Patents by Inventor Lawrence Loomis

Lawrence Loomis has filed for patents to protect the following inventions. This listing includes patent applications that are pending as well as patents that have already been granted by the United States Patent and Trademark Office (USPTO).

  • Publication number: 20230364184
    Abstract: The invention comprises a therapeutic composition adapted to induce innate and antibody-based immune responses. Embodiments of the present invention relate generally to therapeutic compositions for respiratory viruses suitable for nasal and/or nasopharyngeal administration. More specifically, the therapeutic compositions comprise mannose binding lectins (MBL) including e.g., modified MBL (mMBL), selected viral peptides, and combinations of MBL or mMBL and selected viral peptides, optionally in combination with an adjuvant and/or carrier. The invention provides for the simultaneous stimulation of both the innate and adaptive immune responses as well as the proximal aggregation of the invading respiratory vims to its targeted mucosal antibody which maximizes the opsonization of the infecting pathogen.
    Type: Application
    Filed: September 29, 2021
    Publication date: November 16, 2023
    Inventor: Lawrence LOOMIS
  • Publication number: 20230145699
    Abstract: The present invention relates to lateral flow assay devices adapted to detect IgA specific for SARS-CoV-2 in biological samples from subjects suspected to have COVID-19, and methods of using the lateral flow assay devices.
    Type: Application
    Filed: April 5, 2021
    Publication date: May 11, 2023
    Inventor: Lawrence LOOMIS
  • Publication number: 20220356505
    Abstract: The present invention relates methods for rapidly detecting the presence of bacteria in biological solutions regardless of their origin in non-laboratory environments. The present invention further relates to methods for binding, capturing, and concentrating the bacteria in a given sample.
    Type: Application
    Filed: June 26, 2020
    Publication date: November 10, 2022
    Applicant: Transformative Technologies
    Inventors: Lawrence SILVER, Lawrence LOOMIS
  • Publication number: 20220119856
    Abstract: The present invention relates to several methods to detect gram positive mastitis pathogens in a small sample of bovine milk by luminescence using a combination of specific reagents giving a “cow side” “in-stall” indication of the presence or absence of gram positive mastitis pathogens within a short period of time.
    Type: Application
    Filed: January 30, 2020
    Publication date: April 21, 2022
    Applicant: TRANSFORMATIVE TECHNOLOGIES
    Inventors: Lawrence SILVER, Lawrence LOOMIS, David DONOVAN
  • Publication number: 20130068040
    Abstract: A rapid analyte collection and testing device, said device comprising a) a casing, said casing having) a first casing section, said first casing section containing an encapsulated buffer section containing a buffer, and asecond casing section, said second casing section comprising a window on a side of said second section, a complementary mechanism for attachment to said first casing section, an opening at a proximal end of said second casing section; and a non permeable platform strip positioned lengthwise within and extending beyond the second casing section. The non-permeable platform further contains a swab, said swab positioned at the distal end of said non-permeable platform strip, a lateral flow assay positioned downstream from said swab, and a tag, positioned upstream from the capture reagent site.
    Type: Application
    Filed: August 6, 2012
    Publication date: March 21, 2013
    Inventors: Lawrence Loomis, Leslie Kirkegaard, Glen Ford, Robert Greenfield
  • Patent number: 7687069
    Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.
    Type: Grant
    Filed: May 1, 2002
    Date of Patent: March 30, 2010
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 7404961
    Abstract: This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.
    Type: Grant
    Filed: January 12, 2004
    Date of Patent: July 29, 2008
    Assignee: The United States of America as represented by the Secretary of the Army
    Inventors: Frederick J. Cassels, Lawrence Loomis-Price
  • Publication number: 20070212340
    Abstract: A method for the prophylactic and therapeutic treatment of bacterial infections of the skin is disclosed which comprises the treatment of an individual with an effective amount of a native or altered version of a lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria. The lytic enzyme is selected from a group consisting of shuffled lytic enzymes, chimeric lytic enzymes, wherein the lytic enzyme is in an environment having a pH which allows for activity of said lytic enzyme; and a carrier for delivering said lytic enzyme. Additionally, a holin protein for puncturing the membrane may be included in the composition.
    Type: Application
    Filed: June 16, 2004
    Publication date: September 13, 2007
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 7232576
    Abstract: A lozenge for the treatment of Streptococcus Group A infections of the mouth, throat, and nasal passage is disclosed which comprises a lytic enzyme composition specific for Streptococcus Group A and a lozenge carrier for delivering the lytic enzyme.
    Type: Grant
    Filed: November 25, 2003
    Date of Patent: June 19, 2007
    Assignees: New Horizons Diagnostics Corp, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Publication number: 20070077235
    Abstract: A composition and method for treating bacterial infections by the use of an effective amount of at least one lytic specific for the bacteria causing specific. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria. The enzyme may be at least one lytic protein or peptides in a natural or modified form.
    Type: Application
    Filed: August 14, 2006
    Publication date: April 5, 2007
    Inventors: Lawrence Loomis, Vincent Fischetti
  • Patent number: 7169408
    Abstract: The present invention discloses a composition for dermatological infections by the use of a lytic enzyme in a carrier suitable for topical application to dermal tissues. The method for the treatment of dermatological infections comprises administering a composition comprising effective amount of a therapeutic agent, with the therapeutic agent comprising a lytic enzyme produced by infecting a bacteria with phage specific for that bacteria.
    Type: Grant
    Filed: June 20, 2003
    Date of Patent: January 30, 2007
    Assignees: New Horizons Diagnostics Corp., Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Publication number: 20060292135
    Abstract: A composition and method for treating bacterial infections by the use of an effective amount of at least one lytic specific for the bacteria causing specific. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria. The enzyme may be at least one lytic protein or peptides in a natural or modified form.
    Type: Application
    Filed: July 18, 2005
    Publication date: December 28, 2006
    Inventors: Lawrence Loomis, Vincent Fischetti
  • Patent number: 7141241
    Abstract: The present invention relates to an oral delivery system containing a bacteriophage associated lysin enzyme for the treatment of [Streptococcus pneumoniae and] Hemophilus influenzae sinus/nasal infections.
    Type: Grant
    Filed: February 8, 2002
    Date of Patent: November 28, 2006
    Assignees: New Horizons Diagnostics Corp, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 7063837
    Abstract: The present invention discloses a method and composition for the treatment of bacterial infections by the parenteral introduction of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for that bacteria and an appropriate carrier for delivering the lytic enzyme into a patient. The injection can be done intramuscularly, subcutaneously, or intravenously.
    Type: Grant
    Filed: July 19, 2001
    Date of Patent: June 20, 2006
    Assignees: New Horizons Diagnostics Corp, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 7014850
    Abstract: A nasal spray for treating a streptococcal infection is disclosed. The spray comprises an effective amount of a lysin enzyme genetically coded for by a C1 bacteriophage capable of infecting a group C Streptococcal bacteria, and a nasal spray carrier for delivering said lysin enzyme to a mouth, throat, or nasal passage.
    Type: Grant
    Filed: February 8, 2002
    Date of Patent: March 21, 2006
    Assignees: New Horizons Diagnostics Corp, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Publication number: 20050136088
    Abstract: A composition and method for treating bacterial infections is disclosed which comprises the treatment of an individual with an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria wherein at least one lytic enzyme is selected from the group consisting of shuffled lytic enzymes, chimeric lytic enzymes, holin enzymes, and combinations thereof. A carrier may be used for delivering the lytic enzyme. This method, and composition can be used for the treatment of upper respiratory infections, skin infections, wounds, and burns, vaginal infections, eye infections, intestinal disorders and dental problems.
    Type: Application
    Filed: May 28, 2004
    Publication date: June 23, 2005
    Applicant: New Horizons Diagnostics Corporation
    Inventors: Lawrence Loomis, Vincent Fischetti
  • Patent number: 6899874
    Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.
    Type: Grant
    Filed: May 1, 2002
    Date of Patent: May 31, 2005
    Assignees: New Horizons Diagnostics Corporation, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 6893635
    Abstract: A method for treating a streptococcal infection is disclosed using a nasal spray. The spray comprises an effective amount of a lysin enzyme genetically coded for by a C1 bacteriophage capable of infecting a group C Streptococcal bacteria, and a nasal spray carrier for delivering said lysin enzyme to a mouth, throat, or nasal passage.
    Type: Grant
    Filed: February 8, 2002
    Date of Patent: May 17, 2005
    Assignees: New Horizons Diagnostics Corp, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 6881403
    Abstract: A tampon for treatment of Streptococcus Group B infections of the vagina is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering the lytic enzyme.
    Type: Grant
    Filed: March 25, 2002
    Date of Patent: April 19, 2005
    Assignees: New Horizons Diagnostic, Corp, Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis
  • Patent number: 6875431
    Abstract: A method for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The composition may be in the form of an isotonic solution.
    Type: Grant
    Filed: May 1, 2002
    Date of Patent: April 5, 2005
    Assignees: New Horizons Diagnostics Corp., Rockefeller University
    Inventors: Vincent Fischetti, Lawrence Loomis