Abstract: Provided is an underwater repair system for a cavity region of a concrete panel rock-fill dam panel, including a moving platform, a work cabin, a pressure drainage apparatus, a traction apparatus, and a positioning apparatus; the traction apparatus controlling the movement of the moving platform on the surface of a dam concrete panel; the positioning apparatus transmits a detection position; the work cabin is a pressure cabin, the work cabin being connected to the pressure drainage apparatus, and a drill apparatus and grouting apparatus being arranged in the work cabin; the moving platform moves into the cavity region, and the pressure drainage apparatus starts up to drain the water in the work cabin, a partially closed waterless space being formed inside the work cabin, the drill apparatus drilling the concrete panel at the upper end of the cavity region and the grouting apparatus subsequently implementing grouting to complete the repair.

Abstract: The present invention provides compounds of Formula (I), or stereoisomers, tautomers, or pharmaceutically acceptable salts or solvates thereof, wherein all the variables are as defined herein. These compounds modulate the activity of farnesoid X receptor (FXR), for example, as agonists. This invention also relates to pharmaceutical compositions comprising these compounds and methods of treating a disease, disorder, or condition associated with FXR dysregulation, such as pathological fibrosis, transplant rejection, cancer, osteoporosis, and inflammatory disorders, by using the compounds and pharmaceutical compositions.

Abstract: The present invention relates to a cyclic peptide from a novel bone morphogenetic protein 2 (BMP2), a preparation method therefor and an application thereof. The cyclic peptide from the novel BMP2 is selected from one of the following cyclized polypeptides: 1. a cyclized polypeptide having the sequence of CKIPKASSVPTELSAISMLYLGPGGDWIVAC; and 2. a cyclized polypeptide of which the sequence has an 80% homology with the sequence defined in item 1. The present invention also relates to a preparation method for the cyclic peptide from the novel BMP2, and an application thereof in the preparation of the composite material for promoting the repair of large-sized bone defects.

Abstract: Embodiments of the present invention relate to an information sharing method and apparatus. The method includes: sharing, by a first terminal, specified content with a specified sharing user when a preset sharing condition is met, where the sharing condition is at least one of the following factors: a current time of the first terminal is a preset time; a current time of the first terminal falls within a preset time range; a current geographic location of the first terminal is a preset geographic location; or a current geographic location of the first terminal falls within a preset geographic location range. According to the present invention, a sharing condition such as a time or a geographic location is preset, and content is shared with a specified user according to the sharing condition, thereby simplifying complexity of sharing information in a future time period and improving usability of information sharing.

Abstract: A system and method for automatically adjusting computing resources provisioned for a computer service or application by applying historical resource usage data to a predictive model to generate predictive resource usage. The predictive resource usage is then simulated for various service configurations, determining scaling requirements and resource wastage for each configuration. A cost value is generated based on the scaling requirement and resource wastage, with the cost value for each service configuration used to automatically select a configuration to apply to the service. Alternatively, the method for automatically adjusting computer resources provisioned for a service may include receiving resource usage data of the service, applying it to a linear quadratic regulator (LQR) to find an optimal stationary policy (treating the resource usage data as states and resource-provisioning variables as actions), and providing instructions for configuring the service based on the optimal stationary policy.

Abstract: A pressure touch method and a terminal, where the method includes detecting a pressure sensing operation generated by a finger on a target touch component, identifying a pressure level corresponding to the pressure sensing operation, determining a function corresponding to the pressure level, and performing the function corresponding to the pressure level. Therefore, different functions triggered to be performed by pressure sensing operations may be determined using combinations of pressure levels and swipe directions, thereby improving convenience of one-hand operations of a user, and also enhancing coherence of user experience.

Abstract: The present application relates to a method for preparing trifluridine, comprising reacting a compound of formula III with a compound of formula IV in a first solvent in the presence of an acid to obtain a compound of formula II, and performing further reaction to obtain trifluridine.

Abstract: An improved insulation protection structure comprises a sensor film, a chip outline, a protective film, and an insulating cement layer. The chip outline is on the sensor film, the protective film is on the chip outline, the insulating cement layer is between the chip outline and the protective film. The insulating cement layer comprises at least one surface facing inward the chip outline, retracted toward the direction of the chip outline and forms a retracted region along at least one side of the sensor film. Area of the proposed retracted region is preferably no more than 20% of that of the total insulating cement layer, and the conventional issues such as sulphide corrosion are solved. The proposed insulating cement layer can be cured merely at room temperature, and widely used for adhesive materials including both a gel and film, thus characterized by wider application range and better industrial applicability.

Abstract: Generating images and videos depicting a human subject wearing textually defined attire is described. An image generation system receives a two-dimensional reference image depicting a person and a textual description describing target clothing in which the person is to be depicted as wearing. To maintain a personal identity of the person, the image generation system implements a generative model, trained using both discriminator loss and perceptual quality loss, which is configured to generate images from text. In some implementations, the image generation system is configured to train the generative model to output visually realistic images depicting the human subject in the target clothing. The image generation system is further configured to apply the trained generative model to process individual frames of a reference video depicting a person and output frames depicting the person wearing textually described target clothing.

Abstract: Embodiments of this application disclose a transmission processing method and apparatus, a device, and a storage medium. The method is applied to a first device, and includes: receiving a pre-scheduling message that is transmitted by a second device through a first channel; reading, from the pre-scheduling message, a pre-scheduling moment and a pre-scheduling frequency band that are used for pre-scheduling transmission between the first device and the second device; and transmitting, before the pre-scheduling moment is reached, uplink target data and indication information to the second device by using any band other than the pre-scheduling band, the indication information being used for indicating cancellation of the pre-scheduling transmission.

Abstract: The present invention provides compounds of Formula (I): or stereoisomers, tautomers, or pharmaceutically acceptable salts or solvates thereof, wherein all the variables are as defined herein. These compounds modulate the activity of famesoid X receptor (FXR), for example, as agonists. This invention also relates to pharmaceutical compositions comprising these compounds and methods of treating a disease, disorder, or condition associated with FXR dysregulation, such as pathological fibrosis, transplant rejection, cancer, osteoporosis, and inflammatory disorders, by using the compounds and pharmaceutical compositions.

Abstract: Disclosed are a controlled-release dosage form with an absorption window in the upper gastrointestinal tract and a preparation method therefor, wherein the controlled-release dosage form comprises a controlled-release platform and a retention platform. The controlled-release platform is a pharmaceutical composition comprising a tablet core and a coating membrane; and the retention platform holds the controlled-release platform in the oral cavity. The operation steps of the controlled-release dosage form are as follows: placing the controlled-release platform in the retention platform, and fixing the retention platform on matching teeth in the oral cavity; taking out the controlled-release dosage form after 4-24 hours and replacing same with a new controlled-release platform; and re-fixing the retention platform on the matching teeth in the oral cavity to achieve the sustained and stable release of drugs.

Abstract: Provided is an underwater repair system for a cavity region of a concrete panel rock-fill dam panel, including a moving platform, a work cabin, a pressure drainage apparatus, a traction apparatus, and a positioning apparatus; the traction apparatus controlling the movement of the moving platform on the surface of a dam concrete panel; the positioning apparatus transmits a detection position, the work cabin is a pressure cabin, the work cabin being connected to the pressure drainage apparatus, and a drill apparatus and grouting apparatus being arranged in the work cabin; the moving platform moves into the cavity region, and the pressure drainage apparatus starts up to drain the water in the work cabin, a partially closed waterless space being formed inside the work cabin, the drill apparatus drilling the concrete panel at the upper end of the cavity region and the grouting apparatus subsequently implementing grouting to complete the repair.

Abstract: A method for preparing urea ammonium nitrate solution from waste nitric acid after stripping tin from circuit board includes: causing the waste nitric acid after stripping tin and the ammonia water to undergo neutralizing and precipitating reaction through acid-base neutralization, filtering, thereby obtaining tin-containing filter mud and a primary filtrate; adding iron powders into to the primary filtrate to initiate copper-iron replacement reaction, filtering, thereby obtaining iron-containing coarse copper powders and a secondary filtrate; adding hydrogen peroxide to the secondary filtrate, filtering, thereby obtaining an iron-containing sludge and a tertiary filtrate; adding a heavy metal capturing agent to the tertiary filtrate, filtering, thereby obtaining a heavy metal sludge and an ammonium nitrate solution; measuring a concentration of the ammonium nitrate solution, adding urea and liquid fertilizer corrosion inhibitor to obtain a urea/ammonium nitrate dilute solution, evaporating and concentrating

Abstract: The present invention discloses a two-dimensional Ruddlesden-Popper hybrid perovskite film with a gradient structural characteristic and a preparation method thereof, belonging to the field of organic-inorganic hybrid perovskite materials. The film can be obtained by deposition from a precursor solution containing two spacer cations by a solution spin-coating method. The film is composed of large orientedly grown grains, has a high quality and good carrier transmission characteristics, and has a gradient structural characteristic with one of the spacer cations being enriched on the film surface, which is beneficial to obtain good moisture resistance stability. This is of great significance for the preparation of high-performance hybrid perovskite photoelectric devices by a solution method.

Abstract: Provided are an inverted thick 2D hybrid perovskite solar cell insensitive to film thickness and a preparation method thereof, belonging to the field of organic-inorganic hybrid perovskite materials. The solar cell adopts a 2D hybrid perovskite thick-film material as a light absorption layer having thickness in a range of 500-800 nm, which is conducive to the full absorption of sunlight. The thick-film film material can be deposited from a precursor solution added with guanidine hydroiodide, and is composed of large grains growing along the thickness direction. The solar cell with an inverted structure prepared by using the thick-film material as a light absorption layer has an efficiency fluctuation less than 5% in a film thickness range of 500-800 nm. This is of great value for the preparation of high-performance hybrid perovskite solar cells by a large-area solution method.

Abstract: Embodiments of the present invention provide a displaying method. The method includes steps of: displaying an element at a first position on touchscreen, obtaining touch information, determining an arrangement instruction which is obtained for the greatest number of times within predetermined time according to the touch information, and displaying the element at a second position on the touchscreen according to the arrangement instruction.

Abstract: An improved insulation protection structure comprises a sensor film, a chip outline, a protective film, and an insulating cement layer. The chip outline is on the sensor film, the protective film is on the chip outline, the insulating cement layer is between the chip outline and the protective film. The insulating cement layer comprises at least one surface facing inward the chip outline, retracted toward the direction of the chip outline and forms a retracted region along at least one side of the sensor film. Area of the proposed retracted region is preferably no more than 20% of that of the total insulating cement layer, and the conventional issues such as sulphide corrosion are solved. The proposed insulating cement layer can be cured merely at room temperature, and widely used for adhesive materials including both a gel and film, thus characterized by wider application range and better industrial applicability.

Abstract: The invention relates to the technical field of communications, and more particularly, to a method and device for realizing synchronization. The method comprises: performing, by a base station, and according to an SRS signal transmitted by a terminal, filtering to obtain a RRU channel having the maximum receiving power in a current operation; upon determining that the RRU channel having the maximum receiving power in the current operation is different from a RRU channel used in the currently performed demodulation, refraining from performing immediate switching; and permitting switching of the RRU channel only when the receiving power of the RRU channel is determined to match the maximum threshold of a preset series of thresholds, and transmitting a TA command word to the terminal while switching the RRU channel to complete synchronization with the terminal. The invention prevents a terminal from frequently switching between RRU channels on a subframe basis.

Abstract: The present disclosure discloses a motor control module (120), an actuator, and an electromechanical brake apparatus, which relates to the technical field of mechanical braking. The present disclosure solves issues such as insufficient space and large size caused by directly connecting a circuit board and capacitors in the existing motor control modules. The motor control module (120) according to the present disclosure comprises a circuit board (100) and a capacitor assembly (300) including a plurality of capacitors (310) and an electrically conductive connecting element (1000) for electrically connecting the plurality of capacitors (310), the electrically conductive connecting element (1000) being electrically connected to the circuit board (100) and being disposed in a suspended state relative to the circuit board (100), such that a gap (130) is maintained between the capacitor assembly (300) and the circuit board (100).