Abstract: This invention relates to amino acid sequences from within a consensus peptide of the formula: 1 VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA (Seq.

Abstract: The present invention discloses a method and composition for the treatment of bacterial contamination of food by the use of a phage associated lysing enzyme, preferably blended with an appropriate carrier. The method for treating food stuffs comprises treating the food stuffs with an anti-infection agent comprising an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for the bacteria. Additionally, chimeric lytic enzymes shuffled lytic enzymes, and holin proteins, either alone or in combination, may be used to treat or prevent bacterial contamination of foodstuffs. The lytic enzyme can be used for the treatment or prevention of various strains of Staphylococcus, Streptococcus, Listeria, Salmonella, E. coli, Campylobacter, Pseudomonas, Brucella, other bacteria, and any combination thereof.

Abstract: A method for the prophylactic and therapeutic treatment of bacterial infections is disclosed which comprises the treatment of an individual with an effective amount of a native or modified version of a lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria. The lytic enzyme is selected from a group consisting of shuffled lytic enzymes, chimericlytic enzymes, wherein the lytic enzyme is in an environment having a pH which allows for activity of said lytic enzyme; and a carrier for delivering said lytic enzyme. Additionally, a holin enzyme for puncturing the membrane may be included in the composition. This method, and composition can be used for the treatment of upper respiratory infections, skin infections, wounds, and burns, vaginal infections, eye infections, intestinal disorders and dental problems.

Abstract: The present invention discloses a method and composition for the treatment of bacterial infections by the parenteral introduction of an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria wherein the lytic enzyme is selected from the group consisting of shuffled lytic enzymes, chimeric lytic enzymes, holin enzymes, and combinations thereof, wherein said lytic enzyme is in an appropriate carrier for delivering the lytic enzyme into a patient. The injection can be done intramuscularly, subcutaneously, or intravenously.

Abstract: A composition for treatment of bacterial infections of burns and wounds of the skin, comprising an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria, and a carrier for delivering said at least one lytic enzyme to the skin. The carrier may be, but is not limited to, a liquid solution applied to a bandage.

Abstract: The present invention discloses a method and composition for the treatment of bacterial contamination of food by the use of a phage associated lysing enzyme, preferably blended with an appropriate carrier. The method for treating food stuffs comprises treating the food stuffs with an anti-infection agent comprising an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for the bacteria. The lytic enzyme is preferably in an environment having a pH which allows for activity of said lytic enzyme. The lytic enzyme can be used for the treatment or prevention of various strains of Staphylococcus, Streptococcus, Listeria, Salmonella, E. coli, Campylobacter, Pseudomonas, Brucella, other bacteria and any combination thereof. Feed for livestock, poultry and beef in slaughterhouses, canned and bottled goods, salad bars, and eggs are just some of the food items that can be treated with at least one lytic enzyme to reduce the risk of food contamination by bacteria.

Abstract: A lozenge for the treatment of Hemophilus influenzae infections of the mouth throat and nasal passage is disclosed which comprises a lytic enzyme composition specific for Hemophilus influenzae, and a lozenge carrier for delivering said lytic enzyme.

Abstract: The present invention discloses a composition for dermatological infections by the use of a lytic enzyme in a carrier suitable for topical application to dermal tissues. The method for the treatment of dermatological infections comprises administering a composition comprising effective amount of a therapeutic agent, with the therapeutic agent comprising a lytic enzyme produced by infecting a bacteria with phage specific for that bacteria.

Abstract: A composition for the treatment of upper respiratory bacterial infections is disclosed which comprises a composition comprising an effective amount of a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The bacteria being treated is selected from the group consisting of Streptococcus pneumoniae and Hemophilus influenza. The carrier may be a candy, chewing gum, lozenge, troche, tablet, a powder, an aerosol, a liquid or a liquid spray.

Abstract: A chewing gum composition produced by mixing an effective amount of lysin enzyme produced by group C streptococcal bacteria infected with a C1 bacteriophage and a carrier for delivering said lysin enzyme to a mouth, throat, or nasal passage.

Abstract: A composition and method for treating bacterial dental caries by the use of an effective amount of at least one lytic specific for the bacteria causing dental caries. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria.

Abstract: A composition and method for treating bacterial dental caries by the use of an effective amount of at least one lytic specific for the bacteria causing caries. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria.

Abstract: A composition and method for treating bacterial dental caries by the use of an effective amount of at least one lytic specific for the bacteria causing dental caries. The lytic enzyme is genetically coded for by a bacteriophage which may be specific for said bacteria.

Abstract: A composition and method for treating bacterial infections is disclosed which comprises the treatment of an individual with an effective amount of at least one lytic enzyme produced by a bacteria infected with a bacteriophage specific for said bacteria wherein at least one lytic enzyme is selected from the group consisting of shuffled lytic enzymes, chimeric lytic enzymes, holin enzymes, and combinations thereof. A carrier may be used for delivering the lytic enzyme. This method, and composition can be used for the treatment of upper respiratory infections, skin infections, wounds, and burns, vaginal infections, eye infections, intestinal disorders and dental problems.

Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.

Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme.. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution. .

Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.

Abstract: A composition for treatment of bacterial infections of the eye is disclosed which comprises a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. The carrier for delivering at least one lytic enzyme to the eye may be but is not limited to the use of an isotonic solution.

Abstract: A method for the prophylactic and therapeutic treatment of Streptococcal pneumoniae infections is disclosed which comprises the treating of an individual with an effective amount of a lytic enzyme composition specific for the infecting bacteria, and a carrier for delivering said lytic enzyme. This method, and composition can be used for the treatment of upper respiratory infections, lower respiratory infections, septicemia, bacterial meningitis, and other infections involving Streptococcal pneumoniae.

Abstract: A method for the prophylactic and therapeutic treatment of bacterial infections is disclosed which comprises the treatment of an individual with an effective amount of a lytic enzyme composition specific for the infecting bacteria, with the lytic enzyme comprising an effective amount of lytic enzyme, wherein the lytic enzyme is in an environment having a pH which allows for activity of said lytic enzyme; and a carrier for delivering said lytic enzyme. This method, and composition can be used for the treatment of upper respiratory infections, skin infections, wounds, and burns, vaginal infections, eye infections, intestinal disorders and dental problems.