Patents Examined by Ganapathirama Raghu
  • Patent number: 11028413
    Abstract: The invention relates to the production of one or more terpenoids through microbial engineering, and relates to the manufacture of products comprising terpenoids.
    Type: Grant
    Filed: March 5, 2020
    Date of Patent: June 8, 2021
    Assignees: Massachusetts Institute of Technology, National University of Singapore
    Inventors: Parayil K. Ajikumar, Gregory Stephanopoulos, Heng Phon Too
  • Patent number: 11021724
    Abstract: The subject invention concerns materials and methods for alkene reduction of compounds, such as levoglucosenone (LGO) and (S)-?-hydroxymethyl-?,?-butenolide (HBO), using an alkene reductase enzyme. In one embodiment, a method of the invention comprises alkene reduction of a target compound by reacting the compound with an Old Yellow Enzyme (OYE) that reduces alkene bonds. In one embodiment, the OYE is OYE 2.6 from Pichia stipites and comprises the amino acid sequence of SEQ ID NO: I. In a specific embodiment, the enzyme is an Old Yellow Enzyme (OYE) 2.6 mutant having an amino acid substitution at position 78 in the sequence, wherein the tyrosine at position 78 is substituted with a tryptophan amino acid (Y78W) and is designated as OYE 2.6 Y78W (SEQ ID NO:2).
    Type: Grant
    Filed: March 29, 2018
    Date of Patent: June 1, 2021
    Assignees: University of Florida Research Foundation, Inc., AfroParisTech
    Inventors: Jon Dale Stewart, Florent Allais, Louis Michel Marie Mouterde
  • Patent number: 11021729
    Abstract: The present invention provides engineered ketoreductase and phosphite dehydrogenase enzymes having improved properties as compared to a naturally occurring wild-type ketoreductase and phosphite dehydrogenase enzymes, as well as polynucleotides encoding the engineered ketoreductase and phosphite dehydrogenase enzymes, host cells capable of expressing the engineered ketoreductase and phosphite dehydrogenase enzymes, and methods of using the engineered ketoreductase and phosphite dehydrogenase enzymes to synthesize a chiral catalyst used in the synthesis of antiviral compounds, such as nucleoside inhibitors. The present invention further provides methods of using the engineered enzymes to deracemize a chiral alcohol in a one-pot, multi-enzyme system.
    Type: Grant
    Filed: April 13, 2018
    Date of Patent: June 1, 2021
    Assignee: Codexis, Inc.
    Inventors: Jeffrey C. Moore, Jack Liang, Jonathan Penfield, Jovana Nazor, Nikki Dellas, Vesna Mitchell, Da Duan, Iman Farasat, Agustina Rodriguez-Granillo, Grant Murphy, Nicholas Marshall
  • Patent number: 11021722
    Abstract: There is provided SHC/HAC derivatives, amino acid sequences comprising the SHC/HAC derivatives, nucleotide sequences encoding the SHC/HAC derivatives, vectors comprising nucleotide sequences encoding the SHC/HAC derivatives, recombinant host cells comprising nucleotide sequences encoding the SHC/HAC derivatives and applications of the recombinant host cells comprising either SHC/HAC derivatives or WT SHC/HAC enzymes in methods to prepare (?)-Ambrox and SHC/HAC enzymes in methods to prepare (?)-Ambrox.
    Type: Grant
    Filed: October 10, 2019
    Date of Patent: June 1, 2021
    Assignee: GIVAUDAN S.A.
    Inventors: Eric Eichhorn, Boris Schilling, Denis Wahler, Laurent Fourage, Esther Locher
  • Patent number: 11021691
    Abstract: The present invention relates to a sucrose phosphorylase variant comprising or consisting of an amino acid sequence with at least 75% homologous and/or identical to an amino acid sequence of wild type sucrose phosphorylase, preferably wherein the sucrose phosphorylase is characterized by different structural and functional features. The invention also relates to method for preparing aG1P and a co-product, wherein the method comprises reacting a sucrose phosphorylase with a glucoside substrate, wherein the sucrose phosphorylase is a sucrose phosphorylase as defined in the context of the present invention.
    Type: Grant
    Filed: November 28, 2018
    Date of Patent: June 1, 2021
    Assignees: New Matterhorn, LLC, c-LEcta GmBH
    Inventors: Claudia Feller, Birgit Brucher, Andreas Vogel
  • Patent number: 11008369
    Abstract: Nucleic acid molecules encoding monomeric near-infrared fluorescent proteins, variants and derivatives thereof are provided, as well as proteins and peptides encoded by these nucleic acids. Also provided are proteins that are substantially similar to, or derivatives, homologues, or mutants of, the above-referenced specific proteins. Also provided are fragments of the nucleic acids and the peptides encoded thereby, specifically split fluorescent proteins. In addition, host-cells, stable cell lines and transgenic organisms comprising above-referenced nucleic acid molecules are provided. The invention also refers to methods of making and using monomeric fluorescent proteins derived from bacterial phytochromes. The subject protein and nucleic acid compositions find use in a variety of different applications and methods, particularly for labeling of biomolecules, cells or cell organelles, and for detecting protein-protein interactions. Finally, kits for use in such methods and applications are provided.
    Type: Grant
    Filed: September 11, 2019
    Date of Patent: May 18, 2021
    Assignee: Albert Einstein College of Medicine
    Inventors: Vladislav V. Verkhusha, Daria M. Shcherbakova, Mikhail Baloban
  • Patent number: 11001786
    Abstract: The present invention relates to protease variants and methods for obtaining protease variants. The present invention also relates to polynucleotides encoding the variants; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and methods of using the variants.
    Type: Grant
    Filed: January 30, 2020
    Date of Patent: May 11, 2021
    Assignee: NOVOZYMES A/S
    Inventors: Miguel Duarte Guilherme Pereira Toscano, Esben Peter Friis, Bena-Marie Lue
  • Patent number: 10995325
    Abstract: The present invention relates to variant phytase enzymes and their use thereof.
    Type: Grant
    Filed: September 10, 2019
    Date of Patent: May 4, 2021
    Assignee: Fornia BioSolutions, Inc.
    Inventors: Khin Oo, Jie Yang, Xiyun Zhang, Goutami Banerjee, Tatsuya Fukushima, Eric Lin Hu, Imad N. Sawaya, Stephen Joshua Macaso Millet, Jijiao Zeng, Wenhua Lu
  • Patent number: 10988753
    Abstract: The present invention discloses an aspartase variant, method of preparing the same and use thereof. Compared with sequence 2 in the sequence listing, the amino acid sequence of the aspartase variant provided in the present invention has more than 96% identity, and there are mutations in T187I and N326C at positions 187 and 326, respectively, and has improved catalytic activity for the ammoniation of acrylic acid, compared with the aspartase shown in sequence 2. The experiment proves that the aspartase variant provided in the present invention does have improved catalytic activity for the ammoniation of acrylic acid compared with the wild type parent aspartase, and has better thermal stability and pH spectrum. The reaction can greatly increase the conversion ratio of acrylic acid.
    Type: Grant
    Filed: July 24, 2018
    Date of Patent: April 27, 2021
    Assignee: QINHUANGDAO HUAHENG BIOENGINEERING CO., LTD.
    Inventors: Bian Wu, Yang Liu, Ruifeng Li, Dongzhu Zhang, Zhicheng Liu, Hui Zhang
  • Patent number: 10982200
    Abstract: The present disclosure provides for endonuclease enzymes having distinguishing domain features, as well as methods of using such enzymes or variants thereof.
    Type: Grant
    Filed: June 30, 2020
    Date of Patent: April 20, 2021
    Assignee: METAGENOMI IP TECHNOLOGIES, LLC
    Inventors: Brian Thomas, Christopher Brown, Rose Kantor, Audra Devoto, Cristina Butterfield, Lisa Alexander, Daniela S. A. Goltsman, Jason Liu
  • Patent number: 10980848
    Abstract: Methods and compositions comprising hogocidin peptides (SH-lantibiotics), derivatives and variants are provided. Also provided are methods and compositions comprising probiotic compositions utilizing strains of S. hominis and S. epidermidis that produce hogocidin, hogocidin-like peptides, or other inhibitors of skin pathogens. Methods of treatment for microbial skin infections and atopic dermatitis are also provided.
    Type: Grant
    Filed: October 15, 2019
    Date of Patent: April 20, 2021
    Assignee: The Regents of the University of California
    Inventors: Teruaki Nakatsuji, Richard L. Gallo
  • Patent number: 10982245
    Abstract: The present disclosure relates to an O-succinyl homoserine transferase mutant, a polynucleotide encoding the same, a microorganism including the mutant, and a method of producing O-succinyl homoserine using the microorganism.
    Type: Grant
    Filed: June 29, 2018
    Date of Patent: April 20, 2021
    Assignee: CJ CHEILJEDANG CORPORATION
    Inventors: Kyungrim Kim, Jihyun Shim, Hyun Ah Kim, Yong Uk Shin, Peter Lee
  • Patent number: 10975364
    Abstract: A modified Streptococcus aureus Cas9 (SaCas9) protein with a mutation at an N413 position, and optionally one or more of a nuclear localization sequence, a cell penetrating peptide sequence, an affinity tag and/or a fusion base editor protein, and a kit that comprises said modified protein. A method for altering the genome of a cell, the method including the step of using the modified protein of the invention.
    Type: Grant
    Filed: August 27, 2019
    Date of Patent: April 13, 2021
    Assignee: City University of Hong Kong
    Inventors: Zongli Zheng, Jiahai Shi, Yuanyan Tan
  • Patent number: 10975366
    Abstract: The present invention relates to the field of genetic engineering, particularly to a method for efficiently expressing pullulanase in Bacillus subtilis and recombinant Bacillus subtilis. said method includes steps of constructing modified Bacillus subtilis strain with deletion of alkaline protease gene and neutral protease gene, constructing expression vector including an optimized combination of promoter and signal peptide and pullulanase gene, and transforming said modified Bacillus subtilis strain with by said expression vector. A series of combinations of promoter and signal peptide are optimized to obtain the combination for efficiently expressing pullulanase, provide an industrial application basis.
    Type: Grant
    Filed: October 24, 2017
    Date of Patent: April 13, 2021
    Assignee: GUANGDONG VTR BIO-TECH CO., LTD
    Inventors: Yangyuan Li, Jianrong Wang, Ling Yang, Man Qu, Lizhi Chen, Jiale Huang
  • Patent number: 10975398
    Abstract: Nucleic acids and cells comprising a methyltransferase gene and/or a reductase gene are disclosed. These nucleic acids and cells may be used to produce branched (methyl)lipids, such as 10-methylstearate.
    Type: Grant
    Filed: October 25, 2019
    Date of Patent: April 13, 2021
    Assignee: Ginkgo Bioworks, Inc.
    Inventors: Arthur J. Shaw, Hannah Blitzblau, Donald V. Crabtree
  • Patent number: 10961551
    Abstract: Disclosed is a process for producing at least one metabolite of interest by conversion of a pentose in a microorganism. The process includes at least: (i) an operation of culturing a recombinant microorganism expressing a synthetic pathway for pentose assimilation which includes at least the following steps: a) phosphorylation in position 1 of a pentose chosen from (D)-xylulose and/or (L)-ribulose, b) cleavage of the pentose-1-phosphate obtained at the end of step a), in order to obtain glycolaldehyde and dihydroxyacetone phosphate (DHAP), and (ii) an operation of recovering the at least one metabolite of interest obtained at the end of the culturing operation (i). Also disclosed is an associated microorganism.
    Type: Grant
    Filed: November 1, 2019
    Date of Patent: March 30, 2021
    Assignees: INSTITUT NATIONAL DE RECHERCHE POUR L'AGRICULTURE, L'ALIMENTATION ET L'ENVIRONMENT, INSTITUT NATIONAL DES SCIENCES APPLIQUEES—INSA, CENTRE NATIONAL DE LA RECHERCHE SCIENTIFIQUE
    Inventors: Thomas Walther, Yvan Cam, Jean-Marie Francois, Ceren Alkim
  • Patent number: 10913941
    Abstract: The present disclosure provides for endonuclease enzymes having distinguishing domain features, as well as methods of using such enzymes or variants thereof.
    Type: Grant
    Filed: June 30, 2020
    Date of Patent: February 9, 2021
    Assignee: METAGENOMI IP TECHNOLOGIES, LLC
    Inventors: Brian Thomas, Christopher Brown, Rose Kantor, Audra Devoto, Cristina Butterfield, Lisa Alexander, Daniela S. A. Goltsman, Jason Liu
  • Patent number: 10907140
    Abstract: A mutant ?-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.
    Type: Grant
    Filed: September 5, 2016
    Date of Patent: February 2, 2021
    Assignee: Technische Universitaet Muenchen
    Inventors: Vladimir Zverlov, Wolfgang Schwarz, Roman Prechtl, Benedikt Leis, Claudia Held, Wolfgang Liebl
  • Patent number: 10900047
    Abstract: The present invention relates to isolated polypeptides having beta-xylosidase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: January 24, 2020
    Date of Patent: January 26, 2021
    Assignee: Novozymes Inc.
    Inventors: Yu Zhang, Ye Liu, Junxin Duan, Lan Tang, Brett McBrayer
  • Patent number: 10889836
    Abstract: Described herein are processes for producing ethanol from starch-containing material using a Saccharomyces cerevisiae strain MBG4985 (deposited under Accession No. NRRL Y67342 at the Agricultural Research Service Patent Culture Collection (NR-RL), Northern Regional Research Center, 1815 University Street, Peoria, Ill., USA) or a fermenting organism strain having properties that are about the same as that of the deposited Saccharomyces cerevisiae strain or a derivative of Saccharomyces cerevisiae strain MBG4985 (e.g., a recombinant derivative expressing an alpha-amylase and/or a glucoamylase) having the defining characteristics of strain Saccharomyces cerevisiae yeast MBG4985. Also described is Saccharomyces cerevisiae strain MBG4985 deposited under the Budapest Treaty and having accession No. NRRL Y67342 or a derivative of strain NRRL Y67342 which exhibits one or more properties or defining characteristics of strain Saccharomyces cerevisiae strain MBG4985.
    Type: Grant
    Filed: November 22, 2017
    Date of Patent: January 12, 2021
    Assignees: Novozymes A/S, Microbiogen Pty. Ltd.
    Inventors: Hamid Rismani Yazdi, Philip John Livingstone Bell, Paul Victor Attfield, Michael Glenn Catlett