Abstract: A closure system is provided with a peripheral wall (e.g., as defined either by a top portion of a container for extending from, and defining, an opening or as defined by a separate closure body for extending from a container). The peripheral wall has a laterally inwardly extending sealing member. A lid is provided for being moved from an open position to a closed position on the peripheral wall. The lid has a flange with a peripheral sealable surface for being engaged by the sealing member of the peripheral wall to effect a seal.

Abstract: A tamper-evident dispensing closure system is provided for a container. The system has a body for extending from the container at the container opening. The body defines a dispensing orifice, a channel, and a retention member projecting over a portion of the channel. The system includes a lid for being moved between a closed position and an open position. An anchor member is provided for being received in the channel and has an engaging portion for engaging the retention member when the anchor member is received in the channel. At least one frangible web initially connects the anchor member with the lid so that the frangible web breaks when the lid is initially lifted from the closed position.

Abstract: A method for centrifugally separating whole blood into red blood cells and a plasma constituent rotates about a rotational axis a separation zone having radially spaced apart walls with a high-G side and a low-G side located closer to the rotational axis than the high-G side. Whole blood enters the rotating separation zone in an entry region to begin separation. Separation is halted by a terminal wall that is circumferentially spaced from the entry region. The whole blood separates into red blood cells toward the high-G side and plasma constituent toward the low-G side. The method directs red blood cells separated in the separation zone in a circumferential flow direction toward the terminal wall. The method directs separated red blood cells from the rotating separation zone through a second path that extends, at least in part, radially beyond the high-G wall.

Abstract: A latch assembly to connect a component to a rack. The assembly comprises a latch spring and a lever that are connected to a component. The latch spring is moveable between an engaged and a disengaged position. In the engaged position the latch spring is engaged with a catch that is connected to a rack. In the disengaged position the latch spring is disengaged from the catch. The lever is rotatable about an axis of rotation between a latched position and an unlatched position. The rotation of the lever from the latched position to the unlatched position moves the latch spring from the engaged position to the disengaged position in a direction parallel to the axis of rotation.

Abstract: Teeth whitening is disclosed using a wand applicator that may apply a whitening composition directly to the one or more teeth to be whitened. The teeth whitening may include capping a whitening composition container with a wand applicator. Kits and whitening compositions for the same are also disclosed.

Abstract: The present invention is a method of non-continuous administration of a pharmaceutical to a female for a condition associated with the female's menstrual cycle, comprising administering a daily placebo dosage, starting on the first or the second day of the menstrual cycle and continuing the daily administration for a placebo dosage period. Next administering a daily pharmaceutical dosage, starting on the day after the last daily placebo dosage was administered and continuing the daily administration of the pharmaceutical dosage for a pharmaceutical dosage period. Both the placebo dosages and the pharmaceutical dosages are contained in a single package.

Abstract: A multi-port optical connection terminal for use as a branch point in a fiber optic communications network at a distance from a mid-span access location provided on a distribution cable having a plurality of optical fibers. The multi-port terminal includes a base and a cover affixed to the base. A stub cable port formed through one of the base and the cover receives a stub cable having at least one optical fiber extending continuously from the multi-port terminal to the mid-span access location. A first end of the optical fiber is optically connected to a respective optical fiber of the distribution cable at the mid-span access location and a fiber optic connector is mounted upon the second end. At least one connector port is provided on the multi-port terminal for receiving the fiber optic connector and a connectorized end of a fiber optic drop cable extending from the multi-port terminal.

Abstract: The invention provides an immunomodulatory flagellin peptide having substantially the same amino acid sequence GALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQ (SEQ ID NO:44), or a modification thereof, and having toll like receptor 5 (TLR5) binding. The immunomodulatory flagellin peptide also can have substantially the same amino acid sequence TQFSGVKVLAQDNTLTIQVGANDGETIDIDLKQINS QTLGLDTL (SEQ ID NO:45); EGALNEINNNLQRVRELAVQSANSTNSQSDLDSIQAEITQRLNEIDRVNG (SEQ ID NO:46) or MAQVINTNSLSLLTQNNLNKSQSALGTAIERLSSGLRINSAKDDAAGQAIANF TANIKGLTQASRNANDGISIAQTTEGALNEINNNLQRVRELAVQS (SEQ ID NO:47), or a modification thereof. Also provided is an immunomodulatory flagellin peptide having substantially the same amino acid sequence LQKIDAALAQVDTLRSDLGAVQNRFNSAITNL (SEQ ID NO:48), or a modification thereof, and having toll like receptor 5 (TLR5) binding.

Abstract: Blood processing systems and methods convey blood cells from a blood cell source into a blood component collection flow channel that includes a blood cell storage container and an in-line filter to remove leukocytes from blood cells before entering the blood cell storage container. The systems and methods also convey additive solution from an additive solution source into the blood component collection flow channel. The systems and methods alternate the conveyance of blood cells through the filter with the conveyance of additive solution through the filter.

Abstract: A pilot fuel nozzle configuration for use in a combustor is disclosed having a natural frequency outside the range of the operating frequencies of a gas turbine engine. Multiple embodiments are disclosed for the improved pilot fuel nozzle including configurations for newly manufactured nozzles, repair to existing pilot nozzles, as well as multiple natural frequency levels for the improved pilot fuel nozzle. The pilot fuel nozzle comprises an elongated housing, first and second flanges, and a nozzle tip, with the first flange fixed to the elongated housing at a first end and the nozzle tip fixed to the second end, opposite of the first end. The second flange is fixed along the elongated housing and is used for attaching the pilot fuel nozzle to a combustor. The present invention incorporates an increased wall thickness along at least a mid-span portion of the pilot nozzle to increase the stiffness and change the natural frequency.

Abstract: The present invention is a method of non-continuous administration of a pharmaceutical to a female for a condition associated with the female's menstrual cycle, comprising ascertaining a number of days in the female's menstrual cycle, and then administering a daily first dosage, starting on the first or the second day of the menstrual cycle and continuing the daily administration for a first dosage period. Next administering a daily second dosage, starting on the day after the last daily first dosage was administered and continuing the daily administration of the second dosage for a second dosage period. Wherein either the first dosage is a placebo and the second dosage is the pharmaceutical, or the first dosage is the pharmaceutical and the second dosage is a placebo. Both the first dosages and the second dosages being contained in a single package.

Abstract: A mounting device for securing an electronic device to an equipment rack includes a mounting member and a securing device mounted on an end thereof.

Abstract: A dispensing closure that has a cover which is provided with a scrubbing structure that includes protuberances. In a preferred embodiment, the scrubbing structure is a resilient flexible material which has been molded on a generally rigid base. The base is injection molded in an initial injection molding step from a first material, and the scrubbing structure is injection molded in situ in a subsequent molding step from a second material onto said first material to become bonded thereto.

Abstract: A tamper-evident dispensing closure system is provided for a container. The system has a body for extending from the container at the container opening. The body defines a dispensing orifice, a channel, and a retention member projecting over a portion of the channel. The system includes a lid for being moved between a closed position and an open position. An anchor member is provided for being received in the channel and has an engaging portion for engaging the retention member when the anchor member is received in the channel. At least one frangible web initially connects the anchor member with the lid so that the frangible web breaks when the lid is initially lifted from the closed position.

Abstract: A method for inhibiting the leakage of a container during handling or shipping is provided. The container can have a body that defines a base portion and a top portion to which a lid is removably secured. A sealing label is adhesively attached to the lid and container body to inhibit the loosening of the lid. For example, in one embodiment, the sealing label includes a polyolefin film facestock and a rubber-based adhesive that is solvent-resistant.

Abstract: Teeth whitening is disclosed using a wand applicator that may apply a whitening composition directly to the one or more teeth to be whitened. The teeth whitening may include capping a whitening composition container with a wand applicator. Kits and whitening compositions for the same are also disclosed.

Abstract: A tamper-evident dispensing closure system is provided for a container. The system has a body for extending from the container at the container opening. The body defines a dispensing orifice, a channel, and a retention member projecting over a portion of the channel. The system includes a lid for being moved between a closed position and an open position. An anchor member is provided for being received in the channel and has an engaging portion for engaging the retention member when the anchor member is received in the channel. At least one frangible web initially connects the anchor member with the lid so that the frangible web breaks when the lid is initially lifted from the closed position.