diagnosing coeliac disease, or susceptibility to coeliac disease, in an individual comprising contacting a sample from the individual with a peptide analogue and determining in vitro whether T cells in the sample recognize the peptide analogue.Type: GrantFiled: November 3, 2006Date of Patent: December 11, 2012Assignee: Isis Innovation LimitedInventors: Robert Paul Anderson, Adrian Vivian Sinton Hill, Derek Parry Jewell
-
IMMUNOASSAY STANDARDS AND MEASUREMENT OF CLINICAL BIOMARKERS USING INTRA-ASSAY CALIBRATION STANDARDS
Publication number: 20120309028Abstract: The present invention provides novel compositions and methods for creating quantitative standards to calibrate analytes. These compositions and methods enable the creation of standards and calibrators for analyzing analytes and measuring clinical biomarkers. Also provided are kits comprising the novel compositions for use in assays, for example sandwich immunoassays.Type: ApplicationFiled: February 9, 2011Publication date: December 6, 2012Inventors: Paul Rhyne, Claudio Mapelli, Oi Tak Allen Wong, Flora Berisha, Robert John Neely -
Publication number: 20120308594Abstract: The current invention relates to a previously unrecognized clade of HCV genotypes as well as to diagnostic, prophylactic and therapeutic applications of nucleic acids, proteins, and antibodies to said protein, derived of or based on the newly characterized hepatitis C viruses.Type: ApplicationFiled: December 9, 2011Publication date: December 6, 2012Applicant: INNOGENETICSInventors: Erwin Sablon, Wim Quint, Leen-Jan Van Doorn
-
Publication number: 20120308638Abstract: The present invention provides novel therapeutic antimicrobial peptides that are bactericides and have an inhibitory effect on biofilms produced by biofilm-forming bacteria and especially biofilm-forming staphyloccocal bacteria. The invention includes the nucleic acids encoding the polypeptides, methods of treating bacterial infections, medical devices or implants or prosthetics impregnated with, covered or coated in the polypeptides, and means of delivery of the peptide to the oral cavity.Type: ApplicationFiled: December 16, 2010Publication date: December 6, 2012Inventors: Mathew Upton, Stephanie Sandiford
-
Patent number: 8323657Abstract: This invention provides a new tumor antigen having an epitope that induces a Th1 cell (a CD4-positive T cell specific to MAGE-A4), and a method ot application thereof.Type: GrantFiled: October 2, 2007Date of Patent: December 4, 2012Assignee: National University Corporation Hokkaido UniversityInventor: Takashi Nishimura
-
Publication number: 20120301434Abstract: The present invention discloses polypeptides with antibacterial properties and use said polypeptides and/or polynucleotides encoding said polypeptides in the preparation of medicament for the treatment of infectious diseases. The inventors also provide vectors encoding and adapted for expression of the polypeptides and polynucleotides of the invention. The vectors may be used in the preparation of a medicament for the treatment of bacterial infections. Further, the vector of the invention may be used to reduce the load of bacteria in food and/or feed.Type: ApplicationFiled: October 4, 2010Publication date: November 29, 2012Applicant: OSLO UNIVERSITETSSYKEHUS HFInventors: Ragnhild Weel-Sneve, James Alexander Booth, Magnar Bjørås, Knut Ivan Kristiansen
-
Publication number: 20120302650Abstract: The current disclosure provides for specific peptides from the Insulin-Like Growth Factor 1 Receptor (IGF-1R) protein and the derived ionization characteristics of those peptides that are advantageous for quantifying the IGF-1R directly in formalin fixed biological samples by the method of Selected Reaction Monitoring (SRM) mass spectrometry. Such fixed biological samples include: formalin-fixed tissue/cells, formalin-fixed/paraffin embedded (FFPE) tissue/cells, FFPE tissue blocks and cells from those blocks, and formalin fixed and paraffin embedded tissue culture cells. IGF-1R protein is quantitated in biological samples by the method of SRM/MRM mass spectrometry by quantitating one or more of the peptides described herein. The peptides can be quantitated if they reside in a modified or an unmodified form. Examples of potentially modified forms of an IGF-1R peptides include those bearing phosphorylation of a tyrosine, threonine, serine, and/or other amino acid residues within the peptide sequence.Type: ApplicationFiled: June 21, 2012Publication date: November 29, 2012Applicant: EXPRESSION PATHOLOGY, INC.Inventors: David B. Krizman, Todd Hembrough, Sheeno Thyparambil
-
Publication number: 20120302509Abstract: The present invention relates to compositions comprising peptides that may be variants, derivatives and structural equivalents of cupredoxins that inhibit the development of premalignant lesions in mammalian cells, tissues and animals. Specifically, these compositions may comprise azurin from Pseudomonas aeruginosa, and/or the 50-77 residue region of azurin (p28). The present invention further relates to compositions that may comprise cupredoxin(s), and/or variants, derivatives or structural equivalents of cupredoxins, that retain the ability to inhibit the development of premalignant lesions in mammalian cells, tissues or animals. These compositions may be peptides or pharmaceutical compositions, among others. The compositions of the invention may be used to prevent the development of premalignant lesions in mammalian cells, tissues and animals, and thus prevent cancer.Type: ApplicationFiled: July 23, 2012Publication date: November 29, 2012Applicant: The Board of Trustees of the University of IllinoisInventors: Tapas Das Gupta, Ananda Chakrabarty
-
Patent number: 8318174Abstract: MHC Class I-restricted peptides derived from the tumor associated antigen, survivin, which peptides are capable of binding to Class I HLA molecules at a high affinity, capable of eliciting INF-?-producing cells in a PBL population of a cancer patient and capable of in situ detection of cytotoxic T cells in a tumor tissue, therapeutic and diagnostic composition comprising the peptide and uses thereof.Type: GrantFiled: January 30, 2004Date of Patent: November 27, 2012Assignee: Survac APSInventors: Evind Per Thor Straten, Mads Hald Andersen
-
Publication number: 20120294879Abstract: Pandemic A(H1N1) continues its global spread, and vaccine production is a serious problem. Protection by current vaccines is limited by the mutational differences that rapidly accumulate in the circulating strains, especially in the virus surface proteins. New vaccine strategies are focusing at conserved regions of the viral internal proteins to produce T cell epitope-based vaccines. T cell responses have been shown to reduce morbidity and promote recovery in mouse models of influenza challenge. We previously reported 54 highly conserved sequences of NP, M1 and the polymerases of all human H1N1, H3N2, H1N2, and H5N1, and avian subtypes over the past 30 years. Sixty-three T cell epitopes elicited responses in HLA transgenic mice (A2, A24, B7, DR2, DR3 and DR4). These epitopes were compared to the 2007-2009 human H1N1 sequences to identify conserved and variant residues.Type: ApplicationFiled: October 13, 2010Publication date: November 22, 2012Applicants: NATIONAL UNIVERSITY OF SINGAPORE, THE JOHNS HOPKINS UNIVERSITYInventors: J. Thomas August, Paul ThiamJoo Tan, Tin Wee Tan, Mohammad Asif Khan
-
Publication number: 20120294924Abstract: Disclosed are peptide-lipid conjugates that bind lipopolysaccharide. Also disclosed are methods of making and using the peptide-lipid conjugates.Type: ApplicationFiled: April 24, 2012Publication date: November 22, 2012Inventors: THOMAS TICE, TORSTEN WOEHR
-
Publication number: 20120295280Abstract: The present invention provides novel citrullinated peptides, their use in methods for aiding, assisting, improving, or facilitating the diagnosis or prognosis of rheumatic diseases such as rheumatoid arthritis (RA), and methods for identifying novel citrullinated peptides that are immunoreactive with anti-citrullinated protein antibodies (ACPAs). The present invention also provides methods for detecting rheumatoid factor (RF) using novel RF detection reagents as a means to aid, assist, improve, or facilitate the diagnosis or prognosis of rheumatic diseases such as RA. Kits comprising at least one of the novel citrullinated peptides and/or RF detection reagents of the present invention are also provided.Type: ApplicationFiled: September 21, 2011Publication date: November 22, 2012Applicant: Prometheus Laboratories Inc.Inventors: Nicholas Chi-Kwan Ling, Shui Long Wang, Dunrui Wang, Sharat Singh
-
Publication number: 20120295990Abstract: The current disclosure provides for specific peptides from the Insulin Receptor Substrate 1 (IRS1) protein and the derived ionization characteristics of those peptides that are advantageous for quantifying IRS1 directly in formalin fixed biological samples by the method of Selected Reaction Monitoring (SRM) mass spectrometry. Such fixed biological samples include: formalin-fixed tissue/cells, formalin-fixed/paraffin embedded (FFPE) tissue/cells, FFPE tissue blocks and cells from those blocks, and formalin fixed and paraffin embedded tissue culture cells. IRS1 protein is quantitated in biological samples by the method of SRM/MRM mass spectrometry by quantitating one or more of the peptides described herein. The peptides can be quantitated if they reside in a modified or an unmodified form. Examples of potentially modified forms of IRS1 peptides include those bearing phosphorylation of a tyrosine, threonine, serine, and/or other amino acid residues within the peptide sequence.Type: ApplicationFiled: June 21, 2012Publication date: November 22, 2012Applicant: EXPRESSION PATHOLOGY, INCInventors: David B. KRIZMAN, Todd Hembrough, Sheeno Thyparambil
-
Publication number: 20120282217Abstract: Provided herein is a nucleic acid comprising consensus amino acid sequence of foot-and-mouth disease FMDV VP1-4 coat proteins of FMDV subtypes A, Asia 1, C, O, SAT1, SAT2, and SAT3 as well as plasmids and vaccines expressing the sequences. Also provided herein is methods for generating an immune response against one or more FMDV subtypes using the vaccine as described above as well as methods for deciphering between vaccinated mammals with the vaccine and those that are infected with FMDV.Type: ApplicationFiled: November 2, 2010Publication date: November 8, 2012Inventors: David B. Weiner, Bernadette Ferraro, Jian Yan, Patricia A. Brown, Rodney A. Bowling, Douglas R. Kern, Mathura P. Ramanathan, Niranjan Y. Sardesai, Karuppiah Muthumani
-
Publication number: 20120283411Abstract: Compositions and related methods for treating IBS and other gastrointestinal disorders and conditions (e.g., gastrointestinal motility disorders, functional gastrointestinal disorders, gastroesophageal reflux disease (GERD), duodenogastric reflux, Crohn's disease, ulcerative colitis, inflammatory bowel disease, functional heartburn, dyspepsia (including functional dyspepsia or nonulcer dyspepsia), gastroparesis, chronic intestinal pseudo-obstruction (or colonic pseudoobstruction), disorders and conditions associated with constipation, e.g., constipation associated with use of opiate pain killers, post-surgical constipation, and constipation associated with neuropathic disorders and disorders and conditions associated with excess fluid and/or salt retention as well as other conditions and disorders are described. The compositions feature polypeptides that activate the guanylate cyclase C (GC-C) receptor.Type: ApplicationFiled: June 27, 2007Publication date: November 8, 2012Applicant: IRONWOOD PHARMACEUTICALS, INC.Inventors: Mark G. Currie, Daniel P. Zimmer
-
Publication number: 20120282274Abstract: The disclosure provides specific and sensitive anti-toxin B antibodies and fragments thereof suitable for diagnosing Clostridium difficile infection. The antibodies and fragments recognize an epitope in the C-terminal 250-amino-acid region of toxin B of C. difficile, including epitopes defined by protein repeat sequences in this region of toxin B. This disclosure also provides the toxin B-specific epitope in the C-terminal 250-amino-acid region of toxin B of C. difficile for use in vaccine development as well as in the treatment of CDI disease and in treatment of the relapse of CDI disease. Also provided are toxin B polypeptides lacking the cytotoxic domain useful in treating or preventing CDI disease. PCR-based diagnostic assays targeting the 750-nucleotide region at the 3? end of tcdB are also provided.Type: ApplicationFiled: November 22, 2010Publication date: November 8, 2012Applicant: NORTHSHORE UNIVERSITY HEALTH SYSTEM RESEARCH INSTITUTEInventors: Jian-Ping Jin, Lance R. Peterson
-
Publication number: 20120276107Abstract: The present invention provides a Mycoplasma pneumoniae community acquired respiratory distress syndrome (CARDS) toxin, biologically active fragments/domains of the CARDS toxin, antibodies to the CARDS toxin and nucleic acids encoding the CARDS toxin. Also provided are methods of diagnosing, treating and/or preventing infection by Mycoplasma pneumoniae using the compositions provided herein.Type: ApplicationFiled: December 29, 2011Publication date: November 1, 2012Inventors: Joel Barry Baseman, Thirumalai Regasamy Kannan
-
Publication number: 20120277158Abstract: The present invention is directed to conjugates that include a polypeptide capable of crossing the blood-brain barrier or entering one or more cell types attached to a transport vector, i.e., a composition capable of transporting an agent (e.g., a therapeutic agent). In certain cases, the polypeptides are directly conjugated to a lipid or polymeric vector to allow targeted application of a therapeutic agent to treat, for example, a cancer, a neurodegenerative disease, or a lysosomal storage disorder.Type: ApplicationFiled: October 5, 2010Publication date: November 1, 2012Applicant: Angiochem Inc.Inventors: Jean-Paul Castaigne, Michel Demeule, Christian Che, Anthony Regina
-
Patent number: 8299032Abstract: A self-assembling peptide containing a polar amino acid residue and a nonpolar amino acid residue, wherein the self-assembling peptide contains an acidic amino acid residue and a basic amino acid residue as the polar amino acid residues, a total sum of charge of the acidic amino acid residue and charge of the basic amino acid residue in a neutral region is the number excluding 0, and the self-assembling peptide is capable of forming a beta (?)-sheet structure in which only the nonpolar amino acid residue is arranged on one face upon self-assembly in an aqueous solution.Type: GrantFiled: June 26, 2006Date of Patent: October 30, 2012Assignee: Menicon Co., Ltd.Inventors: Hidenori Yokoi, Takatoshi Kinoshita
-
Patent number: 8298835Abstract: The present invention identifies biomarkers that are diagnostic of nerve cell injury, organ injury, and/or neuronal disorders. Detection of different biomarkers of the invention are also diagnostic of the degree of severity of nerve injury, the cell(s) involved in the injury, and the subcellular localization of the injury.Type: GrantFiled: June 11, 2008Date of Patent: October 30, 2012Assignee: University of Florida Research Foundation, Inc.Inventors: Ka-Wang (Kevin) Wang, Ming Chen Liu
-
Publication number: 20120271033Abstract: Disclosed are methods for identifying high affinity adaptor molecules that bind to both a circulating antibody and a target molecule and redirect the specificity of the circulating antibody to the target molecule. Exemplary high affinity adaptor molecules are also provided.Type: ApplicationFiled: October 5, 2010Publication date: October 25, 2012Applicant: OPSONIC THERAPEUTICS INC.Inventors: Albert Collinson, Peter Wagner, Matti Sällberg, Anders Vahlne, Gregor Schürmann, Robert Kamen
-
Publication number: 20120270808Abstract: Embodiments of the invention include methods for selecting in parallel (i.e., synchronously or simultaneously) peptides that target a number of organs, in which each peptide targets distinct tissues or organs. Typically, the methods of the invention provide for peptide selection in a Minimal number of subjects and still provides a selectively binding peptide. In certain aspects, methods of identifying peptides that bind to multiple selected tissues or organs of an organism may comprise the steps of administering a phage display library to a first subject; obtaining a sample of two or more selected tissues; obtaining phage displaying peptides that bind to the samples from the first subject; enriching for peptides by administering phage isolated from the samples of the first subject to a second subject; obtaining a sample of two or more selected tissues from the second subject; and identifying the peptides displayed.Type: ApplicationFiled: April 4, 2012Publication date: October 25, 2012Inventors: Mikhail Kolonin, Wadih Arap, Renata Pasqualini
-
Publication number: 20120270811Abstract: A series of peptides with divergent confirmations including structures of formula (1A), (1B), (2) and (3) are provided. In the formula, wherein U, G, A, B, R1, R2 and T are as defined in the specification. The divergent peptides disclosed in the present invention are characterized in a mineral binding affinity function.Type: ApplicationFiled: October 21, 2011Publication date: October 25, 2012Applicant: KAOHSIUNG MEDICAL UNIVERSITYInventors: Hui-Ting Chen, Kuang-Chan Hsieh, Je-Ken Chang, Gwo-Jaw Wang, Yin-Chih Fu, Mei-Ling Ho, Cherng-Chyi Tzeng
-
Publication number: 20120263654Abstract: Described are melanoma specific biomarkers comprising the nucleic acid sequence of the Engrailed-2 (EN2) gene or the amino acid sequence of the encoded EN2 protein. Also described are uses of the biomarkers in the treatment, diagnosis, monitoring and imaging of melanoma.Type: ApplicationFiled: July 13, 2010Publication date: October 18, 2012Inventors: Richard Morgan, Hardev S. Pandha
-
Patent number: 8288336Abstract: Novel ApoE peptide derivatives and ApoE-protein transduction domain conjugates are disclosed which are useful for treating disorders including subarachnoid hemorrhage, intracerebral hemorrhage, and intraventricular hemorrhage and other brain disorders. The invention encompasses methods for treating cerebral vasospasm by administration of at least one ApoE or ApoE mimetic peptide.Type: GrantFiled: October 10, 2011Date of Patent: October 16, 2012Assignee: Cognosci, Inc.Inventors: Michael P. Vitek, Daniel T. Laskowitz
-
Patent number: 8288335Abstract: Novel ApoE peptide derivatives and ApoE-protein transduction domain conjugates are disclosed which are useful for treating disorders including CNS inflammation, traumatic brain injury, inflammatory bowel disease (also known as Crohn's Disease or ulcerative colitis), cerebral ischemia, atherosclerosis, sepsis, multiple sclerosis and arthritic diseases, Alzheimer's Disease and other brain disorders. The invention encompasses methods for protecting subjects having undergone irradiation or radiotherapy by administration of ApoE or at least one ApoE mimetic peptide.Type: GrantFiled: April 28, 2011Date of Patent: October 16, 2012Assignee: Cognosei, Inc.Inventors: Michael P. Vitek, Suzanne E. McKenna
-
Patent number: 8288334Abstract: The present invention relates to new peptides, pharmaceutical composition and cosmetic composition including them and their use for wound healing.Type: GrantFiled: June 14, 2010Date of Patent: October 16, 2012Assignee: Gene Signal International SAInventors: Salman Al-Mahmood, Sylvie Colin
-
Publication number: 20120251502Abstract: Compositions and methods including and related to the Ebola Bundibugyo virus (EboBun) are provided. Compositions are provided that are operable as immunogens to elicit and immune response or protection from EboBun challenge in a subject such as a primate. Inventive methods are directed to detection and treatment of EboBun infection.Type: ApplicationFiled: October 26, 2009Publication date: October 4, 2012Applicant: The Government of the US as Represented by the Secretary of the Dept. of healthInventors: Jonathan S. Towner, Stuart T. Nichol, James A. Comer, Thomas G. Ksiazek, Pierre E. Rollin
-
Publication number: 20120244184Abstract: A modified peptide derived from matrix protein 2 (hereinafter also referred to as “M2”), one of surface layer proteins of influenza virus, and a method for utilization of the modified peptide are provided. A peptide (hereinafter also referred to as “M2eC peptide”) that is made up by inserting cysteine residue(s) into a peptide (hereinafter also referred to as “M2e”) consisting of 23 amino acid residues of from positions No. 2 to No.Type: ApplicationFiled: August 23, 2010Publication date: September 27, 2012Applicant: THE CHEMO-SERO-THERAPEUTIC RESEARCH INSTITUTEInventors: Kazuyoshi Kaminaka, Chikateru Nozaki, Junichi Matsuda, Kiyoto Nishiyama
-
Publication number: 20120245097Abstract: Disclosed herein is a synthetic peptide, which has an amino acid sequence that has 20-39 amino acid residues. The synthetic peptide has at least 80% amino acid sequence identity to SEQ ID NO: 1, and includes at least 20 consecutive residues that has at least 90% amino acid sequence identity to residues 11-30 of SEQ ID NO: 1. Also disclosed herein are compositions containing the synthetic peptide and applications thereof. According to various embodiments of the present disclosure, the synthetic peptide is useful in promoting stem cells proliferation or wound healing.Type: ApplicationFiled: March 23, 2012Publication date: September 27, 2012Inventors: Yeou-Ping Tsao, Tsung-Chuan Ho
-
Publication number: 20120245091Abstract: The present invention relates to a polypeptide derived from a highly conserved region (HCR) I-III of an extracellular region of a CD99 and CD99 family such as CD99L2 and PBDX (or XG), which are a kind of transmembrane protein, or a fused protein thereof. The polypeptide or the fused protein thereof has an activating function of inhibiting the extravasation of white blood cells, or inhibiting the growth and/or metastasis of cancer cells. The present invention also provides a polynucleotide coding the polypeptide, a vector including same, and a transformant transformed by the vector. In addition, the present invention provides a pharmaceutical composition including the polypeptide or the fused protein thereof for preventing or treating inflammatory diseases. Further, the present invention provides a pharmaceutical composition including the polypeptide or the fused protein thereof inhibiting the growth and/or metastasis of cancer cells, i.e., a pharmaceutical composition for preventing or treating cancer.Type: ApplicationFiled: August 24, 2010Publication date: September 27, 2012Applicant: SUPADELIXIR INC.Inventors: Jang-Hee Hahn, Kyoung-Jin Lee, Sun-Hee Lee, Hyun-Mi Ju
-
Patent number: 8273337Abstract: Peptides have been identified that bind with high affinity to hair. Peptide-based hair reagents formed by coupling a hair-binding peptide to a benefit agent are described. The peptide-based hair reagents include peptide-based hair conditioners and hair colorants. The peptide-based hair conditioners and hair colorants are comprised of at least one hair-binding peptide coupled to a hair conditioning agent or a coloring agent, respectively.Type: GrantFiled: August 26, 2008Date of Patent: September 25, 2012Assignees: E I du Pont de Nemours and CompanyInventors: R. Edward Benson, Stephen R. Fahnestock, Paul Hamilton, John P. O'Brien, Hong Wang
-
Publication number: 20120237501Abstract: Anti-HIV peptides and methods of use are provided. In particular, these HIV inhibitory peptides are discovered based on the Antimicrobial Peptide Database.Type: ApplicationFiled: October 19, 2010Publication date: September 20, 2012Inventor: Guangshun Wang
-
Publication number: 20120238503Abstract: The present invention relates to human laminin ?2 chain LG3 domain and active peptides promoting cell adhesion, spreading, migration, and neurite outgrowth. More particularly, it was found that when nerve cells are incubated using human laminin ?2 chain LG3 domain and active peptides in the LG3 domain, cell adhesion, spreading, migration, and neurite outgrowth of nerve cells promote and the promotion of cell adhesion, spreading, migration, and neurite outgrowth of nerve cells are integrin-mediated and achieved by the activation of PKC? and FAK phosphorylation. Thus, the present invention can be very useful for researches on cell adhesion, spreading, migration, and neurite outgrowth activities of cells which are focused on nerve cells and mediated by various extracellular matrix proteins including laminin, manufacture of artificial nerve conduits, burns treatment, wounds treatment, and tissue regeneration.Type: ApplicationFiled: March 12, 2012Publication date: September 20, 2012Applicant: SNU R&DB FOUNDATIONInventor: Byung-Moo MIN
-
Publication number: 20120232012Abstract: The invention generally features compositions and methods that are useful for modulating blood vessel formation, as well as methods that provide for the systematic and efficient identification of angiogenesis modulators. As described in more detail below, a systematic computational methodology based on bioinformatics was used to identify novel peptide modulators of angiogenesis that have been characterized in vitro and/or in vivo.Type: ApplicationFiled: February 8, 2012Publication date: September 13, 2012Applicant: The Johns Hopkins UniversityInventors: Aleksander S. Popel, Emmanouil D. Karagiannis
-
Patent number: 8263741Abstract: The present invention provides a fibronectin type III (Fn3) molecule, wherein the Fn3 contains a stabilizing mutation. The present invention also provides Fn3 polypeptide monobodies, nucleic acid molecules encoding monobodies, and variegated nucleic acid libraries encoding such monobodies. Also provided are methods of preparing a Fn3 polypeptide monobody, and kits to perform the methods.Type: GrantFiled: July 11, 2001Date of Patent: September 11, 2012Assignee: Research Corporation Technologies, Inc.Inventor: Shohei Koide
-
Publication number: 20120225820Abstract: Antigenic peptides that bind to MHC Class II molecules with the shared epitope referred to as HLA-DR molecules are disclosed. More specifically, are citrullinated antigenic peptides having an increased affinity for HLA-DR molecules and associated with rheumatoid arthritis. These novel peptides provide the basis for new methods of diagnosis and treatment of rheumatoid arthritis.Type: ApplicationFiled: May 15, 2012Publication date: September 6, 2012Applicant: LONDON HEALTH SCIENCES CENTRE RESEARCH INC.Inventors: Jonathan Hill, Ewa Cairns, David Bell
-
Publication number: 20120225442Abstract: The invention relates to new peptides and to their use in the diagnosis of celiac disease.Type: ApplicationFiled: October 1, 2010Publication date: September 6, 2012Inventor: Karl Skriner
-
Publication number: 20120219972Abstract: The present invention provides an isolated Ehrlichia peptide and therapeutic and diagnostic uses therefor.Type: ApplicationFiled: January 31, 2012Publication date: August 30, 2012Applicant: The Board of Regents of The University of Texas SystemInventors: Sunil Thomas, David H. Walker
-
Publication number: 20120219575Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.Type: ApplicationFiled: May 7, 2012Publication date: August 30, 2012Inventors: Gregory Alan Stoloff, Wilson Romero Capparros-Wanderley
-
Patent number: 8247378Abstract: This invention provides for a 9 mer peptide (CTPSPFSHC SEQ ID NO:1) that selectively binds to the tumor vasculature supporting tumors of the alimentary canal. The homing peptide has both diagnostic and therapeutic uses.Type: GrantFiled: July 27, 2010Date of Patent: August 21, 2012Assignee: The Chinese University of Hong KongInventors: Chi Hin Cho, Zhi Jie Li
-
Publication number: 20120207778Abstract: The invention provides proteins from group B streptococcus (Streptococcus agalactiae) and group A streptococcus (Streptococcus pyogenes), including amino acid sequences and the corresponding nucleotide sequences.Type: ApplicationFiled: February 16, 2012Publication date: August 16, 2012Applicants: J. CRAIG VENTER INSTITUTE, INC., NOVARTIS VACCINES AND DIAGNOSTICS S.R.L.Inventors: John Telford, Vega Masignani, Immaculada Margarit Y Ros, Guido Grandi, Claire Fraser, Hervé Tettelin
-
Publication number: 20120207776Abstract: Homologs of the E. coli proteins orf353, bacterial lg-like domain (group 1) protein (orf405), flu antigen 43 (orf1 364), NodT-family outer-membrane-factor-lipoprotein efflux transporter (orf1 767), gspK (orf3515), gspJ (orf3516), toriB-dependent siderophore receptor (orO597), fibrial protein (orf3613), upec-948, upec-1232. A chain precursor of the type-1 fimbria! protein (upec-1875), yapH homolog (upec-2820), hemolysin A (recp-3768), and Sel 1 repeat-containing protein (upec-521 1) from several pathogenic strains of E. coli have been identified with regions within the proteins that are conserved across all E. coli. Fragments corresponding to the conserved regions, especially immunogenic fragments such a linear B-epitopes, are provided.Type: ApplicationFiled: July 7, 2010Publication date: August 16, 2012Applicant: NOVARTIS AGInventors: Laura Serino, Danilo Gomes Moriel, Maria Rita Fontana
-
Publication number: 20120201840Abstract: EphA2 T-cell epitope are provided herein. The epitopes include peptides corresponding to specific fragments of human EphA2 protein containing one or more T-cell epitopes, and conservative derivatives thereof. The EphA2 T-cell epitopes are useful in an assay, such as an ELISPOT assay, that may be used to determine and/or quantify a patient's immune responsiveness to EphA2. The epitopes also are useful in methods of modulating a patient's immune reactivity to EphA2, which has substantial utility as a treatment for cancers that overexpress EphA2, such as renal cell carcinoma (RCC). The EphA2 epitopes also can be used to vaccinate a patient against EphA2, by in vivo or ex vivo methods.Type: ApplicationFiled: January 20, 2012Publication date: August 9, 2012Inventors: Walter J. Storkus, Michael S. Kinch
-
Publication number: 20120189608Abstract: The present invention relates to a polypeptide with an amino acid sequence according to SEQ ID NO: 1 and fragments or derivatives thereof. The present invention further relates to fusion proteins comprising said polypeptide and an additional peptide stretch fused to said polypeptide at the N- or C-terminus. Moreover, the present invention relates to nucleic acid molecules encoding said polypeptide or fusion protein, vectors comprising said nucleic acid molecules and host cells comprising either said nucleic acid molecules or said vectors. In addition, the present invention relates to said polypeptide or fusion protein for use as a medicament, in particular for the treatment or prevention of Gram-negative bacterial infections, as diagnostic means, as cosmetic substance or as sanitizing agent.Type: ApplicationFiled: August 24, 2010Publication date: July 26, 2012Inventors: Yves Briers, Rob Lavigne, Maarten Walmagh, Stefan Miller