Abstract: An exhaust gas purifier including a casing, SCR catalysts (comprising a first SCR catalyst and a second SCR catalyst), a first backflow prevention plate, and a second backflow prevention plate. In the casing, at least a part of the catalyst passage and at least a part of the bypass passage are formed. The SCR catalysts are disposed in the catalyst passage and selectively reduce NOx included in an exhaust gas flowing in the catalyst passage. The first backflow prevention plate prevents or reduces a backflow of an exhaust gas from a second exhaust passage to the catalyst passage.

Abstract: The semiconductor device includes a semiconductor substrate of first conductivity type including a cell area and a peripheral area surrounding cell area on a principal surface thereof, a first diffusion layer which is disposed in peripheral area, surrounds the cell area and has a second conductivity type different from the first conductivity type, an electrode which is disposed in the peripheral area, is in contact with the principal surface through an opening provided in an insulating member and is connected to the first diffusion layer, and a second diffusion layer of the first conductivity type which is formed on the principal surface of a region enclosed in the electrode distant from the first diffusion layer when viewed in a direction perpendicular to the principal surface and includes a linear portion having a first width and a curved portion having a portion with a second width greater than the first width.

Abstract: An object of this invention is to provide a streptavidin mutant reduced in affinity to the naturally-occurring biotin, and to provide a modified biotin which shows a high affinity to such streptavidin mutant reduced in affinity to the naturally-occurring biotin. This invention can provide a compound composed of a dimer of modified biotin, a streptavidin mutant, angsd usage of them.

Abstract: Finding a protein of a minute amount present on a cell membrane to provide a method for producing an antibody against the protein. Producing an antibody using a protein identified by an identification method including: a labeling step of using a labeling agent comprising at least one selected from bis-iminobiotin compounds and bis-biotin compounds to obtain cells having a labeled protein; a degradation step of preparing a degradation product for an immobilization treatment, the degradation product containing the labeled protein; an immobilization step of immobilizing the labeled protein contained in the degradation product for an immobilization treatment on a stationary phase via a streptavidin mutant; a cleavage step of releasing an analysis sample from the stationary phase on which the labeled protein is immobilized; and an analysis step of analyzing the analysis sample to identify the labeled protein.

Abstract: A layered film is formed in a display region of an active matrix substrate, and a single layer vapor deposition film is formed outside the display region of the active matrix substrate such that at least part of the single layer vapor deposition film does not overlap with a single layer vapor deposition film.

Abstract: A vapor deposition mask including a metallic substrate provided with a plurality of openings for passing vapor deposition particles, wherein at least a portion of the plurality of openings are structured by one or more opening groups in which the plurality of openings are repeatedly arranged in accordance with a constant rule, and a plurality of protrusions of identical height are arranged to support the entire substrate from one side, and are provided only outside the opening group formation region.

Abstract: A urea solution spray nozzle maybe provided that can suppress the deposit and growth of urea in the urea solution spray nozzle. A urea solution spray nozzle according to at least one present embodiment is such that urea solution flow paths and gas flow paths and are constituted, and urea solution and gas are mixed and injected from an injection port, and a slit, which is a lateral ejection port, is constituted in such a manner that the gas is ejected in the same direction as the injection direction of the urea solution along surfaces of the urea solution spray nozzle, and a water-repellent coating layer is formed on the surfaces of the urea solution spray nozzle.

Abstract: The present invention provides a new method by which polymers can be modified. The present invention provides a method for modifying a polymer including the step of: irradiating a reaction system containing a polymer with light to react the reaction system in a presence of a compound radical, wherein the compound radical is a radical containing one element selected from the group consisting of Group 15 elements and Group 16 elements, and a Group 17 element.

Abstract: An injection molding machine for injecting a molten resin into a cavity of a molding die clamped in a die clamping unit via a nozzle formed in a heating cylinder to form a resin article includes a drive source. The drive source is configured to move the nozzle between a first position with the nozzle coupled to the molding die and a second position with the nozzle decoupled from the molding die. The drive source is also configured to pull out the molding die from the die clamping unit and to push the molding die into the die clamping unit.

Abstract: An exhaust gas purification system includes, as an exhaust gas path of an engine to be mounted in a ship, a main path which is in communication with outside, a bypass path which branches off from a halfway portion of the main path, and a combined casing with which both the main path and the bypass path are in communication. A selective catalyst reduction device is accommodated in the combined casing at a location close to the main path. A path-switching member which switches exhaust gas moving direction is placed in a branched portion between the main path and the bypass path. A reducing agent injection body is placed in the main path between the path-switching member and the combined casing.

Abstract: Disclosed is a gas sensor including: a wiring board; a sensor element mounted on the wiring board and electrically connected to the wiring board by conductive members; a casing installing the sensor element and formed with inlet and outlet ports; and a pretreatment unit configured to perform pretreatment on a measurement gas and feed the measurement gas to the inlet port. The inlet and outlet ports are located outward and upward of the sensor element. A protrusion is provided protruding toward the inside of the casing so as to narrow a flow path from the inlet port to the outlet port. A height from the sensor element to a distal end of the protrusion is lower than heights from the sensor element to the inlet and outlet ports. The protrusion is disposed more inside than respective top portions of the conductive members without being in contact with the conductive members.

Abstract: A rise action assistance device according to an aspect of the present disclosure is provided with: a myoelectric potential acquirer that acquires a myoelectric value of a sitting user's tibialis anterior muscle, and a myoelectric value of the sitting user's vastus lateralis muscle or a myoelectric value of the sitting user's vastus medialis muscle; an angle acquirer that acquires a bend angle of the sitting user's upper body; a detector circuit that detects a start of a rise action by the user, based on the myoelectric value of the user's tibialis anterior muscle, the myoelectric value of the user's vastus lateralis muscle or the myoelectric value of the user's vastus medialis muscle, and the bend angle of the user's upper body; and an assistor that starts assistance of the rise action after the start of the rise action is detected.

Abstract: A catalytic reactor (12) including: a first opening (13a) located in a side surface of a catalytic reactor (12); a plurality of catalytic cassettes (14) charged into the catalytic reactor (12) through the first opening (13a) toward a side surface opposed to the first opening (13a) so that the plurality of catalytic cassettes (14) is arranged adjacent to each other; and a fixing member (34) configured to be urged by a first lid member (26) closing the first opening (13a) and to press upper surfaces of the plurality of catalytic cassettes (14). The fixing member (14) is disposed to extend along a direction from the first opening (13a) to the side surface opposed to the first opening (13a).

Abstract: A three-dimensional display device configured to display a main image and an additional image on a screen includes a display region candidate decider that decides one candidate region from a plurality of region candidates for the additional image to be superimposed on the main image on the screen, a depth suitability determiner that determines whether a difference between a depth of the main image displayed at a boundary region and a depth of the additional image is within a predetermined tolerance range, and an image composer that, when the difference in depth between the depth of the main image displayed at the boundary region and the depth of the additional image is within the tolerance range, superimposes the additional image upon the main image at the candidate region, thereby composing a composite image of the main image and the additional image, and displays the composite image on the screen.

Abstract: A gas sensor includes an adjustment unit having a concentration adjuster which changes the concentration of a particular gas component contained in measured gas introduced into a first chamber, a sensor unit having a second chamber for receiving the measured gas which has passed through the adjustment unit and a detector whose electrical characteristic changes with the concentration of the particular gas component, a single heater for heating the concentration adjuster and the detector, and a gas flow tube having the form of a pipe, at least partially running externally of the adjustment unit and of the sensor unit, and adapted to establish communication between the first chamber and the second chamber. The adjustment unit, the sensor unit, and the heater are united together in such a manner as to establish thermal coupling between the adjustment unit and the heater and thermal coupling between the sensor unit and the heater.

Abstract: The invention provides a lactate dehydrogenase inhibitor that makes it possible to suppress refractory epilepsy in which conventional antiepileptic drugs are ineffective, and an antiepileptic drug containing said inhibitor. The lactate dehydrogenase inhibitor of the invention contains a compound represented by formula (III); i.e., isosafrole or a compound having isosafrole as a scaffold, and the antiepileptic drug of the invention has these compounds as an active ingredient.

Abstract: An injection molding machine for injecting a molten resin into a cavity of a molding die clamped in a die clamping unit via a nozzle formed in a heating cylinder to form a resin article includes a drive source. The drive source is configured to move the nozzle between a first position with the nozzle coupled to the molding die and a second position with the nozzle decoupled from the molding die. The drive source is also configured to pull out the molding die from the die clamping unit and to push the molding die into the die clamping unit.

Abstract: A three-dimensional display device includes: a display region candidate deciding unit that decides a candidate region of an additional image which shields part of a main image of a three-dimensional image on a screen; a depth suitability determination unit that determines whether a difference in depth between the main image and the additional image is within a tolerance range; an image compositing unit that superimposes the additional image upon the candidate region on the main image, and displays the composited image; and a possibly-unsuitable region deciding unit that decides, in the main image, a first region that may protrude to a near side beyond a predetermined depth range, and a second region that may recess to a far side beyond a predetermined depth range. The display region candidate deciding unit further decides a candidate region to shield the first and second regions.

Abstract: A gas concentration measuring device (1) including a light emitter (3) and a light receiver (4) which are disposed so as to be opposed to each other with a hollow tube-like measurement pipe (2) interposed therebetween. The device (1) is configured to measure concentration of target gas passing through the measurement pipe (2) using light applied from the light emitter (3) transmitted through the inside of the measurement pipe (2), and received by the light receiver (4). Purge gas guide pipes (11, 13) through which purge gas is introduced into optical systems of the light emitter (3) and the light receiver (4) are connected to a side wall of the measurement pipe (2). The measurement pipe (2) includes a gas entrance portion (21) having a tapered shape widening from a gas supply port toward a downstream side thereof.

Abstract: Disclosed is a method of treatment for anti-Alzheimer's disease based on an action mechanism associated with amyloid ? protein, which action mechanism is different from conventional action mechanisms. The treatment Alzheimer's disease uses a therapeutic agent for cognitive impairment induced by amyloid ? protein, which therapeutic agent comprises a peptide having the amino acid sequence represented by SEQ ID NO:1 or a peptide similar to this peptide, especially a peptide containing the amino acid sequence represented by SEQ ID NO:2, which is a partial sequence of SEQ ID NO:1. VLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAAT (SEQ ID NO:1) HRGHQPPPEMA (SEQ ID NO:2).