Abstract: Provided herein are methods of producing three-dimensional (3-D) microtissue from a starting cell suspension of pluripotent stem cell (PSC)-derived hepatocytes. Such a method may comprise supplementing the cell suspension with cell adhesion-promoting components and culturing the PSC-derived hepatocytes on a non-adhesive surface to produce the microtissue.

Abstract: Provided are a method for culturing pluripotent stem cells including a culturing process of bringing pluripotent stem cells into contact with a polypeptide which has cell adhesion activity and includes a first domain for binding bFGF and a second domain for adhering to a culture vessel and culturing the pluripotent stem cells, in which bFGF is bound to the first domain, and the second domain is adhered to the culture vessel; a method for culturing pluripotent stem cells including a culturing process of bringing bFGF, which is directly or indirectly adhered to a culture vessel, and a polypeptide, which has cell adhesion activity and is adhered to the culture vessel, into contact with pluripotent stem cells and culturing the pluripotent stem cells; and applications thereof.

Abstract: A display apparatus includes: a display device including pixels each including a light emitting element; a voltage generator configured to generate a plurality of different voltages; a switching device configured to be capable of switching the voltages in a manner such that any one of the voltages is applied to each of the pixels; and a controller configured to control operation of the switching device. The controller is configured to cause, at least once during a period for displaying an image corresponding to one frame, the switching device to operate in a manner such that voltages applied to the pixel are switched from a lower to a higher voltage.

Abstract: A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Abstract: A core-shell-type electrode material is used as an electrode active material layer of a non-aqueous electrolyte secondary battery, the core-shell-type electrode material having a core part in which at least a part of a surface of an electrode active material is coated with a first conductive material and a shell part in which a second conductive material is contained in a base material formed by a gel-forming polymer having a tensile elongation at break of 10% or more in a gel state.

Abstract: A core-shell-type electrode material is used as an electrode active material layer of a non-aqueous electrolyte secondary battery, the core-shell-type electrode material having a core part including an electrode active material and a shell part in which a conductive material is contained in a base material formed by a gel-forming polymer having a tensile elongation at break of 10% or more in a gel state.

Abstract: A vehicle seat sliding device includes: a lower rail configured to be fixed to a vehicle floor; an upper rail slidably engaging with the lower rail and configured to support a vehicle seat upward; a screw rod is rotatably supported by a first rail configuring one side of the lower and upper rails; a drive unit driving rotation of the screw rod; a nut member provided with a screw hole into which the screw rod is screwed; and a nut holding member fixed to a second rail configuring the other side of the lower and upper rails, and holding the nut member, in which one and the other of the nut and nut holding members are provided with a support shaft and an arcuate groove, respectively, and the nut holding member regulates integral rotation of the screw rod and the nut member, and allows the nut member to rotate around a second rotation axis.

Abstract: A vehicle seat sliding device includes: a lower rail fixed to a vehicle floor; an upper rail slidably engaging with the lower rail and supports a vehicle seat upward; a nut member fixed to a first rail which configures one side of the lower rail and the upper rail; a screw rod screwed into the nut member; a drive unit rotating the screw rod; and a support supporting the screw rod on a second rail which configures the other side of the lower rail and the upper rail. The support includes a holding member that is provided with an insertion hole into which the screw rod is inserted and that is fixed to the second rail, and a holding nut that is provided with a through-hole into which the screw rod is inserted and that is screwed to a screwing portion provided on the screw rod or the holding member.

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.

Abstract: A non-aqueous electrolyte secondary battery has a positive electrode having a positive electrode active material layer, a negative electrode having a negative electrode active material layer, and an electrolyte layer having an electrolyte solution containing a non-aqueous solvent. At least one of the positive electrode active material layer and the negative electrode active material layer contains an electrode material for a non-aqueous electrolyte secondary battery having a core part including an electrode active material and a shell part including a conductive material in a base material formed by a gel-forming polymer having a liquid absorption rate with respect to the electrolyte solution of 10 to 200%.

Abstract: A polypeptide composition induces a pluripotent stem cell culturing property, particularly, an excellent cell growth ability. The polypeptide composition contains a predetermined polypeptide including an amino acid sequence of human vitronectin or an amino acid sequence of a predetermined first region derived from human vitronectin. The polypeptide composition includes a multimeric polypeptide, which is composed of two or more monomers held together by intermolecular cross-linking via cysteine residues included in the first region, in an amount equal to or less than 20% by mass of a total mass of polypeptides contained in the composition. A culture method for pluripotent stem cells includes culturing pluripotent stem cells in the presence of the polypeptide composition. Also provided is a culture vessel including a support which has a cell culture surface and the polypeptide contained in the polypeptide composition disposed on the cell culture surface of the support.

Abstract: A core-shell-type electrode material is used as an electrode active material layer of a non-aqueous electrolyte secondary battery, the core-shell-type electrode material having a core part in which at least a part of a surface of an electrode active material is coated with a first conductive material and a shell part in which a second conductive material is contained in a base material formed by a gel-forming polymer having a tensile elongation at break of 10% or more in a gel state.

Abstract: A culture method for pluripotent stem cells includes culturing pluripotent stem cells on a cell culture surface of a support by using a medium in which the concentration of 2-mercaptoethano is equal to or less than 10 ?M in the presence of a polypeptide consisting of 40 to 450 amino acid residues, in which the polypeptide includes (1) a first domain including at least one amino acid sequence selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO: 1) and an amino acid sequence represented by RGD and (2) a second domain including (2-i) an amino acid sequence which is represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO: 2), (2-ii) an amino acid sequence which shares sequence identity of equal to or higher than 50% with the amino acid sequence represented by SEQ ID NO: 2 and exhibits adsorbability with respect to the cell culture surface of the support, or (2-iii) an amino acid sequence which is formed by the addition, substitution, or deletion of 1 to 30 amino acids

Abstract: A core-shell-type electrode material is used as an electrode active material layer of a non-aqueous electrolyte secondary battery, the core-shell-type electrode material having a core part including an electrode active material and a shell part in which a conductive material is contained in a base material formed by a gel-forming polymer having a tensile elongation at break of 10% or more in a gel state.

Abstract: A culture method for pluripotent stem cells includes obtaining a polypeptide-coated culture surface by applying a polypeptide to a cell culture surface of a support, and culturing pluripotent stem cells by seeding the pluripotent stem cells onto the polypeptide-coated culture surface by using a medium in which the content of an ascorbic acid derivative is equal to or greater than 1.5 mmol/L (mM), in which the polypeptide is (a) a polypeptide having an amino acid sequence represented by SEQ ID NO: 1, (b) a polypeptide having an amino acid sequence, which shares identity of equal to or higher than 80% with the amino acid sequence represented by SEQ ID NO: 1, and having culture performance for pluripotent stem cells, or (c) a polypeptide having an amino acid sequence, which is formed by the deletion, substitution, or addition of one amino acid or several amino acids in SEQ ID NO: 1, and having culture performance for pluripotent stem cells.

Abstract: An object of the present invention is to provide a resin for coating an active material for lithium ion batteries which can prevent expansion of the electrode without inhibiting conduction of lithium ions. The resin for coating an active material for lithium ion batteries according to the present invention has a liquid absorbing rate of 10% or more when the resin is immersed in an electrolyte solution, and a tensile elongation at break of 10% or more when the resin is saturated with the electrolyte solution.

Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.