Abstract: The present invention relates to compounds of a general formula (I) having photoluminescence properties. The present invention also relates to applications, such as protein imaging tools, involving such compounds.

Abstract: This document provides methods and materials related to polypeptides present in a vaccinia virus (e.g., membrane proteins such as vaccinia virus B5R, L1R, A33R, or A27L polypeptides). For example, methods for generating a vaccine comprising one or more of vaccinia virus polypeptides disclosed herein for preventing or treating Orthopoxvirus infection are provided. In addition, kits related to the use of vaccinia polypeptides are provided.

Abstract: The present invention relates to immunogenic peptides of Chikungunya Virus and methods for vaccinating a subject using these peptides. Also disclosed are nucleic acids encoding these peptides and methods for their production.

Abstract: Novel peptides having antimicrobial activity, and compositions containing the same.

Abstract: The present invention provides isolated stabilized EPO-derived peptides and their mimics that protect against tissue damage in subjects having diverse forms of neural and non-neural organ system injury, pharmaceutical compositions containing the isolated stabilized EPO-derived peptides, methods for treating symptoms of a disease, disorder or condition having an inflammatory or an autoimmune component in a subject in need thereof, and methods for downregulating immune mediator activity in a subject in need thereof.

Abstract: A purified anti-cancer peptide consisting of amino acids 266 to 287 of Genbank Accession No. O68604 (SEQ ID No. 4), and modified and homologous forms of the peptide are described. The modified or and homologous forms of the peptide include more than contiguous amino acids having at least 75% amino acid sequence identity with at least 8 contiguous amino acids of amino acids 266-287 of Genbank Accession No. O68604 (SEQ ID No. 4) defining a motif selected from the group consisting of RRRVQQ (SEQ ID No. 5) and RGRAK (SEQ ID No. 1). The peptide(s) can be produced by B. linens, a Brevibacterium commonly used in the production of cheese. There is also provided method for prophylaxis or treatment of cancer in a mammal, comprising treating the mammal with an effective amount of the peptide, or a protein the pepsin cleavage of which yields the peptide.

Abstract: Peptides derived from cancer specific isoform of proliferating cell nuclear antigen (caPCNA, also known as csPCNA) or from nmPCNA-interacting proteins interfere with intracellular protein-protein interaction, thereby causing a reduction in the proliferative potential of cancer. These peptides serve as therapeutic compositions to reduce the proliferation of cancer cells and also augment existing chemotherapeutic methods.

Abstract: The present invention relates to compositions comprising peptides for preventing or treating allergy to house dust mites, and in particular to optimal combinations of peptides for preventing or treating said allergy.

Abstract: An HLA-A*1101-restricted WT1 peptide, specifically, a peptide comprising an amino acid sequence consisting of 9 contiguous amino acids from a WT1 protein, wherein the peptide has an ability to bind to an HLA-A*1101 molecule, and has an ability to induce a CTL is described. A peptide dimer having an ability to bind to an HLA-A*1101 molecule and having an ability to induce a CTL, in which two peptide monomers each comprising an amino acid sequence cons sting of 9 contiguous amino acids from a WT1 protein and comprising at least one cysteine residue are bound to each other through a disulfide bond is also described. Furthermore, a polynucleotide encoding the peptide, a pharmaceutical composition for the treatment and/or prevention of a cancer comprising the same and the like are provided.

Abstract: Provided is treatment of urinary tract infections including bladder infections caused by uropathogenic bacterial strains such as for example Escherichia coli with a beta-hairpin antimicrobial Arenicin polypeptide derived from the murine polychaeta Arenicola marina. Also provided are variants of Arenicin for treatment of urinary tract infections.

Abstract: A method of treating a neurodegenerative disorder is disclosed. The method comprises administering to the subject a therapeutically effective amount of an isolated peptide comprising at least 3 amino acids of a CD44V10 amino acid sequence no more than 20 amino acids of said CD44V10 amino acid sequence and comprising a neuroprotective activity.

Abstract: The invention provides tight junction protein modulators, compositions comprising the same, and uses thereof. In particular, the invention provides tight junction protein modulators that modulate the second extracellular loop of tight junction proteins, such as occludin or claudin.

Abstract: Compositions and methods that are useful for modulating blood vessel formation, as well as methods that provide for the systematic and efficient identification of angiogenesis modulators are described. As discussed in more detail below, a systematic computational methodology based on bioinformatics was used to identify novel peptide modulators of angiogenesis that have been characterized in vitro and/or in vivo.

Abstract: The present invention relates to peptides having one or more stable, internally-constrained HBS ?-helices, where the peptide is capable of interacting with Ras and related proteins.

Abstract: The present invention relates generally to tissue differentiation factor (TDF) analogs. More specifically, the invention relates to structure-based methods and compositions useful in designing, identifying, and producing molecules which act as functional modulators of TDF-like receptors. The invention further relates to methods of detecting, preventing, and treating TDF-associated disorders.

Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of said antibodies.

Abstract: The present invention relates to peptides, nucleic acids, and cells for use in the immunotherapy of cancer. The present invention furthermore relates to survivin-derived tumor-associated cytotoxic T cell (CTL) peptide epitopes, alone or in combination with other tumor-associated peptides that serve as active pharmaceutical ingredients of vaccine compositions that stimulate anti-tumor immune responses. The present invention specifically relates to three novel peptide sequences and variants thereof derived from HLA class I and class II molecules of human tumor cells that can be used in vaccine compositions for eliciting anti-tumor immune responses.

Abstract: The present invention provides synthetic cell platforms. The synthetic cell platforms can be used for culturing cells in vitro. The synthetic cell platforms can also be implanted together with bound cells into an individual. The present invention provides methods of using the platforms to provide cells or progeny of such cells for use in various applications, including clinical applications; and methods of use of the platforms to introduce cells into an individual.

Abstract: The present invention relates to a biomarker for the detection of brain damage or a disease associated with loss of neurons, said biomarker comprising a protein fragment of the neurofilament heavy chain (NfH) protein in a biological sample, wherein said protein fragment is a polypeptide selected from the group consisting of i) a polypeptide having the amino acid sequence selected from the group consisting of SEQ ID NO:1, SEQ ID NO:2, SEQ ID NO:3, SEQ ID NO:4, SEQ ID NO:5, and polypeptides composed of amino acids 476-1026 and 476-986 of SEQ ID NO 6; ii) a protein fragment of the NfH protein having an amino acid sequence that is at least 60% identical to SEQ ID NO:1, at least 60% identical to SEQ ID NO:2, at least 60% identical to SEQ ID NO:3, at least 60% identical to SEQ ID NO:4, at least 60% identical to SEQ ID NO:5; or at least 60% identical to a polypeptide composed of amino acids 476-1026 and.

Abstract: A method of treating metastatic cancer, comprising the steps of (a) treating a metastatic cancer patient with an isolated therapeutic Cystatin C peptide, and (b) observing a reduction in tumor burden is disclosed.

Abstract: The present invention relates to an immunogenic composition comprising an antigenic peptide of formula (I) below: Nt-S—X1-X2-X3-K—X4-Ct (I) [SEQ ID No 1], wherein—Nt consists of a peptide having from 0 to 50 amino acids in length, —Ct consists of a peptide having from 0 to 50 amino acids in length, —each of X1 to X4 consists of an amino acid residue, wherein: —(i) X1 means the specific amino acid W or (ii) X1 means any amino acid residue excepted W, —(i) X2 means the specific amino acid S or (ii) X2 means any amino acid residue excepted S, —(i) X3 means the specific amino acid N or (ii) X3 means any amino acid residue excepted N, —(i) X4 means the specific amino acid S or (ii) X4 means any amino acid residue excepted S, with the proviso that—three out of the four amino acid residues X1, X2, X3 and X4 mean the specific amino acid defined in their respective meaning (i) above, and—the remaining amino acid residue among X1 to X4 means any amino acid residue excepted the specific amino acid residue defined in its

Abstract: The present invention relates to selected proline-rich peptides of salivary derivation with a strong antiviral activity and also an anti-reservoir activity with respect to the HIV virus, said peptides as medicaments for the treatment, prevention and eradication of HIV on human beings, pharmaceutical compositions comprising at least one of said peptides, pharmaceutical kits comprising at least one of said peptides and therapeutic methods for the treatment, prevention and eradication of HIV on human beings.

Abstract: The disclosure relates to compositions and methods of mitigating tissue damage and fibrosis in a patient by modulating latent transforming growth factor beta binding protein (LTBP4)-induced proteolysis of a TGF? superfamily protein.

Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of the antibodies.

Abstract: The present invention is directed to diagnostic methods based upon the detection of peptides derived from the degradation of CA125. In particular, it is concerned with assays of urine samples collected from women for the purpose of determining whether they are at increased risk for having ovarian cancer, have decreased their risk as the result of clinical or non-clinical procedures, to monitor the efficacy of a treatment method, or to determine whether cancer has recurred or advanced.

Abstract: Described is a method of fabricating biologically active, unnatural polypeptides. The method includes the steps of selecting a biologically active polypeptide or biologically active fragment thereof having an amino acid sequence comprising ?-amino acid residues, and fabricating a synthetic polypeptide that has an amino acid sequence that corresponds to the sequence of the biologically active polypeptide, but wherein about 14% to about 50% of the ?-amino acid residues found in the biologically active polypeptide or fragment of step (a) are replaced with ?-amino acid residues, and the ?-amino acid residues are distributed in a repeating pattern.

Abstract: A generic structure for the peptides of the present invention includes A-X-B-C, where C is a cargo moiety, the B portion includes basic amino acids, X is a cleavable linker sequence, and the A portion includes acidic amino acids. The intact structure is not significantly taken up by cells; however, upon extracellular cleavage of X, the B-C portion is taken up, delivering the cargo to targeted cells. Cargo may be, for example, a contrast agent for diagnostic imaging, a chemotherapeutic drug, or a radiation-sensitizer for therapy. Cleavage of X allows separation of A from B, unmasking the normal ability of the basic amino acids in B to drag cargo C into cells near the cleavage event. X is cleaved extracellularly, preferably under physiological conditions. D-amino acids are preferred for the A and B portions, to minimize immunogenicity and nonspecific cleavage by background peptidases or proteases.

Abstract: What is provided is EPO mimetic peptide derivatives defined as formula (I) and their pharmaceutical salts, the preparation thereof, wherein R1, R2, R3, R4, R5, n1, n2 are defined as described in description. A composition comprising of an EPO mimetic peptide derivative defined as formula (I) and its pharmaceutical salt. The uses of the derivatives and their pharmaceutical salts, as well as the uses of the compositions described above in treatment of diseases characterized by a deficiency of EPO or a low or defective red blood cell population.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of the antibodies.

Abstract: The present invention relates to new peptides and to use thereof, in particular for treatment and/or prevention of infections, inflammations, pain, wounds, scar and/or tumours.

Abstract: The present invention relates to peptides of the enolase protein from Staphylococcus aureus as well as nucleic acid and nucleic acid sequence homologues encoding the peptides. The present invention also relates to a composition, particularly a S. aureus vaccine, comprising one or more of the enolase peptides described herein or a fragment, derivative or variant thereof capable of generating an immune response that induces a protective antibody response or opsonophagocytic activity of human neutrophils for S. aureus. The present invention also encompasses methods of treating and/or reducing the likelihood of a Staphylococcus infection by administering a composition of the invention.

Abstract: This document relates to methods and materials for treating diseases or disorders associated with elevated platelet counts (e.g., essential thrombocythemia, secondary thrombocytosis, congenital amegakaryocytic thrombocytopenia, sepsis, or asplenism) as well as methods and materials for treating diseases or disorders associated with elevated platelet adhesion to collagen (e.g., acute coronary syndromes, angina pectoris, chronic atherosclerosis, diabetes, or hypertension).

Abstract: A method of treatment of inflamed, pre-cancerous or cancerous tissue or polyps in a mammalian subject is disclosed. The treatment involves administration of a composition of at least one peptide agonist of a guanylate cyclase receptor and/or other small molecules that enhance intracellular production of cGMP. The at least one peptide agonist of a guanylate cyclase receptor may be administered either alone or in combination with an inhibitor of cGMP-dependent phosphodiesterase. The inhibitor may be a small molecule, peptide, protein or other compound that inhibits the degradation of cGMP. Without requiring a particular mechanism of action, this treatment may restore a healthy balance between proliferation and apoptosis in the subject's population of epithelial cells, and also suppress carcinogenesis.

Abstract: Drug-polymer chemotherapeutics are provided having improved therapeutic efficacy and reduced dose-limiting toxicity. Methods are also provided for modulating the architecture, pharmacokinetics and biodistribution of drug-polymers and for reducing the dependence of transition temperature on concentration for drug-polymers.

Abstract: The present invention includes compositions, methods and kits for the identification of a polypeptide that binds to a predetermined RNA sequence. The invention comprises, in part, a photoreactive moiety to aid in identification of such a polypeptide.

Abstract: The present invention relates to peptides derived from the proinflammatory cytokines, interleukin-1? (IL1?) and tumor necrosis factor ? (TNF?), and their use in human or veterinary therapy, such as to generally treat diseases linked to the overproduction of IL1? or TNF? as well as acute or chronic inflammatory diseases, rheumatoid arthritis, septic shock, autoimmune diabetes, graft rejection in the host, etc.

Abstract: The present invention relates to a peptide of linear, non-cyclic structure consisting of or comprising 17 to 23 amino acids, wherein the amino acids in positions 1 to 23, counted from the N-terminus, are as follows (1) G, S or lacking; (2) C or lacking; (3) K or R; (4) K or R; (5) Y, W or F; (6) K or R; (7) K or R; (8) F, W or L; (9) K or R; (10) K or L or lacking; (11) W, L or F; (12) K or R; (13) F, Y or C; (14) K or R; (15) G or Q; (16) K or R; (17) F, L or W; (18) F or W; (19) F, L or W; (20) W or F; (21) C or lacking; (22) F or G or lacking (23) G or lacking. Further, the invention relates to a nucleic acid molecule encoding the peptide of the invention, an expression vector comprising the nucleic acid molecule of the invention, a host cell which may be grown in cell culture comprising the vector of the invention, and a method of producing the peptide of the invention comprising culturing the host cell of the invention and collecting the peptide produced.

Abstract: Object is to provide a method of constructing a library of peptides having, at a desired position in the random sequence of each peptide, an amino acid having a portion capable of binding to a target. The invention provides a method of producing a library of peptides having, at a designated position in the random sequence of each peptide, a special amino acid having a portion capable of binding to a target, including (i) preparing a library of mRNAs having, in the mRNA sequence coding for a random amino acid sequence, a base sequence having an altered codon encoding the special amino acid, (ii) preparing an aminoacyl tRNA with the special amino acid linked to a tRNA encoded by the altered codon, and (iii) translating the mRNAs by using a cell-free translation system containing the aminoacyl tRNA to obtain a library of peptides having, in the random sequence thereof, a predetermined special amino acid.

Abstract: DNA constructions that provide for production of potent antifungal proteins in transgenic plants and transformed yeast cells are described. Methods of using the DNA constructs to produce transgenic plants that inhibit growth of plant pathogenic fungi are also disclosed. The use of transformed yeast cells containing the DNA constructs to produce the antifungal proteins and methods of isolating the antifungal proteins are also described.

Abstract: Here provided are a pharmaceutical composition containing an X-DING-CD4 peptide, a derivative of the X-DING-CD4 peptide, or a combination thereof a method for preventing or treating a pathological condition in a subject using the above pharmaceutical composition; and a process of making the above pharmaceutical composition. Also provided are isolated X-DING-CD4 cDNAs and isolated X-DING-CD4 peptides. Further provided are the composition and method for cell-based therapy using polynucleotides encoding X-DING-CD4 peptide, its derivative, or a combination thereof.

Abstract: Provided herein are polypeptides comprising or consisting essentially of a QSYDNTLSGSYVF (SEQ ID NO:1) or LSADSSGSYLYVF (SEQ ID NO:2) amino acid sequence. Also provided herein are methods of treating or preventing cast nephropathy in a subject. The methods comprise identifying a subject with or at risk of developing cast nephropathy and administering to the subject any of the polypeptides disclosed herein.

Abstract: Compositions and methods are provided including a transporter peptide derived from the loop2 domain of the neuronally-derived lynx1 protein which can be conjugated to an effector agent to form a transporter-effector complex for transport of the therapeutic effector agent to a target that is found across the blood brain barrier.

Abstract: We have disclosed affinity peptides toward BMP-2. More specifically we have disclosed an affinity biomatrix where the affinity peptide is covalently attached to a biocompatible, biodegradable polymer. The affinity biomatrix is useful in preparing controlled release devices for BMP-2.

Abstract: The present invention provides inventive stitched polypeptides, pharmaceutical compositions thereof, and methods of making and using inventive stitched polypeptides.

Abstract: Embodiments of the invention are described, including materials and methods for making molecules and materials that have a specific binding domain of a PlGF2. Embodiments include, for instance, medicaments, biomaterials, biomolecules, molecular fusions, and vaccines.

Abstract: The present invention provides peptides having an amino acid sequence as set forth in SEQ ID NO: 19, 22, 30, 34, 344, 358, 41, 44, 46, 48, 78, 376, 379, 80, 100, 101, 110, 111, 387, 112, 394, 114, 116, 117, 121, 395, 133, 135, 137, 426, 143, 147, 148, 149, 150, 152, 153, 154, 156, 160, 161, 162, 163, 166, 174, 178, 186, 194, 196, 202, 210, 213, 214, 217, 223, 227, 228, 233, 254, 271, 272 or 288, as well as peptides having the above-mentioned amino acid sequences in which 1, 2, or several (e.g., up to 5) amino acids are substituted, deleted, or added, provided the peptides possess cytotoxic T cell inducibility. The present invention also provides drugs for treating or preventing a disease associated with over-expression of the CDH3, EPHA4, ECT2, HIG2, INHBB, KIF20A, KNTC2, TTK and/or URLC10, e.g. cancers containing as an active ingredient one or more of these peptides. The peptides of the present invention find further utility as vaccines.

Abstract: Compositions that include isolated peptides that inhibit TLR-4 signaling pathways and inflammation are disclosed. Methods of producing and using the compositions to inhibit TLR-4 signaling and/or inflammation are also disclosed herein.

Abstract: The present invention relates to a method of reducing the numbers of eosinophils in a human subject comprising administration to a subject an IL-5R binding molecule that comprises (a) a region that specifically binds to the IL-5R and (b) an immunoglobulin Fc region. In a specific embodiment, a method of the invention reduces the number of eosinophils in blood, bone marrow, gastrointestinal tract (e.g. esophagus, stomach, small intestine and colon), or lung.

Abstract: Derivatives of the peptide corresponding to the sequence RIHMVYSKRSGKPRGYAFIEY (SEQ ID NO: 1), pharmaceutical compositions, and methods of use thereof are provided.