Abstract: An engine valve actuation mechanism for producing a variable engine valve event includes a cam, a rocker arm, a rocker arm shaft, an eccentric rocker arm bushing, and a bushing actuation device. The eccentric rocker arm bushing is disposed in an axial hole in the rocker arm, the rocker arm shaft being disposed in the eccentric rocker arm bushing with the rocker arm shaft and the eccentric rocker arm bushing having offset axial centerlines. One end of the rocker arm and the cam is connected to form a kinematic pair and the other end of the rocker arm is located above the engine valve with a gap between the cam and the engine valve. The bushing actuation device is placed in the rocker arm and drives the eccentric rocker arm bushing to rotate, and the rotation of the eccentric rocker arm bushing changes the gap to generate the variable engine valve event.

Abstract: A combined rocker arm apparatus for actuating auxiliary valve of engine, comprises an auxiliary actuator, a main rocker arm and a secondary rocker arm. The auxiliary actuator comprises an auxiliary rocker arm and an auxiliary cam. The auxiliary rocker arm and the main rocker arm are mounted on the rocker arm shaft in parallel. The auxiliary rocker arm is connected to the auxiliary cam at one end and adjacent to the secondary rocker arm at the other end. The auxiliary rocker arm includes a drive mechanism which provided with a piston. In the non-operation mode of the drive mechanism, the piston is drawn back, then the auxiliary rocker arm is disconnected with the secondary rocker arm; in the operation mode of the drive mechanism, the piston is pushed out, then the auxiliary rocker arm is connected with the secondary rocker arm.

Abstract: An auxiliary valve actuating mechanism of an engine includes a first valve actuating mechanism and an auxiliary valve actuating mechanism. The auxiliary valve actuating mechanism comprises an auxiliary cam, an auxiliary rocker-arm shaft, an auxiliary rocker arm, an eccentric rocker arm bushing and a bushing actuation device. One end of the auxiliary rocker arm constitutes a motion pair with the auxiliary cam and the other end is above the valve. The bushing actuation device actuates the eccentric rocker arm bushing to rotate between an operating position and a non-operating position.

Abstract: A method and apparatus for resetting a valve lift for use in an engine brake. A brake piston (160), and a hydraulic fluid passage (214) are arranged within a rocker arm (210) or a valve bridge (400) of an engine. A resetting valve arranged between the rocker arm (210) and the valve bridge (400) is driven by a change in the distance between the rocker arm (210) and the valve bridge (400). When the valve lift of an engine exhaust valve (300) reaches a maximum, a reset fluid passage (219) is opened, the hydraulic pressure within the hydraulic fluid passage is released, the brake piston (160) is reversed by one interval, the motion transmission between a cam (230) and the engine exhaust valve (300) is partially disengaged, and the valve lift of the engine exhaust valve (300) is reduced.

Abstract: A fixed chain engine braking device includes a brake box, a driving mechanism and a braking mechanism. One upright blind hole and one horizontal blind hole are placed in the brake box, and the upright blind hole intersects the horizontal blind hole orthogonally. The driving mechanism includes a rolling ball and/or a driving piston placed in the horizontal blind hole, the braking mechanism includes a braking plunger placed in the upright blind hole. A fluid passage is placed in the brake box, and the fluid passage is communicated with the entry of the horizontal blind hole.

Abstract: Methods and systems are disclosed for forcing at least some members of a communication group to join a new group call when they are participating in an another group call to a different communication group. A wireless communication device that seeks to initiate the new group call transmits a request-to-transmit (RTT) on a reverse channel to initiate the new group call. This way, at least some of group members participating in the other group call can be allowed to join the new group call. The recipients of the RTT can then switch from a primary channel on which the other group call is taking place to an alternative channel to join the new group call. In one implemenation, the disclosed embodiments can be applied to a two-way wireless communication system that employs a TDMA channel access scheme.

Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogs and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.

Abstract: A reset rocker arm braking method and device are provided. A braking piston hole and an oil drain piston hole which are communicated with a braking oil supply passage are arranged inside a rocker arm, and an oil drain passage is arranged between the braking piston hole and the oil drain piston hole. When the rocker arm is driven by a braking cam lobe of a cam, an exhaust valve is opened to realize braking by a braking piston inside the braking piston hole. When the rocker arm is driven by an exhaust cam lobe of the cam, the rocker arm drives an oil drain piston in the oil drain piston hole to open the oil drain passage to discharge oil, and the lift profile of the exhaust valve is reset and reduced to a conventional exhaust valve lift profile without an engine braking.

Abstract: A printed circuit board (PCB) includes two power supply units, a central processing unit (CPU), two inductors and a temperature compensation resistor. One of the inductor is electrically connected between one power supply unit and the CPU, the other inductor is electrically connected between another power supply unit and the CPU. The temperature compensation resistor is electrically connected between the power supply units and ground, and is positioned between the two inductors to adjust output voltage from the CPU.

Abstract: Disclosed is a two-way radio frequency (RF) communications system including a first device that receives, from a first subscriber unit, a virtual radio conferencing call (VRC) request identifying a plurality of other subscriber units to be partied to the VRC call and a conference time period during which to conduct the VRC call. The device reserves RF resources at one or more corresponding radio sites associated with the subscriber units partied to the VRC call for the conference time period. At a beginning of the conference time period, the device causes a virtual radio conference call start message to be transmitted to the subscriber units partied to the call instructing the subscriber units to join the VRC call via the reserved RF resources at their respective radio sites.

Abstract: A reset rocker arm braking method and device are provided. A braking piston hole and an oil drain piston hole which are communicated with a braking oil supply passage are arranged inside a rocker arm, and an oil drain passage is arranged between the braking piston hole and the oil drain piston hole. When the rocker arm is driven by a braking cam lobe of a cam, an exhaust valve is opened to realize braking by a braking piston inside the braking piston hole. When the rocker arm is driven by an exhaust cam lobe of the cam, the rocker arm drives an oil drain piston in the oil drain piston hole to open the oil drain passage to discharge oil, and the lift profile of the exhaust valve is reset and reduced to a conventional exhaust valve lift profile without an engine braking.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lives and better oxidative resistance to materials than currently available antioxidants.

Abstract: In a method for modularizing power supplies placed on a printed circuit board (PCB) using a computing device, a circuit design drawing of a power supply is obtained from a database. The method acquires circuit design data of the power supply from the circuit design drawing of the power supply, and modularizes the circuit design data to generate a virtual power supply. The method generates a first layout of the virtual power supply on the PCB in a landscape orientation according to a horizontal dimension of the PCB, and generates a second layout of the virtual power supply on the PCB in a portrait orientation according to a vertical dimension of the PCB. A component information system (CIS) management library is created in the database, and the first layout and the second layout of the virtual power supply are stored in the CIS management library.

Abstract: Disclosed is a two-way radio frequency (RF) communications system including a first device that receives, from a first subscriber unit, a virtual radio conferencing call (VRC) request identifying a plurality of other subscriber units to be partied to the VRC call and a conference time period during which to conduct the VRC call. The device reserves RF resources at one or more corresponding radio sites associated with the subscriber units partied to the VRC call for the conference time period. At a beginning of the conference time period, the device causes a virtual radio conference call start message to be transmitted to the subscriber units partied to the call instructing the subscriber units to join the VRC call via the reserved RF resources at their respective radio sites.

Abstract: A combined rocker arm apparatus for actuating auxiliary valve of engine, comprises an auxiliary actuator, a main rocker arm and a secondary rocker arm. The auxiliary actuator comprises an auxiliary rocker arm and an auxiliary cam. The auxiliary rocker arm and the main rocker arm are mounted on the rocker arm shaft in parallel. The auxiliary rocker arm is connected to the auxiliary cam at one end and adjacent to the secondary rocker arm at the other end. The auxiliary rocker arm includes a drive mechanism which provided with a piston. In the non-operation mode of the drive mechanism, the piston is drawn back, then the auxiliary rocker arm is disconnected with the secondary rocker arm; in the operation mode of the drive mechanism, the piston is pushed out, then the auxiliary rocker arm is connected with the secondary rocker arm.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lifes and better oxidative resistance to materials than currently available antioxidants.

Abstract: A system and method of actuating one or more engine valves is disclosed. In one embodiment, the system comprises: a valve train element; a rocker arm pivotally mounted on a shaft and adapted to rotate between a first position and a second position, the rocker arm selectively receiving motion from the valve train element; a valve bridge disposed above the one or more engine valves; and a lost motion system disposed in the valve bridge.

Abstract: An auxiliary valve actuating mechanism of an engine includes a first valve actuating mechanism and an auxiliary valve actuating mechanism. The auxiliary valve actuating mechanism comprises an auxiliary cam, an auxiliary rocker-arm shaft, an auxiliary rocker arm, an eccentric rocker arm bushing and a bushing actuation device. One end of the auxiliary rocker arm constitutes a motion pair with the auxiliary cam and the other end is above the valve. The bushing actuation device actuates the eccentric rocker arm bushing to rotate between an operating position and a non-operating position.

Abstract: The present invention provides an active peptide purified from scorpions, and derivatives, analogues and active fragment which are produced by using genetic engineering technology. The analgesic active peptide VGG is extracted, separated and purified from scorpion, and its amino acid sequence is shown as below: VKDGYIADDRNCPYFCGRNAYCDGECKKNRAESGYCQWASKYGNACWCY KLPDDARIMKPGRCNGG. The present invention further provides a use of the peptides in preparation of an analgesic drug, where the peptide is mixed with a pharmaceutically acceptable carrier to prepare into forms for injection, oral administration, transdermal absorption, and transmucosal absorption.

Abstract: Disclosed are compositions comprising antioxidants and stabilizers, such as, acid scavengers or organic phosphorus stabilizers, and optionally further comprising co-stabilizers. The disclosed compositions are useful as stabilizers for polyolefins and other polymeric materials. The disclosed compositions and methods generally provide longer shelf lives and better oxidative resistance to materials than currently available antioxidants.