Abstract: The invention comprises a therapeutic composition adapted to induce innate and antibody-based immune responses. Embodiments of the present invention relate generally to therapeutic compositions for respiratory viruses suitable for nasal and/or nasopharyngeal administration. More specifically, the therapeutic compositions comprise mannose binding lectins (MBL) including e.g., modified MBL (mMBL), selected viral peptides, and combinations of MBL or mMBL and selected viral peptides, optionally in combination with an adjuvant and/or carrier. The invention provides for the simultaneous stimulation of both the innate and adaptive immune responses as well as the proximal aggregation of the invading respiratory vims to its targeted mucosal antibody which maximizes the opsonization of the infecting pathogen.

Abstract: The present invention relates to lateral flow assay devices adapted to detect IgA specific for SARS-CoV-2 in biological samples from subjects suspected to have COVID-19, and methods of using the lateral flow assay devices.

Abstract: The present invention relates methods for rapidly detecting the presence of bacteria in biological solutions regardless of their origin in non-laboratory environments. The present invention further relates to methods for binding, capturing, and concentrating the bacteria in a given sample.

Abstract: The present invention relates to several methods to detect gram positive mastitis pathogens in a small sample of bovine milk by luminescence using a combination of specific reagents giving a “cow side” “in-stall” indication of the presence or absence of gram positive mastitis pathogens within a short period of time.

Abstract: A rapid analyte collection and testing device, said device comprising a) a casing, said casing having) a first casing section, said first casing section containing an encapsulated buffer section containing a buffer, and asecond casing section, said second casing section comprising a window on a side of said second section, a complementary mechanism for attachment to said first casing section, an opening at a proximal end of said second casing section; and a non permeable platform strip positioned lengthwise within and extending beyond the second casing section. The non-permeable platform further contains a swab, said swab positioned at the distal end of said non-permeable platform strip, a lateral flow assay positioned downstream from said swab, and a tag, positioned upstream from the capture reagent site.

Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.

Abstract: This invention relates to amino acid sequences from within a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (SEQ ID. NO: 1) Eight mer peptides from within the consensus peptide were tested against an antibody raised to the consensus peptide. Studies relating to antibody raised to denatured proteins from the natural organisms producing the family of proteins were also useful and showed particular value of some sequences. A sequence of the formula ASVDPTIDLLQA (SEQ ID NO: 2) was identified thereby. An enlarge sequence of the formula TVTASVDPTIDLLQAD (SEQ ID NO: 3) is also especially interesting as are intermediate sequences such as sequences VTASVDPTIDLLQAD (SEQ ID NO: 4), TASVDPTIDLLQAD (SEQ ID NO: 5), and TASVDPTIDLLQA (SEQ ID NO: 6) as being binding sites for antibodies raised to the denatured proteins.

Abstract: A method for the prophylactic and therapeutic treatment of bacterial infections of the skin is disclosed which comprises the treatment of an individual with an effective amount of a native or altered version of a lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria. The lytic enzyme is selected from a group consisting of shuffled lytic enzymes, chimeric lytic enzymes, wherein the lytic enzyme is in an environment having a pH which allows for activity of said lytic enzyme; and a carrier for delivering said lytic enzyme. Additionally, a holin protein for puncturing the membrane may be included in the composition.

Abstract: A lozenge for the treatment of Streptococcus Group A infections of the mouth, throat, and nasal passage is disclosed which comprises a lytic enzyme composition specific for Streptococcus Group A and a lozenge carrier for delivering the lytic enzyme.

Abstract: A composition and method for treating bacterial infections by the use of an effective amount of at least one lytic specific for the bacteria causing specific. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria. The enzyme may be at least one lytic protein or peptides in a natural or modified form.

Abstract: The present invention discloses a composition for dermatological infections by the use of a lytic enzyme in a carrier suitable for topical application to dermal tissues. The method for the treatment of dermatological infections comprises administering a composition comprising effective amount of a therapeutic agent, with the therapeutic agent comprising a lytic enzyme produced by infecting a bacteria with phage specific for that bacteria.

Abstract: A composition and method for treating bacterial infections by the use of an effective amount of at least one lytic specific for the bacteria causing specific. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria. The enzyme may be at least one lytic protein or peptides in a natural or modified form.

Abstract: The present invention relates to an oral delivery system containing a bacteriophage associated lysin enzyme for the treatment of [Streptococcus pneumoniae and] Hemophilus influenzae sinus/nasal infections.

Abstract: The present invention discloses a method and composition for the treatment of bacterial infections by the parenteral introduction of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for that bacteria and an appropriate carrier for delivering the lytic enzyme into a patient. The injection can be done intramuscularly, subcutaneously, or intravenously.

Abstract: A nasal spray for treating a streptococcal infection is disclosed. The spray comprises an effective amount of a lysin enzyme genetically coded for by a C1 bacteriophage capable of infecting a group C Streptococcal bacteria, and a nasal spray carrier for delivering said lysin enzyme to a mouth, throat, or nasal passage.

Abstract: A composition and method for treating bacterial infections is disclosed which comprises the treatment of an individual with an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria wherein at least one lytic enzyme is selected from the group consisting of shuffled lytic enzymes, chimeric lytic enzymes, holin enzymes, and combinations thereof. A carrier may be used for delivering the lytic enzyme. This method, and composition can be used for the treatment of upper respiratory infections, skin infections, wounds, and burns, vaginal infections, eye infections, intestinal disorders and dental problems.

Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.

Abstract: A method for treating a streptococcal infection is disclosed using a nasal spray. The spray comprises an effective amount of a lysin enzyme genetically coded for by a C1 bacteriophage capable of infecting a group C Streptococcal bacteria, and a nasal spray carrier for delivering said lysin enzyme to a mouth, throat, or nasal passage.

Abstract: A tampon for treatment of Streptococcus Group B infections of the vagina is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering the lytic enzyme.

Abstract: A method for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The composition may be in the form of an isotonic solution.