Abstract: The invention relates to purinergic (P2X) receptors, more specifically to P2X7 receptors, the generation of antibodies and the use of antibodies and immunogens that are capable of selectively binding to a non ATP-binding P2X7 receptor but not to an ATP-binding P2X7 receptor, for the detection and treatment of disease conditions, especially cancer.

Abstract: A peptide or peptidomimetic comprising the amino acid sequence KKRLSVXLTSSLFR (SEQ ID NO: 1) or the inverse thereof, or comprising at least eight contiguous amino acids of helix C of ?-catenin (SEQ ID NO: 41) or inverse thereof, wherein the peptide or peptidomimetic comprises a total of about 50 or fewer amino acids and inhibits the Wnt pathway, as well as a method of inhibiting the Wnt pathway in a cell, a method of treating or preventing a disease mediated by the Wnt pathway, and related compounds, compositions, and methods.

Abstract: The invention provides novel guanylate cyclase-C agonist peptides and their use in the treatment of human diseases including gastrointestinal disorders, inflammation or cancer (e.g., a gastrointestinal cancer). The peptides can be administered either alone or in combination with an inhibitor of cGMP-dependent phosphodiesterase. The gastrointestinal disorder may be classified as either irritable bowel syndrome, constipation, or excessive acidity etc. The gastrointestinal disease may be classified as either inflammatory bowel disease or other GI condition including Crohn's disease and ulcerative colitis, and cancer.

Abstract: The present invention relates to diagnosis, prevention and treatment of Herpes simplex viruses and infection. In particular embodiments the present invention relates to methods and compositions for the prophylactic or therapeutic immunization against of infections of HSV. The present invention also relates to methods and compositions for diagnosis of the presence of and level of immunity to HSV. The invention also relates to peptide epitopes of HSV, in particular peptide epitopes of HSV2 glycoprotein D, to compositions thereof and to the use of such epitopes and compositions in methods for diagnosis, prevention and treatment of HSV.

Abstract: The present invention relates generally to tissue differentiation factor (TDF) analogs. More specifically, the invention relates to structure-based methods and compositions useful in designing, identifying, and producing molecules which act as functional modulators of TDF-like receptors. The invention further relates to methods of detecting, preventing, and treating TDF-associated disorders.

Abstract: Antibodies containing one or more modular recognition domains (MRDs) that can be used to target the antibodies to specific sites are described. The use of antibodies containing one or more modular recognition domains to treat disease, and methods of making antibodies containing one or more modular recognition domains are also described.

Abstract: Antibodies containing one or more modular recognition domains (MRDs) that can be used to target the antibodies to specific sites are described. The use of antibodies containing one or more modular recognition domains to treat disease, and methods of making antibodies containing one or more modular recognition domains are also described.

Abstract: The present invention is directed to prostate specific antigen (PSA) and tumor endothelial marker 8 (TEM8) peptide compositions and methods for treating cancer with the compositions.

Abstract: The present invention provides a compound including a peptidomimetic which interacts sterically with the binding site of a F11R molecule, the peptidomimetic including a peptidomimetic having the SEQ ID NO: 4D. The present invention also provides a method for treating a disorder comprising administering peptide 4D to a mammal.

Abstract: The present invention relates to a method for activating helper T cells, which includes the step of activating helper T cells by adding a WT1 peptide to antigen presenting cells, wherein the WT1 peptide has the ability to bind to any MHC class II molecule of an HLA-DRB1* 0101 molecule, an HLA-DRB1* 0401 molecule, an HLA-DRB1* 0403 molecule, an HLA-DRB1* 0406 molecule, an HLA-DRB1* 0803 molecule, an HLA-DRB1* 0901 molecule, an HLA-DRB1* 1101 molecule, an HLA-DRB3* 0202 molecule, an HLA-DRB4* 0101 molecule, an HLA-DPB1* 0201 molecule or an HLA-DPB1* 0301 molecule, and the like.

Abstract: A new biomarker, a peptide having sequence SSKITHRIHWESASLLR*, wherein the side chain of the C-terminal arginine denoted with the asterisk is lacking the NH2-C?NH moiety normally present in the side chain. Usefulness of the biomarker in the diagnosis of neurological and/or neuropsychiatric disorders (in particular autism) is disclosed, as well as are methods for determining the concentration of the new biomarker and antibodies directed to the new biomarker. Treatment of autism, comprising administering a complement factor I inhibitor to the subject.

Abstract: Described herein is a peptide, referred to as a GlycoTag peptide, that includes repeats of an N-linked glycosylation sequon that is naturally present in C. jejuni. The GlycoTag peptide can be in a purified and isolated form following expression of a construct encoding the GlycoTag peptide or it is, in whole or in part, a synthetic peptide. The GlycoTag peptide is typically used with glycans attached thereto. The GlycoTag peptide can be used alone or in combination with different proteins or peptides and can be incorporated into a chimeric protein or peptide for use in the development of antigen/antibody delivery systems, the preparation of vaccines, pharmaceuticals and diagnostic tests, and research into therapies for countering Campylobacter and other infections.

Abstract: The present invention discloses compositions of peptide inhibitors of protein synthesis, and methods of identifying peptide inhibitors that are capable of inhibiting protein synthesis through an interaction at a stem-loop H18 in 16S rRNA of a 30S ribosomal subunit. Screening methods for peptides are disclosed, in addition to methods of determining the affinity of a test compound for a ribosomal subunit.

Abstract: Methods for treating a condition associated with proteoglycan production in a mammal are provided. The methods comprise the administration of at least one of a calmodulin antagonist, a transient receptor potential (TRP) channel inhibitor and a calmodulin-binding peptide to the mammal.

Abstract: A nanoparticle-polypeptide complex comprising a bioactive polypeptide in association with a nanoparticle, wherein the bioactive polypeptide is modified by the addition of a chemical moiety that facilitates cellular uptake of the protein. The polypeptide can be a protein or a peptide. In some embodiments, the amino acid sequence of the protein or peptide is derived from the amino acid sequence of a tumor suppressor gene product.

Abstract: The invention provides methods for identifying a HLA-B*0702-restricted cryptic epitope in an antigen, as well as methods for increasing the immunogenicity of HLA-B*0702-restricted cryptic epitopes. The HLA-B*0702-restricted cryptic epitopes and their cognate immunogenic epitopes are useful for stimulating an immune reaction against the cryptic epitopes in a subject. Accordingly, the invention further provides pharmaceutical compositions comprising a HLA-B*0702-restricted cryptic epitope or a cognate immunogenic epitope thereof, and vaccination kits comprising such epitopes. The novel materials of the invention are particularly useful for efficiently treating patients having an HLA-B*0702 phenotype.

Abstract: The present invention relates to peptides which are formulated or engineered to prevent or reduce the formation of dimers.

Abstract: The invention provides pharmaceutical compositions and method for inhibiting growth of prostatic adenocarcinoma, stomach cancer, breast cancer, endometrial, ovarian or other cancers of epithelial secretion, or benign prostate hyperplasia (BPH). In one embodiment the pharmaceutical composition includes human rHuPSP94, antigenic portions thereof, and functionally equivalent polypeptides thereof. In another embodiment, the pharmaceutical composition includes a mixture of human rHuPSP94, antigenic portions thereof, and functionally equivalent polypeptides thereof and an anticancer drug which may be administered in an appropriate dosage form, dosage quantity and dosage regimen to a patient suffering from, for example of prostatic adenocarcinoma, stomach cancer, breast cancer, endometrial, ovarian or other cancers of epithelial secretion, benign prostate hyperplasia, or (BPH) gastrointestinal cancer.

Abstract: The invention provides for methods and compositions for treatment of pain via craniofacial mucosal administration of an analgesic compound (e.g. a non-opioid analgesic peptide, an NOP agonist or N/OFQ). Intranasal administration of certain analgesic peptides such as N/OFQ results in global analgesic effects.

Abstract: The present invention relates to a tyrosine kinase-inducible domain (pKID) and uses thereof. An isolated polypeptide comprising the pKID, and an isolated polynucleotide comprising a nucleic acid sequence encoding the pKID are provided. Also provided are methods for determining tyrosine kinase and/or phosphatase activity in a sample and for identifying an agent that inhibits a tyrosine kinase or phosphatase using a polypeptide comprising the pKID.

Abstract: The present invention relates to compositions comprising peptides for preventing or treating allergy to cats, and in particular to optimal combinations of peptides.

Abstract: The present invention relates to the phosphohistidine analogs of the present invention which of the formula (I) and the hapten containing the residue of same. It also relates to the hapten conjugated to a carrier molecule and the isolated antibodies raised against the immunogens, said antibodies recognizing polypeptide containing a phosphorylated histidine or the phosphotriazole residue but it does not recognize an amino acid or polypeptide that is not phosphorylated or a polypeptide which is phosphorylated on amino acids other than histidine but not on histidine.

Abstract: The present invention concerns the use of a phosphopeptide able to block HER3/p85 interaction for the treatment of HER2 hyper-expressing tumours, such as, for example, metastatic mammary tumour, possibly in combination with other anti-tumour agents like, for example, trastuzumab

Abstract: The application discloses peptides capable of preventing or treating fungal disease, including fungal allergy disease.

Abstract: Disclosed herein are isolated human monoclonal antibodies, and functional fragments thereof, that specifically bind HMW-MAA. Nucleic acids encoding these antibodies, expression vectors including these nucleic acid molecules, and isolated host cells that express the nucleic acid molecules are also disclosed. The antibodies can be used to detect HMW-MAA in a sample. Methods of diagnosing cancer, or confirming a diagnosis of cancer, are disclosed herein that utilize these antibodies. Methods of treating a subject with cancer are also disclosed.

Abstract: Complexes containing one or more modular recognition domains (MRDs) and MRDs attached to scaffold's including antibodies are described. The manufacture of these complexes are the use of these complexes to treat and diagnose diseases and disorders are also described.

Abstract: The present invention relates to the field of radiopharmaceuticals for in vivo imaging, in particular to a method of labelling a biological targeting molecule with a radioisotope. The method of the invention is particularly suitable for use with an automated synthesizer apparatus. Also provided are precursors in sterile form, as well as cassettes comprising such precursors useful in the method.

Abstract: The instant invention comprises a process for the solid phase synthesis of directed epitope peptide mixtures useful in the treatment and diagnosis of protein conformational disorders, such process defined by a set of rules regarding the identity and the frequency of occurrence of amino acids that substitute a base or native amino acid of a known epitope. The resulting composition is a mixture of related peptides for therapeutic use. The invention also pertains to the process of generating antibodies using the directed epitope peptide mixtures as the antigens, and antibodies generated by such process, useful in the treatment and diagnostics of the said protein conformational disorder.

Abstract: The present invention relates to an injectable bone regeneration material containing a bone formation enhancing peptide, and more particularly, to an injectable bone regeneration material, in which a bone formation enhancing peptide essentially containing one and more amino acid sequences among SEQ ID NO: 1 to SEQ ID NO: 28 is bonded or mixed to a gel-forming base material selected from the group consisting of chitosan, alginic acid, silk fibroin, propylene glycol, propylene glycol alginic acid, poloxamer, chondroitin sulphate, and the combination thereof. The injectable bone regeneration material according to the present invention can increase differentiation of bone marrow stromal cells and osteoblasts into bone tissue, thus maximizing tissue regeneration by a peptide capable of promoting differentiation of bone tissue and periodontal tissue regeneration. The injectable bone regeneration material is in the form of a gel, and thus can be applied to a surface of various medical devices such as implant etc.

Abstract: The present invention provides a novel membrane protein molecular weight marker.

Abstract: The present invention is related to new peptide antagonists of ?v?3 receptor, designed on the basis of the crystal structure of integrin ?v?3 in complex with c(RGDf[NMe]V) and the NMR structure of echistatin. These peptides are potent and selective antagonists of the ?v?3 receptor and can be used as novel anticancer drugs and/or new class of diagnostic non-invasive tracers as suitable tools for ?v?3-targeted therapy and imaging.

Abstract: Treatments employing the matricellular protein thrombospondin-1 (TSP-I) and related compositions are disclosed for stabilizing atherosclerotic plaque and decreasing occurrence of plaque rupture events leading to, for example, myocardial infarction, stroke, and acute limb ischemia. Various peptides, including certain synthetic peptides, related to TSP-I are also disclosed. Such peptides have utility in stabilizing plaque in various contexts, including the disease states mentioned above. Some of these peptides include one or more sequences related to active sites of TSP-I for regulating, e.g., TGF-ss1 and MMP-9 activity. Experimental data show that a representative peptide provides a beneficial effect with systemic injection of the peptide.

Abstract: The present invention refers to a novel circovirus as causative agent of bone marrow aplasia with haemorrhagic disease in cattle. The present invention provides novel nucleic acid and protein sequences for diagnostic and therapeutic uses.

Abstract: Provided is a multimeric peptide comprising at least two peptide monomers linked to one another, each of the at least two peptide monomers comprising at least 6 consecutive amino acids from the amino acid sequence as set forth in SEQ ID NO: 1, wherein the at least two peptide monomers are each no longer than 30 amino acids, wherein the multimeric peptide is capable of reducing binding of Placenta Immunomodulatory Factor (PLIF) to human leukocytes.

Abstract: The present invention relates to radiopharmaceutical imaging in vivo of apoptosis and other forms of cell death. The invention provides PET imaging agents which target apoptotic cells via selective binding to the aminophospholipid phosphatidylethanolamine (PE), which is exposed on the surface of apoptotic cells. Also provided are pharmaceutical compositions, kits and methods of in vivo imaging.

Abstract: The present invention refers to the use of gene sequences or portions thereof characterized in that the same belong to the classes of in vitro and ex vivo induced, repressed or conserved genes in Mycobacterium tuberculosis currently infected human macrophages and to corresponding peptides or consensus peptides or proteins for the preparation of specific bio-markers for the diagnosis and prevention of active or latent disease.

Abstract: The invention describes peptide analogues of ?-melanocyte-stimulating hormone (?-MSH), which possess an increased efficacy compared to the native ?-MSH peptide. The ?-MSH analogues exhibit increased anti-inflammatory effects and increased capability to prevent ischemic conditions compared to ?-MSH. The invention further discloses use of the peptides for the manufacture of pharmaceutical compositions for the treatment or prophylaxis of a condition in the tissue of one or more organs of a mammal, and moreover pharmaceutical compositions.

Abstract: The present invention provides peptides containing the amino acid sequence of SEQ ID NOs: 1, 2, 3, 4, 16, 17, 30, 31, 34, 36, 37, 40, 41, 45, 49, 55, 57 and 61, as well as peptides containing the above-mentioned amino acid sequences in which 1, 2, or several amino acid(s) are substituted, deleted, inserted or added, but still have cytotoxic T cell inducibility. The present invention also provides drugs for treating or preventing tumors, which drugs containing these peptides. The peptides of the present invention can also be used as vaccines.

Abstract: The present invention provides therapies, vaccines, and predictive methods for infectious salmon anemia virus and provides compounds for diagnosing, preventing, and treating outbreaks of infectious salmon anemia virus including compounds for diagnosing, preventing, and treating infectious salmon anemia across different strains of virus.

Abstract: The present invention relates to a method for manufacturing a gold core/insulator shell nanostructure and a novel peptide used in the method. The method of the present invention is a biomimetic synthetic method using a silica-polymerizing peptide having a high affinity onto the surface of gold.

Abstract: A purified polypeptide, designated ULIP6, comprising the amino acid sequence SED ID No. 2 or an epitopic fragment of said polypeptide, comprising the sequence SEQ ID No. 4, is provided along with its nucleic acid sequences. In addition, antibodies to the polypeptide and methods of diagnosing paraneoplastic neurological syndromes and/or for the early diagnosis of the formation of cancerous tumors are also provided.

Abstract: The invention relates to composition comprising a pharmaceutically effective amount of one or more functional vasoactive intestinal peptide (VIP) fragments, and the use of those compositions in the treatment of fibrosis, hypertension and other disorder.

Abstract: The disclosure provides peptide compounds that regulate the complement system and methods of using these compounds. Specifically the disclosure provides an isolated, purified peptide of 30 amino acids derived from human astrovirus protein, called CP1. The peptide compounds disclosed include peptide mimetics, peptide analogs and/or synthetic derivatives of CP1 having, for example, internal peptide deletions and/or substitutions, deletions and/or substitutions at the N-terminus and C-terminus, and that are able to regulate complement activation. The disclosure further provides pharmaceutical compositions comprising therapeutically effective amounts of the peptide compounds and a pharmaceutically acceptable carrier, diluent, or excipient for treating a disease or condition associated with complement-mediated tissue damage.

Abstract: The invention relates to a peptidomimetic of an NPC-1 epitope on the MUC5AC protein which is differentially expressed in pancreatic and colorectal cancer, and diagnostic and therapeutic usages. Further, antibodies that selectively bind the NPC-1 epitope peptidomimetics and may be used in diagnostic and therapeutic methods.

Abstract: The present application is directed to a peptides comprising an a-helix forming-amino acid sequence that binds a heat shock protein. Also included is a polypeptide comprising (a) a first peptide portion that comprises an ?-helix-forming amino acid sequence that binds a heat shock protein; and (b) at least one second peptide portion comprising an antigenic amino acid sequence and/or an a-helix-stabilizing amino acid sequence that increases the interaction of the first peptide portion with the heat shock protein. The present application also includes compositions comprising the peptides and/or polypeptides of present application and uses of the peptides and/or polypeptides of the present application for fractionating substances relevant for discovery, research or clinical analysis from a biological sample and as therapeutics.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: Disclosed are compositions and methods related to improving pharmacological properties of bioactive compounds targeting nervous system.

Abstract: The present invention relates to a method of treating a subject for an infectious disease. This method involves selecting a subject infected with an infectious disease-causing agent. The infectious disease-causing agent elicits, in the selected subject, an immune response that is insufficient to cure the selected subject of the infectious disease. The method also involves administering to the selected subject a synthetic peptide representing an antigen epitope associated with an immune response to the infectious agent. The immune response to the synthetic peptide is sufficient to treat the selected subject for the infectious disease.

Abstract: The present invention relates a prophylactic or therapeutic composition for cancer, and more particularly, to a pro-phylactic or therapeutic composition for cancer comprising a peptide which is represented by an amino acid sequence of the following Formula (I), a method for preventing or treating cancer comprising the step of administering the peptide to a subject, and use of the peptide in the preparation of the prophylactic or therapeutic composition for cancer. (I) APKAMX1LLX2X3L-LX4LQKKGI wherein X1, X2, X3 and X4 are each independently R or K.

Abstract: The present invention provides polypeptide inhibitors of HSP27 kinase, compositions thereof, and methods for using such polypeptides and compositions for various therapeutic uses.