Abstract: An imaging device images a sample holder held by a sample stage. At a front side (target side) of the imaging device, a light emitter device array and a mask array are provided. A plurality of light beams are generated by the light emitter device array. A plurality of center parts of the plurality of light beams are masked by the mask array. A plurality of shadows produced thereby are covered by a plurality of peripheral parts of the plurality of light beams.

Abstract: First shape data representing a three-dimensional shape of a sample unit including a sample is generated based on a result of three-dimensional shape measurement of the sample. Second shape data representing a three-dimensional shape of a structure which exists in a sample chamber is generated. Movement of the sample unit is controlled based on the first shape data and the second shape data such that collision of the sample unit with the structure does not occur.

Abstract: A slide device includes a lower rail; an upper rail disposed movably with respect to the lower rail; a screw provided on one of the lower rail and the upper rail; and a nut provided on the other one of the lower rail and the upper rail, and engaging the screw, wherein: the upper rail moves relatively with respect to the lower rail in accordance with rotation of at least one of the screw and the nut; the lower rail includes a bottom wall, a side wall extending upward from the bottom wall, and an upper wall extending toward the center in a width direction from the side wall; and the screw or the nut provided on the lower rail has a central axis line which is disposed in a space enclosed by the bottom wall, the side wall, and the upper wall of the lower rail.

Abstract: A slide device including a lower rail including a bottom wall, a side wall extending upward from the bottom wall, and a top wall extending from the side wall toward the center in a width direction; and an upper rail movable in a longitudinal direction in the lower rail, wherein: the side wall has a first regulating portion provided lower than the center in a vertical direction thereof, the first regulating portion engaging the upper rail and thereby regulating upward movement of the upper rail; and the bottom wall has a second regulating portion extending upward from the bottom wall, the second regulating portion engaging the upper rail and thereby regulating upward movement of the upper rail.

Abstract: According to an embodiment, a vehicle seat sliding device includes a rotary member that integrally rotates with a screw rod, a swinging member that is supported on an upper rail in a manner capable of swinging in a state in which the rotation around a rotational center is restricted and that rotatively supports the rotary member and integrally swings with the rotary member, and receiving members that are fixed to a lower rail and support the swinging member in a manner capable of swinging.

Abstract: A seat rotating device for a vehicle includes: a plate used to support a seat; and a pair of guide rails arranged side by side in a vehicle width direction and supporting the plate. The guide rails each have a fixed rail and a sliding member that supports the plate and is slidable along the fixed rail. The plate includes guides that guide each of the sliding members. The guides are configured such that the plate rotates while causing the sliding members to move in directions opposite to each other or the plate rotates based on movement of the sliding members in directions opposite to each other.

Abstract: A reduction gear includes a housing, a worm, a worm wheel, and a drive gear. The worm is located in the housing and rotates by power of a motor. The worm wheel is moved in cooperation with the worm. The drive gear is moved in cooperation with the worm wheel. The drive gear overlaps the worm. The housing includes a partition wall located between the worm and the drive gear.

Abstract: A motor control device controls driving of a motor, which outputs torque to a rack shaft as a load by rotation of a shaft fixed to a rotor. The motor control device has a rotation stress check unit for determining a rotation stress indicating a rotation stress, which is applied inversely from the load to a protection target member such as a shaft, bearing and oil seal related to the rotation of the shaft or torque transmission to the load. The rotation stress check unit determines the rotation stress is excessive based on that an absolute value of a rotation evaluation value exceeds a stress threshold value. The rotation evaluation value is a rotation angular velocity, a rotation angular acceleration or a related value corresponding to the rotation angular velocity or the rotation angular acceleration. The stress threshold value is set to be larger than an absolute value of an upper limit value realized in normal drive control.

Abstract: A power seat slide device includes, for example, a nut member fixed to one of a floor and a seat in a vehicle; a rod screw member that is placed on the other of the floor and the seat in a lengthwise direction of the vehicle, and is to be screwed into the nut member; a screw-through member that is fixed to the other of the floor and the seat, and provided with a through hole through which the rod screw member rotatably passes; a screw fixing member fixed to part of the rod screw member in an axial direction; and a plurality of roll members arranged around the rod screw member in a circumferential direction, to come into sliding contact with the screw-through member and the screw fixing member in the axial direction.

Abstract: A non-aqueous electrolyte secondary battery has a positive electrode having a positive electrode active material layer, a negative electrode having a negative electrode active material layer, and an electrolyte layer having an electrolyte solution containing a non-aqueous solvent. At least one of the positive electrode active material layer and the negative electrode active material layer contains an electrode material for a non-aqueous electrolyte secondary battery having a core part including an electrode active material and a shell part including a conductive material in a base material formed by a gel-forming polymer having a liquid absorption rate with respect to the electrolyte solution of 10 to 200%.

Abstract: A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 ?M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: A vehicle seat sliding device includes: a lower rail fixed to a vehicle floor; an upper rail slidably engaging with the lower rail and supports a vehicle seat upward; a nut member fixed to a first rail which configures one side of the lower rail and the upper rail; a screw rod screwed into the nut member; a drive unit rotating the screw rod; and a support supporting the screw rod on a second rail which configures the other side of the lower rail and the upper rail. The support includes a holding member that is provided with an insertion hole into which the screw rod is inserted and that is fixed to the second rail, and a holding nut that is provided with a through-hole into which the screw rod is inserted and that is screwed to a screwing portion provided on the screw rod or the holding member.

Abstract: The present invention addresses the problem of providing: a method for producing brown adipocytes, osteoblasts, cartilage cells, neural cells, or cardiac cells from somatic cells without performing artificial gene transfer; brown adipocytes, osteoblasts, cartilage cells, neural cells, or cardiac cells; or a composition including a combination of chemical substances that can be used for the aforementioned production method. An example of the present invention is a method for producing brown adipocytes, osteoblasts, cartilage cells, neural cells, or cardiac cells including a step for culturing somatic cells in the presence or absence of an inhibitor or activator selected from the group consisting of an ALK5 inhibitor, an ALK6 inhibitor, an AMPK inhibitor, a cAMP activator, an ALK2 inhibitor, an ALK3 inhibitor, a GSK3 inhibitor, and an Erk inhibitor.

Abstract: A display apparatus includes: a display device including pixels each including a light emitting element; a voltage generator configured to generate a plurality of different voltages; a switching device configured to be capable of switching the voltages in a manner such that any one of the voltages is applied to each of the pixels; and a controller configured to control operation of the switching device. The controller is configured to cause, at least once during a period for displaying an image corresponding to one frame, the switching device to operate in a manner such that voltages applied to the pixel are switched from a lower to a higher voltage.

Abstract: A vehicle seat device lifts and lowers a seat. The vehicle seat device includes a base, a lifter link, and a drive device. The lifter link includes a plurality of members that move a seat cushion of the seat vertically relative to the base. The drive device is coupled to the lifter link. The drive device relatively moves the lifter link. The drive device is attached to the base, a vehicle floor, or a seat-mounting device fixed to the vehicle floor.

Abstract: A seat rotating device for a vehicle includes: a plate used to support a seat; and a pair of guide rails arranged side by side in a vehicle width direction and supporting the plate. The guide rails each have a fixed rail and a sliding member that supports the plate and is slidable along the fixed rail. The plate includes guides that guide each of the sliding members. The guides are configured such that the plate rotates while causing the sliding members to move in directions opposite to each other or the plate rotates based on movement of the sliding members in directions opposite to each other.

Abstract: According to an embodiment, a vehicle seat sliding device includes a rotary member that integrally rotates with a screw rod, a swinging member that is supported on an upper rail in a manner capable of swinging in a state in which the rotation around a rotational center is restricted and that rotatively supports the rotary member and integrally swings with the rotary member, and receiving members that are fixed to a lower rail and support the swinging member in a manner capable of swinging.

Abstract: A vehicle seat sliding device includes: a lower rail configured to be fixed to a vehicle floor; an upper rail slidably engaging with the lower rail and configured to support a vehicle seat upward; a screw rod is rotatably supported by a first rail configuring one side of the lower and upper rails; a drive unit driving rotation of the screw rod; a nut member provided with a screw hole into which the screw rod is screwed; and a nut holding member fixed to a second rail configuring the other side of the lower and upper rails, and holding the nut member, in which one and the other of the nut and nut holding members are provided with a support shaft and an arcuate groove, respectively, and the nut holding member regulates integral rotation of the screw rod and the nut member, and allows the nut member to rotate around a second rotation axis.

Abstract: An object of the present invention is to provide a resin for coating an active material for lithium ion batteries which can prevent expansion of the electrode without inhibiting conduction of lithium ions. The resin for coating an active material for lithium ion batteries according to the present invention has a liquid absorbing rate of 10% or more when the resin is immersed in an electrolyte solution, and a tensile elongation at break of 10% or more when the resin is saturated with the electrolyte solution.