Antibodies against signal-regulatory protein α and methods of use
Provided herein, inter alia, are isolated, humanized antibodies that bind an extracellular domain of a human SIRP-α polypeptide. Also provided are polynucleotides, vectors, host cells, and methods of production and use related thereto.
This application claims the priority benefit of U.S. Provisional Application Ser. No. 62/646,210, filed Mar. 21, 2018, which is hereby incorporated by reference in its entirety.
SUBMISSION OF SEQUENCE LISTING ON ASCII TEXT FILEThe content of the following submission on ASCII text file is incorporated herein by reference in its entirety: 757972000600SEQLIST.txt, date recorded: Mar. 19, 2019, size: 230 KB).
FIELDThe present disclosure relates to isolated, humanized antibodies that bind an extracellular domain (e.g., the D1 domain) of a human SIRP-α polypeptide, as well as polynucleotides, vectors, host cells, and methods related thereto.
BACKGROUNDSignal-regulatory protein alpha (SIRP-α) is part of a family of cell-surface receptors that plays critical roles in the regulation of the immune system (see, e.g., Barclay, A. N. and Brown, M. H. (2006) Nat. Rev. Immunol. 6:457-64). SIRP-α is expressed on the surface of various cells, including leukocytes such as dendritic cells, eosinophils, neutrophils, and macrophages. SIRP-α includes an extracellular domain that interacts with external stimuli such as ligands and an intracellular domain that mediates a variety of intracellular signals.
One of the major roles of SIRP-α is its regulation of the immune response through interactions with CD47. CD47 is expressed on the surface of a variety of cell types. When the IgSF domain of CD47 binds the extracellular domain (e.g., the D1 domain) of SIRP-α expressed on an immune cell (e.g., a macrophage), this transduces a SIRP-α-mediated signal in the immune cell that prevents phagocytosis of the CD47-expressing cell. Thus, CD47 serves to convey what has been termed a “don't eat me” signal to the immune system that prevents phagocytosis of healthy cells (see, e.g., WO2015/138600 and Weiskopf, K. et al. (2013) Science 341:88-91). However, CD47 has also been shown to be highly expressed by a variety of cancers, and its interaction with SIRP-α in this context is thought to allow tumors to mimic the healthy “don't eat me” signal in order to evade immune surveillance and phagocytosis by macrophages (see, e.g., Majeti, R. et al. (2009) Cell 138:286-99; Zhao, X. W. et al. (2011) Proc. Natl. Acad. Sci. 108:18342-7). As such, antibodies that block this interaction are highly desirable.
SIRP-α is known to be a highly polymorphic protein in humans, monkeys, and mice. For example, polymorphic differences have been identified between SIRP-α proteins in the NOD and C57BL/6 mouse strains, and these polymorphisms lead to functional consequences related to CD47 binding and engraftment of human hematopoietic stem cells in these mouse strains. In humans, two prevalent alleles of the SIRPA gene have been reported (Treffers, L W. et al. (2018), Eur. J. Immunol. 48:344-354; Zhao, X. et al. (2011), PNAS. 108:18342-47; van der Heijden, J. (2014). Genetic variation in human Fc gamma receptors: Functional consequences of polymorphisms and copy number variation (Doctoral dissertation)).
Due to the importance of the SIRP-α-CD47 interaction in normal immune function and tumorigenesis, the identification of antibodies that bind human SIRP-α is of great interest for development of clinical candidates.
All references cited herein, including patent applications, patent publications, non-patent literature, and UniProtKB/Swiss-Prot Accession numbers are herein incorporated by reference in their entirety, as if each individual reference were specifically and individually indicated to be incorporated by reference.
SUMMARYTo meet these and other needs, provided herein, inter alia, are isolated antibodies that bind an extracellular domain of a human SIRP-α polypeptide. Advantageously, these antibodies possess one or more of many useful in vitro and/or in vivo properties, such as binding to multiple SIRP-α polypeptides with high affinity, cross-reactivity against multiple mammalian SIRP-α polypeptides (e.g., human v1, human v2, cynomolgus, and/or multiple murine SIRP-α proteins), the ability to enhance macrophage phagocytosis, the ability to enhance dendritic cell activation, and/or the ability to inhibit in vivo growth of a tumor that expresses CD47. In addition, the present disclosure provides antibodies with variant light chains that have been engineered to remove potential liabilities, such as residues that may be modified by deamidation or glycation, resulting in antibodies with more desirable characteristics for manufacturing, storage, and/or drug development.
In certain aspects, the present disclosure provides antibodies (e.g., isolated antibodies) that bind an extracellular domain of a human SIRP-α polypeptide, where the antibodies comprise: a heavy chain comprising a heavy chain variable (VH) domain that comprises the amino acid sequence of SEQ ID NO:26; and a light chain comprising a light chain variable (VL) domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCS GGSYS SYYYAWYQQKPGQAPVTLIYSDDKRPSNI PERFSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), wherein X1 is G or T; X2 is K, Q, or R; and X3 is L or V, and wherein the VL domain does not comprise the sequence of SEQ ID NO:25.
In some embodiments, the VL domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:39-41. In some embodiments, the light chain further comprises a light chain constant (CL) domain sequence that comprises an amino acid sequence according to the formula GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETT KPSKQSX4X5KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO:72), wherein X4X5 is ND, DN, DS, or SD. In some embodiments, the light chain further comprises a light chain constant (CL) domain sequence that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:43-46. In some embodiments, the light chain further comprises a kappa light chain constant (CL) domain. In some embodiments, the light chain comprises the amino acid sequence of SEQ ID NO:36. In some embodiments, the light chain further comprises a lambda light chain constant (CL) domain. In some embodiments, the light chain comprises the amino acid sequence of SEQ ID NO:37 or SEQ ID NO:38. In some embodiments, the light chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:48-57.
In some embodiments, the antibody is a scFv-Fc, single domain antibody, single heavy chain antibody, or single light chain antibody. In some embodiments, the antibody is a monoclonal antibody. In some embodiments, the antibody comprises a heavy chain comprising a heavy chain constant domain that comprises an Fc region. In some embodiments, the Fc region is a human Fc region selected from the group consisting of an IgG1 Fc region, an IgG2 Fc region, and an IgG4 Fc region. In some embodiments, the Fc region is a human IgG1 Fc region. In some embodiments, the Fc region is a human IgG1 Fc region comprising L234A, L235A, and G237A substitutions, amino acid position numbering according to EU. In some embodiments, the Fc region is a human IgG2 Fc region. In some embodiments, the Fc region is a human IgG2 Fc region comprising A330S and P331S substitutions, amino acid position numbering according to EU. In some embodiments, the Fc region further comprises an N297A substitution, amino acid position numbering according to EU. In some embodiments, the Fc region is a human IgG2 Fc region comprising an N297A substitution, amino acid position numbering according to EU. In some embodiments, the Fc region is a human IgG4 Fc region, and wherein the heavy chain comprises an S228P substitution, amino acid position numbering according to EU. In some embodiments, the heavy chain comprises a heavy chain constant domain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:31-35. In some embodiments, the heavy chain comprises a heavy chain constant domain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:33, 34, and 137. In some embodiments, the heavy chain comprises a heavy chain constant domain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:132-139.
In some embodiments, the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:58-62. In some embodiments, the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:60, 61, and 129. In some embodiments, the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:124-131.
In certain aspects, the present disclosure provides antibodies (e.g., isolated antibodies) that bind an extracellular domain of a human SIRP-α polypeptide, wherein: the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:52; the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:53; the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:54; the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:56; or the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:57.
In certain aspects, the present disclosure provides antibodies (e.g., isolated antibodies) that bind an extracellular domain of a human SIRP-α polypeptide, wherein: the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:52; the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:52; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:52; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:52; the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:53; the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:53; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:53; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:53; the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:54; the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:54; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:54; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:54; the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:56; the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:56; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:56; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:56; the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:57; the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:57; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:57; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:57; the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO: 129, and the light chain comprises the amino acid sequence of SEQ ID NO:55; the heavy chain comprises the amino acid sequence of SEQ ID NO: 124, and the light chain comprises the amino acid sequence of SEQ ID NO:52; or the heavy chain comprises the amino acid sequence of SEQ ID NO: 124, and the light chain comprises the amino acid sequence of SEQ ID NO:55.
In some embodiments, the antibody enhances phagocytosis by a macrophage expressing a human SIRP-α polypeptide. In some embodiments, the antibody enhances activation of a dendritic cell expressing a human SIRP-α polypeptide. In some embodiments, the antibody inhibits in vivo growth of a tumor that expresses CD47.
In some embodiments of any of the above embodiments, the antibody is conjugated to an agent, e.g., a cytotoxic agent, label, or moiety that modules the immune system.
In some embodiments of any of the above embodiments, the antibody is a bispecific antibody. In some embodiments, the antibody comprises a first antigen binding domain that binds an extracellular domain of a human SIRP-α polypeptide and a second antigen binding domain that binds an antigen expressed by a cancer cell. In some embodiments, the antigen expressed by the cancer cell is selected from the group consisting of CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, EphA4, BCMA, Mucin 1, Mucin 16, PD-L1, PTK7, STEAP1, Endothelin B Receptor, mesothelin, EGFRvIII, ENPP3, SLC44A4, GNMB, nectin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin αVβ3, integrin α5β1, MET, IGF1R, TRAILR1, TRAILR2, RANKL, FAP, Tenascin, Ley, EpCAM, CEA, gpA33, PSMA, TAG72, a mucin, CAIX, EPHA3, folate receptor α, GD2, GD3, and an MHC/peptide complex comprising a peptide from NY-ESO-1/LAGE, SSX-2, a MAGE family protein, MAGE-A3, gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MUC1, PRAME, survivin, BRCA1, BRCA2, CDK4, CML66, MART-2, p53, Ras, β-catenin, TGF-βRII, HPV E6, or HPV E7. In some embodiments, the antibody comprises a first antigen binding domain that binds an extracellular domain of a human SIRP-α polypeptide and a second antigen binding domain that binds an antigen expressed by an immune cell. In some embodiments, the antigen expressed by the immune cell is selected from the group consisting of BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Siglec-15, FGL-1, CD200, CD200R, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, arginase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF-β RI, TGF-β RII, c-Kit, CD244, L-selectin/CD62L, CD11b, CD11c, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS. In some embodiments, the antibody comprises a first antigen binding domain that binds an extracellular domain of a human SIRP-α polypeptide and a second antigen binding domain that binds an antigen expressed by a natural killer (NK) cell. In some embodiments, the antigen expressed by the NK cell is selected from the group consisting of NKR-P1A, CD94, KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94, NKG2D, CD160, CD16, NKp46, NKp30, NKp44, DNAM1, CRTAM, CD27, NTB-A, PSGL1, CD96, CD100, NKp80, SLAMF7, and CD244.
In certain aspects, the present disclosure provides a polynucleotide encoding the antibody according to any one of the above embodiments. In certain aspects, the present disclosure provides a vector comprising the polynucleotide according to any one of the above embodiments. In certain aspects, the present disclosure provides a host cell comprising the polynucleotide or vector according to any one of the above embodiments. In certain aspects, the present disclosure provides a method of producing an antibody, the method comprising culture the host cell according to any one of the above embodiments such that the antibody is produced. In some embodiments, the method further comprises recovering the antibody from the host cell.
In certain aspects, the present disclosure provides a method of treating or delaying progression of cancer in an individual, the method comprising administering to the individual an effective amount of the antibody according to any one of the above embodiments. In some embodiments, the method further comprises administering to the individual an effective amount of a second antibody that binds an antigen expressed by the cancer. In some embodiments, the antigen expressed by the cancer is selected from the group consisting of CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, EphA4, BCMA, Mucin 1, Mucin 16, PTK7, STEAP1, Endothelin B Receptor, mesothelin, EGFRvIII, ENPP3, SLC44A4, GNMB, nectin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin αV β3, integrin α5β1, MET, IGF1R, TRAILR1, TRAILR2, RANKL, FAP, Tenascin, Ley, EpCAM, CEA, gpA33, PSMA, TAG72, a mucin, CAIX, EPHA3, folate receptor α, GD2, GD3, and an MHC/peptide complex comprising a peptide from NY-ESO-1/LAGE, SSX-2, a MAGE family protein, MAGE-A3, gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MUC1, PRAME, survivin, BRCA1, BRCA2, CDK4, CML66, MART-2, p53, Ras, β-catenin, TGF-βRII, HPV E6, or HPV E7. In some embodiments, the method further comprises administering to the individual an effective amount of an immunotherapeutic agent. In some embodiments, the immunotherapeutic agent comprises a second antibody. In some embodiments, the second antibody binds to an antigen selected from the group consisting of BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Siglec-15, FGL-1, CD200, CD200R, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, arginase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF-β RI, TGF-β RII, c-Kit, CD244, L-selectin/CD62L, CD11b, CD11c, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS. In some embodiments, the second antibody binds to PD-1. In some embodiments, the second antibody binds to PD-L1. In some embodiments, the immunotherapeutic agent comprises a vaccine, oncolytic virus, adoptive cell therapy, cytokine, or small molecule. In some embodiments, the method further comprises administering to the individual an effective amount of a second antibody that binds an antigen expressed by a natural killer (NK) cell. In some embodiments, the antigen expressed by the NK cell is selected from the group consisting of NKR-P1A, CD94, KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94, NKG2D, CD160, CD16, NKp46, NKp30, NKp44, DNAM1, CRTAM, CD27, NTB-A, PSGL1, CD96, CD100, NKp80, SLAMF7, and CD244. In some embodiments, the method further comprises administering to the individual an effective amount of a chemotherapeutic agent or small molecule anti-cancer agent. In some embodiments, the method further comprises administering to the individual an effective amount of a targeted small molecule inhibitor. In some embodiments, the targeted small molecule inhibitor is a VEGFR and/or PDGFR inhibitor, EGFR inhibitor, ALK inhibitor, CDK4/6 inhibitor, PARP inhibitor, mTOR inhibitor, KRAS inhibitor, TRK inhibitor, BCL2 inhibitor, IDH inhibitor, PI3K inhibitor, DNA damage response (DDR) inhibitor, or hypomethylation agent.
In certain aspects, the present disclosure provides a method of treating or delaying progression of an autoimmune disease or an inflammatory disease in an individual, the method comprising administering to the individual an effective amount of the antibody according to any one of the above embodiments. In some embodiments, the autoimmune disease or inflammatory disease is selected from the group consisting of multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, psoriatic arthritis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, ulcerative colitis, endometriosis, glomerulonephritis, IgA nephropathy, polycystic kidney disease, myasthenia gravis, idiopathic pulmonary fibrosis, fibrotic disease (e.g., pulmonary fibrosis, liver cirrhosis, atrial fibrosis, endomyocardial fibrosis, myelofibrosis, or retroperitoneal fibrosis), asthma, atopic dermatitis, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis.
It is to be understood that one, some, or all of the properties of the various embodiments described herein may be combined to form other embodiments of the present invention. These and other aspects of the invention will become apparent to one of skill in the art. These and other embodiments of the invention are further described by the detailed description that follows.
The present disclosure describes antibodies that bind the extracellular domains (e.g., the D1 domains) of one or more human SIRP-α polypeptides and have a variety of SIRP-α binding profiles of potential interest. In addition, the present disclosure describes anti-SIRP-α antibodies with one or more in vitro and/or in vivo biological properties of interest, such as binding to multiple SIRP-α polypeptides with high affinity and the ability to enhance macrophage phagocytosis, enhance dendritic cell activation, and/or inhibit in vivo growth of a tumor that expresses CD47. These antibodies have a light chain derived from chicken, which provides unique opportunities to generate antibodies that cross-react across multiple mammalian SIRP-α polypeptides. Indeed, these antibodies were found to cross-react with human SIRP-α v1 and v2, cynomolgus SIRP-α, and murine SIRP-α from multiple strains, making them highly advantageous for both pre-clinical testing and clinical application across a large human population. Importantly, these antibodies have also been engineered to remove potential liabilities, such as residues that may be modified by deamidation or glycation, resulting in antibodies with more desirable characteristics for manufacturing, storage, and/or drug development.
In one aspect, provided herein are isolated antibodies that bind the extracellular domain (e.g., the D1 domain) of a human SIRP-α polypeptide. Further provided herein are polynucleotides and vectors encoding the antibodies of the present disclosure, as well as methods of antibody production related thereto.
In another aspect, provided herein are methods for treating or delaying progression of cancer in an individual, comprising administering to the individual an effective amount of an antibody of the present disclosure.
In another aspect, provided herein are methods for treating or delaying progression of an autoimmune or inflammatory disease in an individual, comprising administering to the individual an effective amount of an antibody of the present disclosure.
DefinitionsBefore describing the disclosed embodiments in detail, it is to be understood that the present disclosure is not limited to particular compositions or biological systems, which can, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting.
As used in this specification and the appended claims, the singular forms “a”, “an” and “the” include plural referents unless the content clearly dictates otherwise. Thus, for example, reference to “a molecule” optionally includes a combination of two or more such molecules, and the like.
The term “about” as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to “about” a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se.
It is understood that aspects and embodiments of the present disclosure include “comprising,” “consisting,” and “consisting essentially of” aspects and embodiments.
A “SIRP-α polypeptide” as used herein may refer to any endogenous or naturally occurring SIRP-α polypeptide encoded by a genome from any vertebrate, including mammals such as humans, monkeys, rodents (e.g., mouse or rat), and birds, such as chickens. The term also includes naturally occurring variants, e.g., alternatively spliced variants, allelic variants, or polymorphisms (e.g., those described herein). The term may further refer to full-length, unprocessed SIRP-α polypeptides as well as SIRP-α polypeptides that result from cellular processing, e.g., removal of a signal sequence, etc. Exemplary SIRP-α polypeptide sequences are described herein. In some embodiments, a human SIRP-α polypeptide is one encoded by a human SIRPA gene, e.g., as described by NCBI Gene ID No. 140885. As described herein, SIRP-α polypeptides are highly polymorphic within and among species, including, for example, multiple human variants with amino acid polymorphisms in the extracellular domain.
SIRP-α polypeptides include an extracellular domain that binds ligands/partners, e.g., CD47. SIRP-α polypeptides comprise 3 highly homologous immunoglobulin (Ig)-like extracellular domains-D1, D2, and D3. The SIRP-α D1 domain (“D1 domain”) refers to the membrane distal, extracellular domain of SIRP-α and mediates binding of SIRP-α to CD47 (see, e.g., Hatherley, D. et al. (2008) Mol. Cell 31:266-77; Hatherley, D. et al. (2007) J. Biol. Chem. 282:14567-75; Hatherley, D. et al. (2009) J. Biol. Chem. 284:26613-9; and Lee, W. Y. et al. (2010) J. Biol. Chem. 285:37953-63). The extracellular domain generally refers to the entire extracellular portion of SIRP-α, e.g., as expressed on a cell surface, and may include distinct SIRP-α domains, such as the D1 domain. The D1 domain contains residues shown to be critical for mediating CD47 binding (see, e.g., Lee, W. Y. et al. (2007) J. Immunol. 179:7741-50). In some embodiments, an antibody that binds an extracellular domain of a SIRP-α polypeptide binds one or more residues of the D1 domain.
As used herein, “CD47” (also known as integrin associated protein (IAP), MER6, and OA3) refers to a polypeptide that, among other roles, serves as a binding partner for SIRP-α polypeptides. In some embodiments, CD47 refers to a human CD47 polypeptide, e.g., a polypeptide encoded by a human CD47 gene, such as that described by NCBI Ref Seq ID No. 961. Exemplary human CD47 amino acid sequences are known (see, e.g., NCBI Reference Sequence Accession No. NP_001768). In particular, the IgSF domain of CD47 refers to the N-terminal extracellular domain of CD47 that is known to be critical for SIRP-α binding (see, e.g., Barclay, A. N. and Brown, M. H. (2006) Nat. Rev. Immunol. 6:457-64 and Hatherley, D. et al. (2009) J. Biol. Chem. 284:26613-9). The term “CD47” may also include modified CD47 polypeptides that are able to bind SIRP-α, e.g., a polypeptide comprising an IgSF domain of CD47 conjugated to another polypeptide or other moiety, e.g., an Ig Fc region.
As used herein “modulating SIRP-α signaling” may refer to antagonizing, agonizing, or otherwise interfering with one or more aspects of SIRP-α signaling in a cell expressing a SIRP-α polypeptide. SIRP-α signaling may refer to one or more intracellular signaling events mediated by activation of a SIRP-α polypeptide, including without limitation tyrosine phosphorylation of the intracellular region of SIRP-α, phosphatase (e.g., SHP1) binding, adaptor protein binding (e.g., SCAP2, FYB, and/or GRB2), cytokine production (e.g. IL-10, IL-1β, IFN or TNF), and nitric oxide production; and/or one or more intercellular phenotypes, including without limitation macrophage phagocytosis and other activating or suppressive phenotypes of macrophages, eosinophils, neutrophils, dendritic cells, and myeloid-derived suppressor cells (MDSCs).
As used herein, the term “antibody” may refer to intact antibodies; antibody fragments (including without limitation Fab, F(ab′)2, Fab′-SH, Fv, diabodies, scFv, scFv-Fc, single domain antibodies, single heavy chain antibodies, and single light chain antibodies), provided that they exhibit the desired biological activity (e.g. epitope binding); monoclonal antibodies; polyclonal antibodies; monospecific antibodies; multi-specific antibodies (e.g., bispecific antibodies); and antibody-like proteins.
As used herein, the term “bispecific” when used in reference to an antibody or antibody fragment includes an antibody or antibody fragment that possesses two different binding specificities. For example, each binding specificity may recognize a different antigen, or each binding specificity may recognize the same antigen with different affinity and/or precise epitope. In some embodiments, each different binding specificity comprises one or more different antibody antigen binding domains (e.g., variable domains), such that the bispecific antibody or antibody fragment comprises at least a first antigen binding domain with a first binding specificity and a second antigen binding domain with a second binding specificity. A variety of exemplary bispecific antibody formats are described herein and known in the art.
An “isolated” antibody may refer to an antibody that has been separated and/or recovered from a component of its natural environment, e.g., a host cell or organism. In some embodiments, an antibody is purified to a desired purity by weight (e.g., at least 95%); and/or homogeneity by SDS-PAGE using, for example, staining by silver, Coomassie, etc. In some embodiments, an isolated antibody is obtained following one or more purification steps.
As is known in the art, “native” antibodies refer to typically heterotetrameric complexes including two identical light (L) chains and two identical heavy (H) chains. Variable numbers of disulfide bonds connect the two heavy chains, and one connects each light chain to a heavy chain, in addition to intrachain disulfide bridges. The heavy chains include a variable domain (VH) followed (N-terminus to C-terminus) by three or four constant domains. The light chains include a variable domain (VL) followed by a constant domain (CL). Typically, mammalian light chains fall into one of two categories based on amino acid sequence: kappa and lambda.
A “constant domain” may refer to the more conserved portion of the antibody or fragment, e.g., outside the variable domains. The term may include the CL domain as well as heavy chain constant domains CH1, CH2, and CH3, along with the heavy chain hinge region. Optionally, a heavy chain constant domain may further comprise a CH4 heavy chain constant domain.
Constant domains of the heavy chain can be assigned to one of 5 major types: IgA, IgD, IgE, IgG, and IgM. Several subtypes exist for many of these major types. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known and described generally in, for example, Abbas et al. Cellular and Mol. Immunology, 4th ed. (W.B. Saunders, Co., 2000).
As used herein, the term “antibody variable domain” refers to the portions of the light and heavy chains of an antibody that include the complementary determining regions (CDRs, e.g., CDR L1, CDR L2, CDR L3, CDR H1, CDR H2, and CDR H3) and framework regions (FRs).
The term “variable” refers to the fact that subsequences of the variable domains differ substantially in sequence between antibodies and are critical to the binding specificity of a particular antibody for its antigen. Variability is concentrated in three hypervariable regions (HVRs) in both VH and VL domains. The more conserved portions of variable domains are called the framework regions (FR) in which the HVRs are interspersed. The variable domains of native heavy and light chains each comprise four FR regions connected by three HVRs that form loops (see Kabat et al., Sequences of Proteins of Immunological Interest, Fifth Edition, National Institute of Health, Bethesda, Md. (1991)).
The term “hypervariable region (HVR)” may refer to the subregions of the VH and VL domains characterized by enhanced sequence variability and/or formation of defined loops. These include three HVRs in the VH domain (H1, H2, and H3) and three HVRs in the VL domain (L1, L2, and L3). H3 is believed to be critical in imparting fine binding specificity, with L3 and H3 showing the highest level of diversity. See Johnson and Wu, in Methods in Molecular Biology 248:1-25 (Lo, ed., Human Press, Totowa, N.J., 2003).
A number of HVR delineations are known. The Kabat Complementarity Determining Regions (CDRs) are based on sequence variability and are the most commonly used (Kabat et al., Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)). Chothia refers instead to the location of the structural loops (Chothia and Lesk J. Mol. Biol. 196:901-917 (1987)). The AbM HVRs represent a compromise between the Kabat HVRs and Chothia structural loops, and are used by Oxford Molecular's AbM antibody modeling software. The “contact” HVRs are based on an analysis of the available complex crystal structures. The residues from each of these HVRs are noted below. “Framework” or “FR” residues are those variable domain residues other than the HVR residues.
“Extended” HVRs are also known: 24-36 or 24-34 (L1), 46-56 or 50-56 (L2) and 89-97 or 89-96 (L3) in the VL and 26-35 (H1), 50-65 or 49-65 (H2) and 93-102, 94-102, or 95-102 (H3) in the VH (Kabat numbering).
“Numbering according to Kabat” may refer to the numbering system used for heavy chain variable domains or light chain variable domains of the compilation of antibodies in Kabat et al., supra. The actual linear amino acid sequence may contain fewer or additional amino acids corresponding to a shortening of, or insertion into, a FR or HVR of the variable domain. The Kabat numbering of residues may be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. Typically, the Kabat numbering is used when referring to a residue in the variable domains (approximately residues 1-107 of the light chain and residues 1-113 of the heavy chain), whereas the EU numbering system or index (e.g., the EU index as in Kabat, numbering according to EU IgG1) is generally used when referring to a residue in the heavy chain constant region.
“Full length” or “intact” antibodies typically include heavy chains with an Fc region, e.g., as opposed to an antibody fragment. Antigen-binding “Fab” fragments with a single antigen binding site may be released from the residual Fc fragment by papain digestion. F(ab′)2 fragments include two antigen-binding sites produced by pepsin treatment of an antibody. Antibody fragments will, however, include one or more antibody variable regions.
An “Fv” fragment contains a complete antigen-binding site. A single chain Fv (scFv) can include a VH and a VL domain linked by a peptide linker such that the VH and VL domains associate, e.g., as in an antibody or Fab fragment, such that the HVRs form an antigen binding site. See Pluckthün, in The Pharmacology of Monoclonal Antibodies, vol. 113, Rosenburg and Moore eds., (Springer-Verlag, New York, 1994), pp. 269-315. In some embodiments, the scFv is fused to an antibody Fc domain (e.g., scFv-Fc). While six HVRs typically comprise an antigen binding site, a single variable domain with three HVRs is still capable of binding an antigen, albeit at a lower affinity. See Hamers-Casterman et al., Nature 363:446-448 (1993); Sheriff et al., Nature Struct. Biol. 3:733-736 (1996). Single domain antibodies (e.g., camelid antibodies) typically include a single, monomeric variable domain for antigen binding. Single heavy chain (VHH) and single light chain antibodies are also known. A Fab′ fragment typically includes a few more residues at the C-terminal end than a Fab fragment. A Fab′-SH includes cysteine residues with a free thiol. Various chemical couplings of antibody fragments are known in the art.
A “diabody” includes antibody fragments with two antigen-binding sites. These include a VH and VL domain connected by a linker, which is typically too short to facilitate pairing of domains in the same chain. Diabodies may be bivalent or bispecific. Tribodies and tetrabodies, or other numbers of VH/VL domains are known. See Hudson et al., Nat. Med. 9:129-134 (2003).
As used herein, a “monoclonal” antibody refers to an antibody obtained from a population of substantially homogeneous antibodies, e.g., substantially identical but allowing for minor levels of background mutations and/or modifications. “Monoclonal” denotes the substantially homogeneous character of antibodies, and does not require production of the antibody by any particular method. In some embodiments, a monoclonal antibody is selected by its HVR, VH, and/or VL sequences and/or binding properties, e.g., selected from a pool of clones (e.g., recombinant, hybridoma, or phage-derived). A monoclonal antibody may be engineered to include one or more mutations, e.g., to affect binding affinity or other properties of the antibody, create a humanized or chimeric antibody, improve antibody production and/or homogeneity, engineer a multispecific antibody, resultant antibodies of which are still considered to be monoclonal in nature. A population of monoclonal antibodies may be distinguished from polyclonal antibodies as the individual monoclonal antibodies of the population recognize the same antigenic site. A variety of techniques for production of monoclonal antibodies are known; see, e.g., the hybridoma method (e.g., Kohler and Milstein, Nature, 256:495-97 (1975); Hongo et al., Hybridoma, 14 (3): 253-260 (1995), Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); Hammerling et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981)), recombinant DNA methods (see, e.g., U.S. Pat. No. 4,816,567), phage-display technologies (see, e.g., Clackson et al., Nature, 352: 624-628 (1991); Marks et al., J. Mol. Biol. 222: 581-597 (1992); Sidhu et al., J. Mol. Biol. 338(2): 299-310 (2004); Lee et al., J. Mol. Biol. 340(5): 1073-1093 (2004); Fellouse, Proc. Natl. Acad. Sci. USA 101(34): 12467-12472 (2004); and Lee et al., J. Immunol. Methods 284(1-2): 119-132 (2004), and technologies for producing human or human-like antibodies in animals that have parts or all of the human immunoglobulin loci or genes encoding human immunoglobulin sequences (see, e.g., WO 1998/24893; WO 1996/34096; WO 1996/33735; WO 1991/10741; Jakobovits et al., Proc. Natl. Acad. Sci. USA 90: 2551 (1993); Jakobovits et al., Nature 362: 255-258 (1993); Bruggemann et al., Year in Immunol. 7:33 (1993); U.S. Pat. Nos. 5,545,807; 5,545,806; 5,569,825; 5,625,126; 5,633,425; and U.S. Pat. No. 5,661,016; Marks et al., Bio/Technology 10: 779-783 (1992); Lonberg et al., Nature 368: 856-859 (1994); Morrison, Nature 368: 812-813 (1994); Fishwild et al., Nature Biotechnol. 14: 845-851 (1996); Neuberger, Nature Biotechnol. 14: 826 (1996); and Lonberg and Huszar, Intern. Rev. Immunol. 13: 65-93 (1995).
“Chimeric” antibodies may refer to an antibody with one portion of the heavy and/or light chain from a particular isotype, class, or organism and another portion from another isotype, class, or organism. In some embodiments, the variable region will be from one source or organism, and the constant region will be from another.
“Humanized antibodies” may refer to antibodies with predominantly human sequence and a minimal amount of non-human (e.g., mouse or chicken) sequence. In some embodiments, a humanized antibody has one or more HVR sequences (bearing a binding specificity of interest) from an antibody derived from a non-human (e.g., mouse or chicken) organism grafted onto a human recipient antibody framework (FR). In some embodiments, non-human residues are further grafted onto the human framework (not present in either source or recipient antibodies), e.g., to improve antibody properties. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the hypervariable loops correspond to those of a non-human immunoglobulin, and all or substantially all of the FRs are those of a human immunoglobulin sequence. The humanized antibody optionally will also comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. See Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992).
A “human” antibody may refer to an antibody having an amino acid sequence which corresponds to that of an antibody produced by a human and/or has been made using any of the techniques for making human antibodies as disclosed herein. Human antibodies can be produced using various techniques known in the art, including phage-display libraries. Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991); preparation of human monoclonal antibodies as described in Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985); Boerner et al., J Immunol., 147(1):86-95 (1991); and by administering the antigen to a transgenic animal that has been modified to produce such antibodies in response to antigenic challenge, but whose endogenous loci have been disabled, e.g., immunized xenomice (see, e.g., U.S. Pat. Nos. 6,075,181 and 6,150,584 regarding XENOMOUSE™ technology) or chickens with human immunoglobulin sequence(s) (see, e.g., WO2012162422, WO2011019844, and WO2013059159).
As used herein, the term “linker” refers to a linkage between two elements, e.g., protein domains. In some embodiments, a linker can be a covalent bond or a spacer. The term “spacer” refers to a moiety (e.g., a polyethylene glycol (PEG) polymer) or an amino acid sequence (e.g., a 1-200 amino acid sequence) occurring between two polypeptides or polypeptide domains to provide space or flexibility (or both space and flexibility) between the two polypeptides or polypeptide domains. In some embodiments, an amino acid spacer is part of the primary sequence of a polypeptide (e.g., joined to the spaced polypeptides or polypeptide domains via the polypeptide backbone).
The term “cytotoxic agent” as used herein may refer to any agent that inhibits cellular proliferation or induces cell death. Cytotoxic agents include, but are not limited to, chemotherapeutic agents; radioactive isotopes; growth inhibitory agents; and toxins such as small molecule toxins or enzymatically active toxins, including fragments and/or variants thereof. Exemplary cytotoxic agents include without limitation metabolic inhibitors, anti-microtubule agents, platinum containing compounds, alkylating agents, proteasome inhibitors, topoisomerase II inhibitors, antimetabolites, topoisomerase I inhibitors, signal transduction pathway inhibitors, non-receptor tyrosine kinase angiogenesis inhibitors, hormones and hormonal analogues, proapoptotic agents, inhibitors of LDH-A, cell cycle inhibitors, HDAC inhibitors, and antibiotic agents.
As used herein, a “label” may include any moiety that serves as a detection agent, e.g., of binding between a labeled antibody of the present disclosure and a macromolecule or cell. Exemplary labels include without limitation fluorescent (e.g., compounds or proteins), radioactive, or enzymatic moieties, as well as affinity purification tags.
As used herein, an antibody may be said to “bind” an antigen with an affinity sufficient to render the antibody useful for in vitro and/or in vivo manipulation of the antigen. In some embodiments, an antibody that “binds” an antigen has a dissociation constant (KD) for the antigen that is less than or equal to 1 μM at 25° C.
As used herein, the term “affinity” or “binding affinity” refers to the strength of the binding interaction between two molecules. Generally, binding affinity refers to the strength of the sum total of non-covalent interactions between a molecule and its binding partner, such as a high affinity SIRP-α D1 variant and CD47. Unless indicated otherwise, binding affinity refers to intrinsic binding affinity, which reflects a 1:1 interaction between members of a binding pair. The binding affinity between two molecules is commonly described by the dissociation constant (KD) or the association constant (KA). Two molecules that have low binding affinity for each other generally bind slowly, tend to dissociate easily, and exhibit a large KD. Two molecules that have high affinity for each other generally bind readily, tend to remain bound longer, and exhibit a small KD. In some embodiments, the KD of two interacting molecules is determined using known methods and techniques, e.g., surface plasmon resonance (SPR). KD can be calculated as the ratio of koff/kon.
As used herein, the term “KD less than” refers to a numerically smaller KD value and an increasing binding affinity relative to the recited KD value. As used herein, the term “KD greater than” refers to a numerically larger KD value and a decreasing binding affinity relative to the recited KD value.
As used herein, “treatment” may refer to therapeutic administration of a molecule, compound, formulation, composition, etc. so as to alter one or more pathological symptoms in an individual or cell being treated. Desirable effects of treatment can include without limitation decelerating disease progression, ameliorating or palliating a pathological symptom or disease state, improving prognosis, and/or achieving disease remission. For example, an individual's cancer is successfully “treated” if one or more symptoms associated with cancer are mitigated or abolished, such as, without limitation, reducing the proliferation of cancer cells, eliminating cancer cells or tumor burden, decreasing symptoms resulting from the cancer, increasing the quality of life of the individual, lessening the dose of other medication(s), and/or prolonging survival of the individual. As another example, an autoimmune or inflammatory disease may be successfully “treated” if one or more symptoms associated with the autoimmune or inflammatory disease are mitigated or abolished, such as, without limitation, reducing autoreactive immune cells and/or inflammatory immune cells or cytokines, decreasing immune activation and/or inflammation, slowing or mitigating organ damage resulting from the disease, decreasing symptoms resulting from the disease, increasing the quality of life of the individual, lessening the dose of other medication(s), and/or prolonging survival of the individual.
As used herein, “delaying progression” of a disease may refer to slowing, retarding, deferring, postponing development of, stabilizing, or otherwise hindering the pathological course of the disease. In some embodiments, the term may refer to a delay sufficient to effectively encompass prevention, e.g., in preventing the individual from developing the disease. In some embodiments, e.g., an advanced cancer, delaying progression may include delaying metastasis. One of skill in the art will appreciate that the precise length of delay may depend, e.g., upon the specific disease, condition of the individual, and the like.
The terms “cancer” and “cancerous” may describe dysregulated or unregulated cell growth/proliferation by a cell or cells in a mammal. Any cancer type known in the art may be included, such as but not limited to carcinoma, sarcoma, lymphoma, leukemia, lymphoma, and blastoma. More particular examples of such cancers include, but are not limited to, lung cancer, squamous cell cancer, brain tumors, glioblastoma, head and neck cancer, hepatocellular cancer, colorectal cancer (e.g., colon or rectal cancers), liver cancer, bladder cancer, gastric or stomach cancer, pancreatic cancer, cervical cancer, ovarian cancer, cancer of the urinary tract, breast cancer, peritoneal cancer, uterine cancer, salivary gland cancer, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, anal carcinoma, penile carcinoma, melanoma, multiple myeloma and B-cell lymphoma (including non-Hodgkin's lymphomas (NHL)); acute lymphoblastic leukemia (ALL); chronic lymphocytic leukemia (CLL); acute myeloid leukemia (AML); Merkel cell carcinoma; hairy cell leukemia; chronic myeloblastic leukemia (CML); and associated metastases.
As used herein, the term “effective amount” may refer to an amount of an antibody of the present disclosure or a pharmaceutical composition containing an antibody of the present disclosure that is sufficient and effective in achieving a desired therapeutic effect in treating or delaying progression of a patient having a disease, such as a cancer, e.g., solid tumor or hematological cancer. In some embodiments, a therapeutically effective amount will avoid adverse side effects, and/or such side effects will be outweighed by beneficial effects. An effective amount may depend upon the individual being treated, e.g., age, weight, sex, disease state, as well as the ability of the agent to produce a desired response. An effective amount can be administered in one or more administrations. As in the clinical context, an effective amount of a drug, compound, or pharmaceutical composition may or may not be achieved in conjunction with another drug, compound, or pharmaceutical composition, such as another therapeutic agent. Thus, an “effective amount” may also be considered in the context of administering one or more additional therapeutic agents, and a single agent may be considered to be given in an effective amount if, in conjunction with one or more other agents, a desirable result may be or is achieved.
As used herein, the term “pharmaceutical composition” may refer to a medicinal or pharmaceutical formulation that includes an active ingredient as well as excipients or diluents (or both excipients and diluents) and enables the active ingredient to be administered by suitable methods of administration. In some embodiments, the pharmaceutical compositions disclosed herein include pharmaceutically acceptable components that are compatible with one or more antibodies of the present disclosure. In some embodiments, the pharmaceutical composition is in tablet or capsule form for oral administration or in aqueous form for intravenous or subcutaneous administration, for example by injection.
As used herein, the terms “subject,” “individual,” and “patient” are used interchangeably to refer to a vertebrate, for example, a mammal. Mammals include, but are not limited to, murines, simians, humans, farm animals, sport animals, and pets.
As used herein, “in conjunction with” or “in combination with” may refer to administration of one therapeutic in addition to (e.g., before, during, and/or after) another therapeutic.
Antibodies
Certain aspects of the present disclosure relate to antibodies that bind the extracellular domain (e.g., the D1 domain) of a human SIRP-α polypeptide. In some embodiments, the antibody is a humanized antibody. In some embodiments, the antibody is a monoclonal antibody.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and/or a light chain comprising a VL domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCS GGSYS SYYYAWYQQKPGQAPVTLIYSDDKRPSNI PERFSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), where X1 is G or T; X2 is K, Q, or R; and X3 is L or V. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and a light chain comprising a VL domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCSGGSYSSYYYAWYQQKPGQAPVTLIYSDDKRPSNI PERFSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), where X1 is G or T; X2 is K, Q, or R; and X3 is L or V. In some embodiments of any of the above embodiments, the VL domain does not comprise the sequence of SEQ ID NO:25. In certain embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and a light chain comprising a VL domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCSGGSYSSYYYAWYQQKPGQAPVTLIYSDDKRPSNI PERFSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), where X1 is G or T; X2 is K, Q, or R; and X3 is L or V. In some embodiments, the VL domain does not comprise the sequence of SEQ ID NO:25. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and/or a light chain comprising a VL domain shown in Table 1. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and a light chain comprising a VL domain shown in Table 1.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and/or a light chain comprising a VL domain that comprises an amino acid sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and a light chain comprising a VL domain that comprises an amino acid sequence selected from SEQ ID NOs:39-41.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and/or a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and/or a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:81 and a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:83 and a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises an amino acid sequence selected from SEQ ID NOs:77-111 and a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises an amino acid sequence selected from SEQ ID NOs:77-111 and a light chain that comprises an amino acid sequence selected from SEQ ID NOs:48-51. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain shown in Table 2 and a constant domain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:33, 34, and 137 and/or a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs:60, 61, and 129 and/or a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises an amino acid sequence selected from SEQ ID NOs:26, 81, or 83 and a light chain that comprises an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises an amino acid sequence selected from SEQ ID NOs:26, 81, or 83 and a light chain comprising a VL domain that comprises an amino acid sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and a light chain comprising a VL domain that comprises an amino acid sequence selected from SEQ ID NOs:39-41.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises an amino acid sequence selected from SEQ ID NOs:26, 81, or 83 and a light chain that comprises a VL domain sequence selected from SEQ ID NOs:39-41 and a CL domain comprising a sequence selected from SEQ ID NOs:36-38. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and a light chain that comprises a VL domain sequence selected from SEQ ID NOs:39-41 and a CL domain comprising a sequence selected from SEQ ID NOs:36-38.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises an amino acid sequence selected from SEQ ID NOs:26, 81, or 83 and a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25 and a CL domain sequence selected from SEQ ID NOs:43-46. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a VH domain that comprises the amino acid sequence of SEQ ID NO:26 and a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25 and a CL domain sequence selected from SEQ ID NOs:43-46.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:83 and a light chain that comprises a VL domain sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:83 and a light chain that comprises a VL domain comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:83 and a light chain that comprises the amino acid sequence of SEQ ID NO:55.
In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119-123 and a light chain that comprises a VL domain sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119-123 and a light chain that comprises a VL domain comprising the amino acid sequence of SEQ ID NO:40. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising an amino acid sequence selected from the group consisting of SEQ ID NOs: 119-123 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO: 119 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO: 120 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO: 121 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO: 122 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO: 123 and a light chain that comprises the amino acid sequence of SEQ ID NO:55.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:26 and a constant domain sequence selected from the group consisting of SEQ ID NOs: 132-139; and/or a light chain comprising a VL domain that comprises the amino acid sequence of SEQ ID NO:40. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:26 and a constant domain sequence selected from the group consisting of SEQ ID NOs:33,34, and 137; and/or a light chain comprising a VL domain that comprises the amino acid sequence of SEQ ID NO:40. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:26 and a constant domain sequence selected from the group consisting of SEQ ID NOs:132-139; and/or a light chain comprising the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising the amino acid sequence of SEQ ID NO:26 and a constant domain sequence selected from the group consisting of SEQ ID NOs:33,34, and 137; and/or a light chain comprising the amino acid sequence of SEQ ID NO:55.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:124-131; and/or a light chain comprising a VL domain that comprises the amino acid sequence of SEQ ID NO:40. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:60, 61, and 129; and/or a light chain comprising a VL domain that comprises the amino acid sequence of SEQ ID NO:40. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:124-131; and/or a light chain comprising the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:60, 61, and 129; and/or a light chain comprising the amino acid sequence of SEQ ID NO:55. In some embodiments, the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, the heavy chain comprises the amino acid sequence of SEQ ID NO: 137, and the light chain comprises the amino acid sequence of SEQ ID NO:55.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and/or a light chain comprising a VL domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCSGGSYSSYYYAWYQQKPGQAPVTLIYSDDKRPSNI PERFSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), where X1 is G or T; X2 is K, Q, or R; and X3 is L or V. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and a light chain comprising a VL domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCSGGSYSSYYYAWYQQKPGQAPVTLIYSDDKRPSNI PERFSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), where X1 is G or T; X2 is K, Q, or R; and X3 is L or V. In some embodiments of any of the above embodiments, the VL domain does not comprise the sequence of SEQ ID NO:25.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and a light chain comprising a VL domain shown in Table 1. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and a light chain comprising a VL domain that comprises an amino acid sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and a light chain comprising an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and a light chain comprising a VL domain that comprises an amino acid sequence selected from SEQ ID NOs:39-41 and a CL domain that comprises an amino acid sequence selected from SEQ ID NOs:36-38. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:58-62 and a light chain comprising a VL domain that comprises the amino acid sequence of SEQ ID NO:25 and a CL domain that comprises an amino acid sequence selected from SEQ ID NOs:43-46.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:62 and a light chain that comprises the amino acid sequence of SEQ ID NO:52. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:62 and a light chain that comprises the amino acid sequence of SEQ ID NO:53. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:62 and a light chain that comprises the amino acid sequence of SEQ ID NO:54. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:62 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:62 and a light chain that comprises the amino acid sequence of SEQ ID NO:56. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:62 and a light chain that comprises the amino acid sequence of SEQ ID NO:57.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:58 and a light chain that comprises the amino acid sequence of SEQ ID NO:52. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:59 and a light chain that comprises the amino acid sequence of SEQ ID NO:52. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:60 and a light chain that comprises the amino acid sequence of SEQ ID NO:52. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:61 and a light chain that comprises the amino acid sequence of SEQ ID NO:52.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:58 and a light chain that comprises the amino acid sequence of SEQ ID NO:53. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:59 and a light chain that comprises the amino acid sequence of SEQ ID NO:53. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:60 and a light chain that comprises the amino acid sequence of SEQ ID NO:53. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:61 and a light chain that comprises the amino acid sequence of SEQ ID NO:53.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:58 and a light chain that comprises the amino acid sequence of SEQ ID NO:54. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:59 and a light chain that comprises the amino acid sequence of SEQ ID NO:54. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:60 and a light chain that comprises the amino acid sequence of SEQ ID NO:54. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:61 and a light chain that comprises the amino acid sequence of SEQ ID NO:54.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:58 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:59 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:60 and a light chain that comprises the amino acid sequence of SEQ ID NO:55. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:61 and a light chain that comprises the amino acid sequence of SEQ ID NO:55.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:58 and a light chain that comprises the amino acid sequence of SEQ ID NO:56. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:59 and a light chain that comprises the amino acid sequence of SEQ ID NO:56. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:60 and a light chain that comprises the amino acid sequence of SEQ ID NO:56. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:61 and a light chain that comprises the amino acid sequence of SEQ ID NO:56.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:58 and a light chain that comprises the amino acid sequence of SEQ ID NO:57. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:59 and a light chain that comprises the amino acid sequence of SEQ ID NO:57. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:60 and a light chain that comprises the amino acid sequence of SEQ ID NO:57. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises the amino acid sequence of SEQ ID NO:61 and a light chain that comprises the amino acid sequence of SEQ ID NO:57.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising a sequence selected from SEQ ID NOs:77-111 and a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising a sequence selected from SEQ ID NOs:77-111 and a light chain that comprises a VL domain comprising a sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising a sequence selected from SEQ ID NOs:77-111 and a light chain that comprises a VL domain comprising a sequence selected from SEQ ID NOs:39-41 and a CL domain comprising a sequence selected from SEQ ID NOs:36-38. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a VH domain comprising a sequence selected from SEQ ID NOs:77-111 and a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25 and a CL domain comprising a sequence selected from SEQ ID NOs:43-46. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a sequence selected from SEQ ID NOs: 114-123 and a light chain that comprises a sequence selected from SEQ ID NOs:47-63. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a sequence selected from SEQ ID NOs: 124-131 and a light chain that comprises a sequence selected from SEQ ID NOs:47-63. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a sequence selected from SEQ ID NOs: 114-131 and a light chain that comprises a sequence selected from SEQ ID NOs:47-63.
In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs: 114-118 and a light chain that comprises an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs: 119-123 and a light chain that comprises an amino acid sequence selected from SEQ ID NOs:48-57. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs: 114-123 and a light chain that comprises a VL domain comprising a sequence selected from SEQ ID NOs:39-41. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs: 114-123 and a light chain that comprises a VL domain comprising a sequence selected from SEQ ID NOs:39-41 and a CL domain comprising a sequence selected from SEQ ID NOs:36-38. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises an amino acid sequence selected from SEQ ID NOs:114-123 and a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25 and a CL domain comprising a sequence selected from SEQ ID NOs:43-46.
In some embodiments, an antibody of the present disclosure comprises three CDRs from a VH domain comprising a sequence set forth in Table 2 and/or three CDRs from a VL domain comprising a sequence set forth in Table 1. In some embodiments, an antibody of the present disclosure comprises a VH domain comprising a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a VH domain sequence set forth in Table 2 and optionally three CDRs from a VH domain comprising a sequence set forth in Table 2, and/or a VL domain comprising a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a VL domain sequence set forth in Table 1 and optionally three CDRs from a VL domain comprising a sequence set forth in Table 1. In some embodiments, an antibody of the present disclosure comprises a heavy chain comprising a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a heavy chain sequence set forth in Table 2 and optionally three CDRs from a VH domain comprising a sequence set forth in Table 2, and/or a light chain comprising a sequence that is at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or 100% identical to a light chain sequence set forth in Table 1 and optionally three CDRs from a VL domain comprising a sequence set forth in Table 1.
As described supra, various techniques for delineating hypervariable regions (HVRs) or complementarity determining regions (CDRs) are known in the art and can be applied to the variable domain sequences described herein. In some embodiments, an antibody of the present disclosure comprises HVRs as defined by Chothia, Kabat, IMGT, or a combination thereof (e.g., one or more HVRs as defined by one delineation and one or more HVRs as defined by a different delineation). As used herein, unless otherwise specified, the numbering of HVR or CDR residues is defined by Kabat numbering.
In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a human SIRP-α v1 polypeptide comprising the amino acid sequence of EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFP RVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVR AKPS (SEQ ID NO:5). In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a human SIRP-α v2 polypeptide comprising the amino acid sequence of EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR VTTVSESTKRENMDF SISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS (SEQ ID NO:6). In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a human SIRP-α v1 polypeptide comprising the amino acid sequence of EEELQVIQPDKSVLVAAGETATLRCTATSLIPVGPIQWFRGAGPGRELIYNQKEGHFP RVTTVSDLTKRNNMDFSIRIGNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVR AKPS (SEQ ID NO:5) and an extracellular domain (e.g., the D1 domain) of a human SIRP-α v2 polypeptide comprising the amino acid sequence of EEELQVIQPDKSVSVAAGESAILHCTVTSLIPVGPIQWFRGAGPARELIYNQKEGHFPR VTTVSESTKRENMDF SISISNITPADAGTYYCVKFRKGSPDTEFKSGAGTELSVRAKPS (SEQ ID NO:6).
In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a monkey SIRP-α polypeptide (e.g., the D1 domain of a monkey SIRP-α polypeptide). In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a cynomolgus SIRP-α polypeptide (e.g., found in the organism Macaca fascicularis). In some embodiments, the antibody binds the extracellular domains (e.g., the D1 domains) of at least two different monkey SIRP-α variant polypeptides. In some embodiments, the antibody binds the extracellular domains (e.g., the D1 domains) of at least two different cynomolgus SIRP-α variant polypeptides. For example, in some embodiments, the antibody binds an extracellular domain (e.g., the D1 domain) of a cynomolgus SIRP-α polypeptide comprising the amino acid sequence of EEELQVIQPEKSVSVAAGESATLNCTATSLIPVGPIQWFRGVGPGRELIYHQKEGHFP RVTPVSDPTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDVELKSGAGTELSVRAK PS (SEQ ID NO: 11), an extracellular domain (e.g., the D1 domain) of a cynomolgus SIRP-α polypeptide comprising the amino acid sequence of EEELQVIQPEKSVSVAAGDSATLNCTVSSLIPVGPIQWFRGAGPGRELIYNLKEGHFP RVTAVSDPTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDVELKSGAGTELSVRA KPS (SEQ ID NO: 12), or both.
In some embodiments, an antibody of the present disclosure binds an extracellular domain of a murine or mouse SIRP-α polypeptide (e.g., found in the organism Mus musculus; e.g., the D1 domain of a murine or mouse SIRP-α polypeptide). In some embodiments, the antibody binds the extracellular domains (e.g., the D1 domains) of two or more different murine SIRP-α variant polypeptides. A variety of murine SIRP-α variant polypeptides from different mouse strains are known. In some embodiments, the murine SIRP-α variant polypeptide comprises an amino acid sequence selected from KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIKWYRGVGQSRLLIYSFTGEHFPR VTNVSDATKRNNMDFSIRISNVTPEDAGTYYCVKFQKGPSEPDTEIQSGGGTEVYVL AKPS (SEQ ID NO: 7; from 129 mouse strain), TEVKVIQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGQSRQLIYSFTTEHFPR VTNVSDATKRSNLDFSIRISNVTPEDAGTYYCVKFQRGSPDTEIQSGGGTEVYVLAK (SEQ ID NO:8; from NOD mouse strain), KELKVTQPEKSVSVAAGDSTVLNCTLTSLLPVGPIRWYRGVGPSRLLIYSFAGEYVPR IRNVSDTTKRNNMDFSIRISNVTPADAGIYYCVKFQKGS SEPDTEIQSGGGTEVYVLA K (SEQ ID NO:9; from C57BL/6 mouse strain), and TEVKVTQPEKSVSVAAGDSTILNCTVTSLLPVGPIRWYRGVGQSRLLIYSFTGEHFPRI RNVSDTTKRNNMDFSIRISNVTPEDAGTYYCVKFQRGSSEPDTEIQSGGGTEVYVLA K (SEQ ID NO: 10; from BALB/c mouse strain).
In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a human SIRP family protein. In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a human SIRP-β polypeptide. In some embodiments, a human SIRP-β polypeptide refers to a polypeptide encoded by a human SIRPB1 gene, e.g., as described by NCBI Ref Seq ID No. 10326. In some embodiments, the extracellular domain (e.g., the D1 domain) of the human SIRP-β polypeptide comprises the amino acid sequence of EDELQVIQPEKSVSVAAGESATLRCAMTSLIPVGPIMWFRGAGAGRELIYNQKEGHF PRVTTVSELTKRNNLDFSISISNITPADAGTYYCVKFRKGSPDDVEFKSGAGTELSVR AKPS (SEQ ID NO:13) or EEELQVIQPDKSISVAAGESATLHCTVTSLIPVGPIQWFRGAGPGRELIYNQKEGHFPR VTTVSDLTKRNNMDFSIRISNITPADAGTYYCVKFRKGSPDHVEFKSGAGTELSVRA KPS (SEQ ID NO:14).
In some embodiments, an antibody of the present disclosure binds an extracellular domain (e.g., the D1 domain) of a human SIRP-γ polypeptide. In some embodiments, a human SIRP-γ polypeptide refers to a polypeptide encoded by a human SIRPG gene, e.g., as described by NCBI Ref Seq ID No. 55423. In some embodiments, the extracellular domain (e.g., the D1 domain) of the human SIRP-γ polypeptide comprises the amino acid sequence of EEELQMIQPEKLLLVTVGKTATLHCTVTSLLPVGPVLWFRGVGPGRELIYNQKEGHF PRVTTVSDLTKRNNMDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALG AKPS (SEQ ID NO:15).
In some embodiments, an antibody of the present disclosure binds an IgSF domain of CD47 (e.g., human CD47). In some embodiments, an antibody of the present disclosure binds a polypeptide comprising the amino acid sequence of QLLFNKTKSVEFTFSNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKS TVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRV VS (SEQ ID NO:16).
In some embodiments, an antibody of the present disclosure modulates SIRP-α signaling in a cell expressing a human SIRP-α polypeptide. In some embodiments, an antibody of the present disclosure antagonizes SIRP-α signaling in a cell expressing a human SIRP-α polypeptide. In some embodiments, an antibody of the present disclosure interferes with SIRP-α signaling in a cell expressing a human SIRP-α polypeptide. In some embodiments, an antibody of the present disclosure agonizes SIRP-α signaling in a cell expressing a human SIRP-α polypeptide. In some embodiments, SIRP-α signaling includes one or more intracellular signaling events mediated by activation of a SIRP-α polypeptide, including without limitation tyrosine phosphorylation of the intracellular region of SIRP-α, phosphatase (e.g., SHP1) binding, adaptor protein binding (e.g., SCAP2, FYB, and/or GRB2), and nitric oxide production. Various assays for measuring SIRP-α signaling in a cell include without limitation SIRP-α phosphorylation, SHP1 and SHP2 co-immunoprecipitation, PI3-kinase signaling, cytokine production (both inflammatory IL-12, IL-23, TNFα, IFN and suppressive cytokines IL-10, IL-4, IL-13, cell surface markers levels for M1 and M2 macrophage markers) or dendritic cell activation and function; Kharitonenkov, A. et al. (1997) Nature 386: 181-6; Ochi, F. et al. (1997) Biochem. Biophys. Res. Commun. 239:483-7; Kim, E. J. et al. (2013) Inflammation Research 62:377-86; Yi, T. et al. (2015) Immunity 43:764-75.
In some embodiments, the cell expressing a human SIRP-α polypeptide is a leukocyte. In some embodiments, the cell is a macrophage, dendritic cell, neutrophil, eosinophil, or myeloid-derived suppressor cell (MDSC). In some embodiments, an antibody of the present disclosure decreases or antagonizes SIRP-α signaling in a cell expressing a human SIRP-α polypeptide by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%, e.g., using one or more of the SIRP-α signaling assays described herein or otherwise known in the art. In some embodiments, an antibody of the present disclosure increases or agonizes SIRP-α signaling in a cell expressing a human SIRP-α polypeptide by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%, e.g., using one or more of the SIRP-α signaling assays described herein or otherwise known in the art.
In some embodiments, an antibody of the present disclosure modulates an intercellular phenotype mediated by SIRP-α. In some embodiments, an antibody of the present disclosure enhances phagocytosis by a macrophage expressing a human SIRP-α polypeptide. For example, phagocytic activity of a macrophage treated or contacted with an antibody of the present disclosure can be compared with phagocytic activity of a macrophage not treated or contacted with the antibody, or phagocytic activity of a macrophage that expresses a human SIRP-α polypeptide and is treated or contacted with an antibody of the present disclosure can be compared with phagocytic activity of a macrophage that does not express a human SIRP-α polypeptide and is treated or contacted with the antibody. Exemplary phagocytosis assays may be found, e.g., in Wieskopf, K. et al (2013) Science 341: 88 and Willingham, S. B. et al. (2012) Proc. Natl. Acad. Sci. 109:6662-7. In some embodiments, an antibody of the present disclosure increases phagocytosis by a macrophage expressing a human SIRP-α polypeptide by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%, e.g., using one or more of the phagocytosis assays described herein or otherwise known in the art.
In some embodiments, an antibody of the present disclosure enhances activation of dendritic cell(s) expressing a human SIRP-α polypeptide (e.g., an increased level of activation of individual dendritic cells, or an increased proportion of dendritic cells that are activated within a sample population). For example, activation of dendritic cell(s) treated or contacted with an antibody of the present disclosure can be compared with activation of dendritic cell(s) not treated or contacted with the antibody, or activation of dendritic cell(s) that express a human SIRP-α polypeptide and are treated or contacted with an antibody of the present disclosure can be compared with activation of dendritic cell(s) that do not express a human SIRP-α polypeptide and are treated or contacted with the antibody. Exemplary dendritic cell activation assays are described herein. In some embodiments, an antibody of the present disclosure increases dendritic cell (e.g., expressing a human SIRP-α polypeptide) activation by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%, e.g., using one or more of the dendritic cell activation assays described herein or otherwise known in the art.
In some embodiments, an antibody of the present disclosure inhibits in vivo growth of a tumor that expresses CD47. For example, in vivo growth of a tumor that expresses CD47 and is treated with an antibody of the present disclosure can be compared against in vivo growth of a tumor that expresses CD47 and is not treated with an antibody of the present disclosure. Exemplary in vivo tumor growth assays are described herein. In some embodiments, an antibody of the present disclosure inhibits in vivo growth of a tumor that expresses CD47 by at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, or at least 90%, e.g., using one or more of the in vivo tumor growth assays described herein or otherwise known in the art.
In some embodiments, an antibody of the present disclosure blocks binding between an extracellular domain (e.g., the D1 domain) of a human SIRP-α polypeptide and an IgSF domain of a human CD47 polypeptide (e.g., a “blocking” antibody). For example, the antibody and the CD47 polypeptide may “compete” for the same SIRP-α epitope, and/or antibody binding to SIRP-α may be mutually exclusive with CD47 binding to SIRP-α. The binding interface between SIRP-α and CD47, as well as residues of both proteins that participate in binding, are known; see Hatherley, D. et al. (2007) J. Biol. Chem. 282:14567-75 and Nakaishi, A. et al. (2008) J. Mol. Biol. 375:650-60. In some embodiments, an antibody of the present disclosure blocks binding between an extracellular domain (e.g., the D1 domain) of a human SIRP-α polypeptide and an IgSF domain of a human CD47 polypeptide in an in vitro assay such as an ELISA or SPR assay, e.g., using purified SIRP-α and/or CD47 polypeptides.
Antibody Production and Other Antibody Properties
An antibody of the present disclosure may be produced by any means known in the art. Exemplary techniques for antibody production are described below; however these exemplary techniques are provided for illustrative purposes only and are not intended to be limiting. In addition, exemplary antibody properties contemplated for use with the antibodies described herein are further described.
In some embodiments, an antibody that “binds” an antigen has a dissociation constant (KD) for the antigen that is less than or equal to 1 μM at 25° C. In some embodiments, an antibody of the present disclosure has a dissociation constant (KD) for human v1 and/or v2 SIRP-α polypeptides that is less than or equal to 1 μM at 25° C., less than or equal to 500 nM at 25° C., less than or equal to 400 nM at 25° C., less than or equal to 300 nM at 25° C., less than or equal to 250 nM at 25° C., less than or equal to 200 nM at 25° C., less than or equal to 200 nM at 25° C., less than or equal to 100 nM at 25° C., or less than or equal to 50 nM at 25° C. In some embodiments, an antibody that binds a human SIRP-α polypeptide and one or more non-human SIRP-α polypeptides binds the human SIRP-α polypeptide at a higher affinity (e.g., 10-fold or 100-fold higher) than the non-human SIRP-α polypeptide, though it still considered to “bind” both polypeptides. In some embodiments, an antibody that binds a non-human SIRP-α polypeptide and one or more human SIRP-α polypeptides binds the non-human SIRP-α polypeptide at a higher affinity (e.g., 10-fold or 100-fold higher) than the human SIRP-α polypeptide, though it still considered to “bind” both polypeptides. Assays for determining binding affinity are known in the art and include without limitation surface plasmon resonance (SPR), e.g., as described herein; radiolabeled antigen binding assay (RIA), e.g., using a Fab version of an antibody and its antigen; and the like.
To prepare an antigen, the antigen may be purified or otherwise obtained from a natural source, or it may be expressed using recombinant techniques. In some embodiments, the antigen may be used as a soluble protein. In some embodiments, the antigen may be conjugate to another polypeptide or other moiety, e.g., to increase its immunogenicity. For example, an antigen described herein may be coupled with an Fc region. In some embodiments, a cell expressing the antigen on its cell surface may be used as the antigen.
Polyclonal antibodies can be raised in an animal by multiple subcutaneous (sc) or intraperitoneal (ip) injections of the antigen and an adjuvant. For example, descriptions of chicken immunization are described herein. In some embodiments, the antigen is conjugated with an immunogenic protein, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent. Exemplary methods for immunization of chickens are provided herein. Relevant methods suitable for a variety of other organisms, such as mammals, are well known in the art.
As described supra, monoclonal antibodies may be produced by a variety of methods. In some embodiments, a monoclonal antibody of the present disclosure is made using the hybridoma method first described by Kohler et al., Nature, 256:495 (1975), and further described in Hongo et al., Hybridoma, 14 (3): 253-260 (1995); Harlow et al., Antibodies: A Laboratory Manual, (Cold Spring Harbor Laboratory Press, 2nd ed. 1988); and Hammerling et al., in: Monoclonal Antibodies and T-Cell Hybridomas 563-681 (Elsevier, N.Y., 1981). Human hybridoma technology (Trioma technology) is described in Vollmers and Brandlein, Histology and Histopathology, 20(3):927-937 (2005) and Vollmers and Brandlein, Methods and Findings in Experimental and Clinical Pharmacology, 27(3): 185-91 (2005). A culture medium in which hybridoma cells are grown may be screened for the presence of an antibody of interest, e.g., by in vitro binding assay, immunoprecipitation, ELISA, RIA, etc.; and the binding affinity may be determined, e.g., by Scatchard analysis. A hybridoma that produces an antibody with desired binding properties can be subcloned and grown using known culture techniques, grown in vivo as ascites tumors in an animal, and the like.
In some embodiments, a monoclonal antibody is made using a library method, such as a phage display library. See, e.g., Hoogenboom et al. in Methods in Molecular Biology 178:1-37 (O'Brien et al., ed., Human Press, Totowa, N.J., 2001). In some embodiments, repertoires of VH and VL genes are cloned by polymerase chain reaction (PCR) and recombined randomly in phage libraries, which are then screened for antigen-binding phage, e.g., as described in Winter et al., Ann. Rev. Immunol., 12: 433-455 (1994). Phage typically display antibody fragments, either as single-chain Fv (scFv) fragments or as Fab fragments. Alternatively, the naive repertoire can be cloned (e.g., from human) to provide a single source of antibodies to a wide range of non-self and also self-antigens without any immunization as described by Griffiths et al., EMBO J, 12: 725-734 (1993). Finally, naive libraries can also be made synthetically by cloning unrearranged V-gene segments from stem cells, and using PCR primers containing random sequence to encode the highly variable CDR3 regions and to accomplish rearrangement in vitro, as described by Hoogenboom and Winter, J. Mol. Biol., 227: 381-388 (1992).
In some embodiments, an antibody of the present disclosure is a chicken antibody. Chicken antibodies can be produced using various techniques known in the art; see, e.g., U.S. Pat. Nos. 6,143,559; 8,592,644; and 9,380,769.
In some embodiments, an antibody of the present disclosure is a chimeric antibody. See, e.g., U.S. Pat. No. 4,816,567 and Morrison et al., Proc. Natl. Acad. Sci. USA, 81:6851-6855 (1984). In some embodiments, a chimeric antibody comprises a non-human variable region (e.g., a variable region derived from a chicken, mouse, rat, hamster, rabbit, or non-human primate, such as a monkey) and a human constant region. In some embodiments, a chimeric antibody is a “class switched” antibody in which the class or subclass has been changed from that of the parent antibody. Chimeric antibodies include antigen-binding fragments thereof.
In some embodiments, a chimeric antibody is a humanized antibody. A non-human antibody can be humanized to reduce immunogenicity to humans, while retaining the specificity and affinity of the parental non-human antibody. Generally, a humanized antibody comprises one or more variable domains in which HVRs, e.g., CDRs, (or portions thereof) are derived from a non-human antibody (e.g., a chicken antibody), and FRs (or portions thereof) are derived from human antibody sequences. A humanized antibody optionally will also comprise at least a portion of a human constant region. In some embodiments, some FR residues in a humanized antibody are substituted with corresponding residues from a non-human antibody (e.g., the antibody from which the HVR residues are derived), e.g., to restore or improve antibody specificity or affinity. Humanized antibodies and methods of making them are reviewed, e.g., in Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008). Methods of humanizing a chicken antibody have also been described, e.g., in WO2005014653.
Human framework regions useful for humanization include but are not limited to: framework regions selected using the “best-fit” method; framework regions derived from the consensus sequence of human antibodies of a particular subgroup of light or heavy chain variable regions; human somatically mutated framework regions or human germline framework regions; and framework regions derived from screening FR libraries. See, e.g., Sims et al. J Immunol. 151:2296 (1993); Carter et al. Proc. Natl. Acad. Sci. USA, 89:4285 (1992); Presta et al. J Immunol., 151:2623 (1993); Almagro and Fransson, Front. Biosci. 13:1619-1633 (2008); and Baca et al., J. Biol. Chem. 272:10678-10684 (1997).
In some embodiments, an antibody of the present disclosure is a human antibody. Human antibodies can be produced using various techniques known in the art. In some embodiments, the human antibody is produced by a non-human animal, such as the genetically engineered chickens (see, e.g., U.S. Pat. Nos. 8,592,644; and 9,380,769) and/or mice described herein. Human antibodies are described generally in Lonberg, Curr. Opin. Immunol. 20:450-459 (2008).
In some embodiments, an antibody of the present disclosure is generated by or derived from a chicken, e.g., using the methods described herein.
In some embodiments, an antibody of the present disclosure is an antibody fragment, including without limitation a Fab, F(ab′)2, Fab′-SH, Fv, or scFv fragment, or a single domain, single heavy chain, or single light chain antibody. Antibody fragments can be generated, e.g., by enzymatic digestion or by recombinant techniques. In some embodiments, Proteolytic digestion of an intact antibody is used to generate an antibody fragment, e.g., as described in Morimoto et al., Journal of Biochemical and Biophysical Methods 24:107-117 (1992) and Brennan et al., Science, 229:81 (1985). In some embodiments, an antibody fragment is produced by a recombinant host cell. For example, Fab, Fv and ScFv antibody fragments are expressed by and secreted from E. coli. Antibody fragments can alternatively be isolated from an antibody phage library.
Fab′-SH fragments can be directly recovered from E. coli and chemically coupled to form F(ab′)2 fragments. See Carter et al., Bio/Technology 10:163-167 (1992). F(ab′)2 fragments can also be isolated directly from a recombinant host cell culture. Fab and F(ab′)2 fragment with increased in vivo half-life comprising salvage receptor binding epitope residues are described in U.S. Pat. No. 5,869,046.
In some embodiments, an antibody is a single chain Fv fragment (scFv). See WO 93/16185 and U.S. Pat. Nos. 5,571,894 and 5,587,458. scFv fusion proteins can be constructed to produce a fusion of an effector protein at either the amino or the carboxy terminus of an scFv. The antibody fragment may also be a “linear antibody”, e.g., as described in U.S. Pat. No. 5,641,870, for example. Such linear antibodies may be monospecific or bispecific.
In some embodiments, an antibody of the present disclosure is a multispecific antibody. Multispecific antibodies possess binding specificities against more than one antigen (e.g., having two, three, or more binding specificities). In some embodiments, the antibody is a bispecific antibody. In some embodiments, a bispecific antibody comprises two different binding specificities for the same antigen (e.g., having different binding affinity and/or specific epitope of the same antigen). In some embodiments, a bispecific antibody comprises binding specificities for two distinct antigens. In some embodiments, the bispecific antibody is a full-length or intact antibody. In some embodiments, the bispecific antibody is an antibody fragment of the present disclosure.
Bispecific or multispecific antibodies with a variety of combinations of binding specificities are contemplated herein. In some embodiments, the bispecific antibody has a first binding specificity for one or more SIRP-α polypeptides as described herein. In some embodiments, the bispecific antibody has a second binding specificity for an antigen expressed by a cancer cell, e.g., on the cell surface. Exemplary such antigens include without limitation CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, EphA4, BCMA, Mucin 1, Mucin 16, PTK7, PD-L1, STEAP1, Endothelin B Receptor, mesothelin, EGFRvIII, ENPP3, SLC44A4, GNMB, nectin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin αVβ33, integrin α5β1, MET, IGF1R, TRAILR1, TRAILR2, RANKL, FAP, Tenascin, Ley, EpCAM, CEA, gpA33, PSMA, TAG72, a mucin, CAIX, EPHA3, folate receptor α, GD2, GD3, and an MHC/peptide complex comprising a peptide from NY-ESO-1/LAGE, SSX-2, a MAGE family protein, MAGE-A3, gp100/pmel17, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MUC1, PRAME, survivin, BRCA1, BRCA2, CDK4, CML66, MART-2, p53, Ras, β-catenin, TGF-βRII, HPV E6, or HPV E7. Without wishing to be bound to theory, it is thought that combining such a binding specificity with a binding specificity against a SIRP-α is particularly advantageous, e.g., to direct FcR-expressing leukocytes to target a tumor cell with the second binding specificity while also inhibiting the responsiveness of SIRP-α expressed by the leukocyte to any CD47 expressed by the tumor cell with the first binding specificity.
In some embodiments, the bispecific antibody has a second binding specificity for an antigen expressed by an immune cell, e.g., on the cell surface. Exemplary such antigens include without limitation BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, IDO, TDO, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, PVRIG, DNAM, and ICOS. In some embodiments, the antigen is expressed on a myeloid cell. Such antigens can include without limitation BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, IDO, and TDO. In some embodiments, the antigen is expressed on a T cell. Such antigens can include without limitation 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS.
In some embodiments, the bispecific antibody has a second binding specificity for an antigen expressed by an NK cell, e.g., on the cell surface. Exemplary such antigens include without limitation NKR-P1A (KLRB1), CD94 (NKG2A), KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94 (NKG2C/E), NKG2D, CD160 (BY55), CD16 (FcγRIIIA), NKp46 (NCR1), NKp30 (NCR3), NKp44 (NCR2), DNAM1 (CD226), CRTAM, CD27, NTB-A (SLAMF6), PSGL1, CD96 (Tactile), CD100 (SEMA4D), NKp80 (KLRF1, CLEC5C), SLAMF7 (CRACC, CS1, CD319), and CD244 (2B4, SLAMF4).
Various methods are known in the art for generating and purifying a bispecific antibody. Numerous approaches have been described. One approach is the “knobs-into-holes” or “protuberance-into-cavity” approach (see, e.g., U.S. Pat. No. 5,731,168). In some embodiments, heterodimerization of Fc domain monomers is promoted by introducing different, but compatible, substitutions in the two Fc domain monomers, such as “knob-into-hole” residue pairs and charge residue pairs. The knob and hole interaction favors heterodimer formation, whereas the knob-knob and the hole-hole interaction hinder homodimer formation due to steric clash and deletion of favorable interactions. A hole refers to a void that is created when an original amino acid in a protein is replaced with a different amino acid having a smaller side-chain volume. A knob refers to a bump that is created when an original amino acid in a protein is replaced with a different amino acid having a larger side-chain volume. For example, in some embodiments, an amino acid being replaced is in the CH3 antibody constant domain of an Fc domain monomer and involved in the dimerization of two Fc domain monomers. In some embodiments, a hole in one CH3 antibody constant domain is created to accommodate a knob in another CH3 antibody constant domain, such that the knob and hole amino acids act to promote or favor the heterodimerization of the two Fc domain monomers. In some embodiments, a hole in one CH3 antibody constant domain is created to better accommodate an original amino acid in another CH3 antibody constant domain. In some embodiments, a knob in one CH3 antibody constant domain is created to form additional interactions with original amino acids in another CH3 antibody constant domain.
In some embodiments, a hole is constructed by replacing amino acids having larger side chains such as tyrosine or tryptophan with amino acids having smaller side chains such as alanine, valine, or threonine, for example a Y407V mutation in the CH3 antibody constant domain. Similarly, in some embodiments, a knob is constructed by replacing amino acids having smaller side chains with amino acids having larger side chains, for example a T366W mutation in the CH3 antibody constant domain. In some embodiments, one Fc domain monomer includes the knob mutation T366W and the other Fc domain monomer includes hole mutations T366S, L358A, and Y407V. In some embodiments, a polypeptide of the disclosure including a high affinity SIRP-α D1 variant is fused to an Fc domain monomer including the knob mutation T366W to limit unwanted knob-knob homodimer formation. Examples of knob-into-hole amino acid pairs are included, without limitation, in Table 3.
Another approach uses antibody variable domains with the desired binding specificities (antibody-antigen combining sites) fused to immunoglobulin constant domain sequences, e.g., with an immunoglobulin heavy chain constant domain, comprising at least part of the hinge, CH2, and CH3 regions. In some embodiments, the bispecific antibody has a hybrid immunoglobulin heavy chain with a first binding specificity in one arm and a hybrid immunoglobulin heavy chain-light chain pair (providing a second binding specificity) in the other arm. See WO 94/04690. Another approach uses cross-linking (see, e.g., U.S. Pat. No. 4,676,980) to produce a heterconjugate antibody. In some embodiments, bispecific antibodies can be prepared using chemical linkage (see, e.g., Brennan et al., Science, 229: 81 (1985)) to proteolytically cleave an intact antibody into F(ab′)2 fragments that are reduced in the presence of a dithiol complexing agent and converted to thionitrobenzoate (TNB) derivatives, one of which is reconverted to the Fab′-thiol by reduction and mixed with the other Fab′-TNB derivative to form the bispecific antibody. In some embodiments, Fab′-SH fragments are chemically coupled. In some embodiments, bispecific antibody fragments are produced in cell culture using leucine zippers, as in Kostelny et al., J. Immunol., 148(5): 1547-1553 (1992). For other bispecific antibody formats, see, e.g., Spiess, C. et al. (2015) Mol. Immunol. 67:95-106.
In some embodiments, an antibody of the present disclosure is a diabody. See, e.g., Hollinger et al., Proc. Natl. Acad. Sci. USA, 90:6444-6448 (1993). In a diabody, the VH and VL domains of one fragment pair with complementary VL and VH domains of another fragment, thus forming two antigen-binding sites. Another strategy for making bispecific antibody fragments by the use of single-chain Fv (sFv) dimers has also been reported. See Gruber et al, J Immunol, 152:5368 (1994).
In some embodiments, an antibody of the present disclosure is a single-domain antibody. A single-domain antibody refers to a single polypeptide chain comprising all or a portion of the heavy chain variable domain or all or a portion of the light chain variable domain of an antibody. In certain embodiments, a single-domain antibody is a human single-domain antibody (see, e.g., U.S. Pat. No. 6,248,516 B1). In one embodiment, a single-domain antibody includes all or a portion of the heavy chain variable domain of an antibody. Camelid antibodies are also known.
Antibodies can be produced using recombinant methods. For recombinant production of an anti-antigen antibody, nucleic acid encoding the antibody is isolated and inserted into a replicable vector for further cloning (amplification of the DNA) or for expression. DNA encoding the antibody may be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the antibody). Many vectors are available. The vector components generally include, but are not limited to, one or more of the following: a signal sequence, an origin of replication, one or more marker genes, an enhancer element, a promoter, and a transcription termination sequence.
An antibody of the present disclosure can be produced recombinantly as a fusion polypeptide with a heterologous polypeptide, e.g., a signal sequence or other polypeptide having a specific cleavage site at the N-terminus of the mature protein or polypeptide. The heterologous signal sequence selected can be one that is recognized and processed (e.g., cleaved by a signal peptidase) by the host cell. For prokaryotic host cells that do not recognize and process a native antibody signal sequence, the signal sequence is substituted by a prokaryotic signal sequence selected, for example, from alkaline phosphatase, penicillinase, lpp, or heat-stable enterotoxin II leaders. For yeast secretion the native signal sequence may be substituted by, e.g., the yeast invertase leader, a factor leader (including Saccharomyces and Kluyveromyces α-factor leaders), or acid phosphatase leader, the C. albicans glucoamylase leader, etc. In mammalian cell expression, mammalian signal sequences as well as viral secretory leaders, for example, the herpes simplex gD signal, are available.
Both expression and cloning vectors contain a nucleic acid sequence that enables the vector to replicate in one or more selected host cells, e.g., to allow the vector to replicate independently of the host chromosomal DNA. This sequence can include origins of replication or autonomously replicating sequences. Such sequences are well known for a variety of bacteria, yeast, and viruses. Generally, the origin of replication component is not needed for mammalian expression vectors (the SV40 origin may be used because it contains the early promoter).
Expression and cloning vectors can contain a selection gene or selectable marker. Typical selection genes encode proteins that (a) confer resistance to antibiotics or other toxins, e.g., ampicillin, neomycin, methotrexate, or tetracycline, (b) complement auxotrophic deficiencies, or (c) supply critical nutrients not available from complex media. Examples of dominant selection use the drugs neomycin, mycophenolic acid and hygromycin. Another example of suitable selectable markers for mammalian cells are those that enable the identification of cells competent to take up antibody-encoding nucleic acid, such as DHFR, glutamine synthetase (GS), thymidine kinase, metallothionein-I and -II, preferably primate metallothionein genes, adenosine deaminase, omithine decarboxylase, and the like. For example, a Chinese hamster ovary (CHO) cell line deficient in endogenous DHFR activity transformed with the DHFR gene is identified by culturing the transformants in a culture medium containing methotrexate (Mtx), a competitive antagonist of DHFR.
Alternatively, host cells (particularly wild-type hosts that contain endogenous DHFR) transformed or co-transformed with DNA sequences encoding an antibody of interest, wild-type DHFR gene, and another selectable marker such as aminoglycoside 3′-phosphotransferase (APH) can be selected by cell growth in medium containing a selection agent for the selectable marker such as an aminoglycosidic antibiotic, e.g., kanamycin, neomycin, or G418.
Expression and cloning vectors generally contain a promoter that is recognized by the host organism and is operably linked to nucleic acid encoding an antibody. Promoters suitable for use with prokaryotic hosts include the phoA promoter, β-lactamase and lactose promoter systems, alkaline phosphatase promoter, a tryptophan (trp) promoter system, and hybrid promoters such as the tac promoter. However, other known bacterial promoters are suitable. Promoter sequences are known for eukaryotes. Yeast promoters are well known in the art and can include inducible promoters/enhancers regulated by growth conditions. Virtually all eukaryotic genes have an AT-rich region located approximately 25 to 30 bases upstream from the site where transcription is initiated. Examples include without limitation the promoters for 3-phosphoglycerate kinase or other glycolytic enzymes, such as enolase, glyceraldehyde-3-phosphate dehydrogenase, hexokinase, pyruvate decarboxylase, phosphofructokinase, glucose-6-phosphate isomerase, 3-phosphoglycerate mutase, pyruvate kinase, triosephosphate isomerase, phosphoglucose isomerase, and glucokinase. Antibody transcription from vectors in mammalian host cells can be controlled, for example, by promoters obtained from the genomes of viruses. The early and late promoters of the SV40 virus are conveniently obtained as an SV40 restriction fragment that also contains the SV40 viral origin of replication. The immediate early promoter of the human cytomegalovirus is conveniently obtained as a HindIII E restriction fragment. Alternatively, the Rous Sarcoma Virus long terminal repeat can be used as the promoter.
Transcription of a DNA encoding an antibody of the present disclosure by higher eukaryotes is often increased by inserting an enhancer sequence into the vector. Many enhancer sequences are now known from mammalian genes (globin, elastase, albumin, α-fetoprotein, and insulin). Typically, however, one will use an enhancer from a eukaryotic cell virus.
Expression vectors used in eukaryotic host cells (yeast, fungi, insect, plant, animal, human, or nucleated cells from other multicellular organisms) will also contain sequences necessary for the termination of transcription and for stabilizing the mRNA.
Suitable host cells for cloning or expressing the DNA in the vectors herein are the prokaryote, yeast, or higher eukaryote cells described above. Suitable prokaryotes for this purpose include eubacteria, such as Gram-negative or Gram-positive organisms, for example, Enterobacteriaceae such as Escherichia, e.g., E. coli, Enterobacter, Erwinia, Klebsiella, Proteus, Salmonella, e.g., Salmonella typhimurium, Serratia, e.g., Serratia marcescans, and Shigella, etc. In addition to prokaryotes, eukaryotic microbes such as filamentous fungi or yeast are suitable cloning or expression hosts for antibody-encoding vectors. Saccharomyces cerevisiae, or common baker's yeast, is the most commonly used among lower eukaryotic host microorganisms. Certain fungi and yeast strains may be selected in which glycosylation pathways have been “humanized,” resulting in the production of an antibody with a partially or fully human glycosylation pattern. See, e.g., Li et al., Nat. Biotech. 24:210-215 (2006).
Plant cell cultures of cotton, corn, potato, soybean, petunia, tomato, duckweed (Leninaceae), alfalfa (M. truncatula), and tobacco can also be utilized as hosts.
Suitable host cells for the expression of glycosylated antibody are also derived from multicellular organisms (invertebrates and vertebrates). Examples of invertebrate cells include plant and insect cells. Numerous baculoviral strains and variants and corresponding permissive insect host cells from hosts such as Spodoptera frugiperda (caterpillar), Aedes aegypti (mosquito), Aedes albopictus (mosquito), Drosophila melanogaster (fruitfly), and Bombyx mori have been identified.
Vertebrate cells may be used as hosts, and propagation of vertebrate cells in culture (tissue culture) has become a routine procedure. Examples of useful mammalian host cell lines are monkey kidney CV1 line transformed by SV40 (COS-7, ATCC CRL 1651); human embryonic kidney line (293 or 293 cells subcloned for growth in suspension culture, Graham et al., J. Gen Virol. 36:59 (1977)); baby hamster kidney cells (BHK, ATCC CCL 10); mouse sertoli cells (TM4, Mather, Biol. Reprod. 23:243-251 (1980)); monkey kidney cells (CV1 ATCC CCL 70); African green monkey kidney cells (VERO-76, ATCC CRL-1587); human cervical carcinoma cells (HELA, ATCC CCL 2); canine kidney cells (MDCK, ATCC CCL 34); buffalo rat liver cells (BRL 3A, ATCC CRL 1442); human lung cells (W138, ATCC CCL 75); human liver cells (Hep G2, HB 8065); mouse mammary tumor (MMT 060562, ATCC CCL51); TRI cells (Mather et al., Annals N. Y. Acad. Sci. 383:44-68 (1982)); MRC 5 cells; FS4 cells; and a human hepatoma line (Hep G2). Other useful mammalian host cell lines include Chinese hamster ovary (CHO) cells, including DHFR CHO cells (Urlaub et al., Proc. Natl. Acad. Sci. USA 77:4216 (1980)); and myeloma cell lines such as NS0 and Sp2/0. For a review of certain mammalian host cell lines suitable for antibody production, see, e.g., Yazaki and Wu, Methods in Molecular Biology, Vol. 248 (B. K. C. Lo, ed., Humana Press, Totowa, N.J., 2003), pp. 255-268.
The host cells of the present disclosure may be cultured in a variety of media. Commercially available media such as Ham's F10 (Sigma), Minimal Essential Medium ((MEM), (Sigma), RPMI-1640 (Sigma), and Dulbecco's Modified Eagle's Medium ((DMEM), Sigma) are suitable for culturing the host cells. In addition, any of the media described in Ham et al., Meth. Enz. 58:44 (1979), Barnes et al., Anal. Biochem. 102:255 (1980), U.S. Pat. No. 4,767,704; 4,657,866; 4,927,762; 4,560,655; or 5,122,469; WO 90/03430; WO 87/00195; or U.S. Pat. Re. 30,985 may be used as culture media for the host cells. Any of these media may be supplemented as necessary with hormones and/or other growth factors (such as insulin, transferrin, or epidermal growth factor), salts (such as sodium chloride, calcium, magnesium, and phosphate), buffers (such as HEPES), nucleotides (such as adenosine and thymidine), antibiotics (such as GENTAMYCIN™ drug), trace elements (defined as inorganic compounds usually present at final concentrations in the micromolar range), and glucose or an equivalent energy source. Any other necessary supplements may also be included at appropriate concentrations that would be known to those skilled in the art. The culture conditions, such as temperature, pH, and the like, are those previously used with the host cell selected for expression, and will be apparent to one of skill in the art.
When using recombinant techniques, the antibody can be produced intracellularly, in the periplasmic space, or directly secreted into the medium. If the antibody is produced intracellularly, as a first step, the particulate debris, either host cells or lysed fragments, are removed, for example, by centrifugation or ultrafiltration. Carter et al., Bio/Technology 10:163-167 (1992) describe a procedure for isolating antibodies which are secreted to the periplasmic space of E. coli.
The antibody composition prepared from the cells can be purified using, for example, hydroxylapatite chromatography, hydrophobic interaction chromatography, gel electrophoresis, dialysis, and affinity chromatography, with affinity chromatography being among one of the typically preferred purification steps.
In some embodiments, an antibody of the present disclosure comprises a light chain comprising a light chain constant (CL) domain sequence that comprises an amino acid sequence according to the formula GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTK PSKQSX4X5KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO:72), where X4X5 is ND, DN, DS, or SD. In certain embodiments, the CL domain comprises an amino acid sequence selected from SEQ ID NOs:43-46.
In some embodiments, an antibody of the present disclosure comprises a light chain variable (VL) domain comprising one, two, three, or four IGLV3 framework sequences, including without limitation SYELTQPPSVSVSPGQTARITC (SEQ ID NO:27), WYQQKPGQAPVTLIY (SEQ ID NO:28), NIPERFSGSSSGTTVTLTISGVQAEDEADYYC (SEQ ID NO:29), and FGGGTKLTVL (SEQ ID NO:30). In some embodiments, an antibody of the present disclosure comprises a light chain variable (VL) domain comprising the structure FW1—HVR-L1—FW2—HVR-L2—FW3—HVR-L3—FW4, wherein FW1 comprises the sequence SYELTQPPSVSVSPGQTARITC (SEQ ID NO:27), FW2 comprises the sequence WYQQKPGQAPVTLIY (SEQ ID NO:28), FW3 comprises the sequence NIPERFSGSSSGTTVTLTISGVQAEDEADYYC (SEQ ID NO:29), and FW4 comprises the sequence FGGGTKLTVL (SEQ ID NO:30).
In some embodiments, an antibody of the present disclosure comprises a light chain comprising a kappa or lambda light chain constant (CL) domain. In some embodiments, an antibody of the present disclosure comprises a light chain comprising a light chain constant domain comprising the amino acid sequence of one of SEQ ID NOs:36-38. In some embodiments, an antibody of the present disclosure comprises a light chain comprising a light chain constant domain comprising the amino acid sequence of one of SEQ ID NOs:43-46. In some embodiments, an antibody of the present disclosure comprises a light chain comprising a light chain constant domain sequence shown in Table 1. In some embodiments, an antibody of the present disclosure comprises a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25 and a CL domain sequence selected from SEQ ID NOs:36-38 and 43-46. In some embodiments, an antibody of the present disclosure comprises a light chain that comprises a VL domain comprising the sequence of SEQ ID NO:25 and a CL domain sequence selected from SEQ ID NOs:43-46. In some embodiments, an antibody of the present disclosure comprises a light chain that comprises an amino acid sequence selected from SEQ ID NOs:48-51. In some embodiments, an antibody of the present disclosure comprises a light chain that comprises a VL domain sequence selected from SEQ ID NOs:39-41 and a CL domain comprising a sequence selected from SEQ ID NOs:36-38. Any of the above light chains can be combined with a heavy chain shown in Table 2 or an antibody heavy chain comprising a VH domain shown in Table 2.
In some embodiments, an antibody of the present disclosure includes a heavy chain comprising a heavy chain constant domain that comprises an Fc region. For example, in some embodiments, the Fc region is a human Fc region, e.g., IgG1, IgG2, or IgG4 and subtypes thereof. Exemplary and non-limiting Fc regions are provided within the heavy chain constant domains comprising the amino acid sequences of SEQ ID NOs:31-35 and 132-139, as shown in Table 4. In some embodiments, an Fc region within one or more of the heavy chain constant domain amino acid sequences of SEQ ID NOs:31-35 and 132-139 comprises one or more of the mutations described herein, e.g., infra. In some embodiments, an antibody of the present disclosure comprises a heavy chain that comprises a heavy chain chain constant domain sequence shown in Table 2.
In some embodiments, the Fc region includes one or more mutations that influence one or more antibody properties, such as stability, pattern of glycosylation or other modifications, effector cell function, pharmacokinetics, and so forth. In some embodiments, an antibody of the present disclosure has reduced or minimal glycosylation. In some embodiments, an antibody of the present disclosure has ablated or reduced effector function. In some embodiments, an antibody of the present disclosure has improved stability (e.g., improved stability of the hinge domain and/or reduced monomer exchange of IgG4 antibodies through use of the S228P mutation).
Exemplary Fc mutations (e.g., that influence one or more of the properties described supra) include without limitation (i) a human IgG1 Fc region mutations L234A, L235A, G237A, and optionally N297A; (ii) a human IgG2 Fc region mutations A330S, P331S and optionally N297A; and (iii) a human IgG4 Fc region mutations S228P and optionally E233P, F234V, L235A, delG236, and N297A (EU numbering). In some embodiments, the human IgG1 Fc region comprises L234A, L235A, and G237A mutations. In some embodiments, the human IgG1 Fc region comprises L234A, L235A, G237A, and N297A mutations. In some embodiments, the human IgG2 Fc region comprises A330S and P331S mutations. In some embodiments, the human IgG2 Fc region comprises A330S, P331S, and N297A mutations. In some embodiments, the human IgG4 Fc region comprises an S288P mutation. In some embodiments, the human IgG4 Fc region comprises S288P and L235E mutations.
Antibodies that target cell surface antigens can trigger immunostimulatory and effector functions that are associated with Fc receptor (FcR) engagement on immune cells. There are a number of Fc receptors that are specific for particular classes of antibodies, including IgG (gamma receptors), IgE (eta receptors), IgA (alpha receptors) and IgM (mu receptors). Binding of the Fc region to Fc receptors on cell surfaces can trigger a number of biological responses including phagocytosis of antibody-coated particles (antibody-dependent cell-mediated phagocytosis, or ADCP), clearance of immune complexes, lysis of antibody-coated cells by killer cells (antibody-dependent cell-mediated cytotoxicity, or ADCC) and, release of inflammatory mediators, placental transfer, and control of immunoglobulin production. Additionally, binding of the C1 component of complement to antibodies can activate the complement system. Activation of complement can be important for the lysis of cellular pathogens. However, the activation of complement can also stimulate the inflammatory response and can also be involved in autoimmune hypersensitivity or other immunological disorders. Variant Fc regions with reduced or ablated ability to bind certain Fc receptors are useful for developing therapeutic antibodies and Fc-fusion polypeptide constructs which act by targeting, activating, or neutralizing ligand functions while not damaging or destroying local cells or tissues.
In some embodiments, a Fc domain monomer refers to a polypeptide chain that includes second and third antibody constant domains (e.g., CH2 and CH3). In some embodiments, an Fc domain monomer also includes a hinge domain. In some embodiments, the Fc domain monomer is of any immunoglobulin antibody isotype, including IgG, IgE, IgM, IgA, and IgD. Additionally, in some embodiments, an Fc domain monomer is of any IgG subtype (e.g., IgG1, IgG2, IgG2a, IgG2b, IgG2c, IgG3, and IgG4). In some embodiments, Fc domain monomers include as many as ten changes from a wild-type Fc domain monomer sequence (e.g., 1-10, 1-8, 1-6, 1-4 amino acid substitutions, additions or insertions, deletions, or combinations thereof) that alter the interaction between an Fc domain and an Fc receptor.
In some embodiments, an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer is capable of forming an Fc domain with another Fc domain monomer. In some embodiments, an Fc domain monomer of an immunoglobulin or a fragment of an Fc domain monomer is not capable of forming an Fc domain with another Fc domain monomer. In some embodiments, an Fc domain monomer or a fragment of an Fc domain is fused to a polypeptide of the disclosure to increase serum half-life of the polypeptide. In some embodiments, an Fc domain monomer or a fragment of an Fc domain monomer fused to a polypeptide of the disclosure dimerizes with a second Fc domain monomer to form an Fc domain which binds an Fc receptor, or alternatively, an Fc domain monomer binds to an Fc receptor. In some embodiments, an Fc domain or a fragment of the Fc domain fused to a polypeptide to increase serum half-life of the polypeptide does not induce any immune system-related response. An Fc domain includes two Fc domain monomers that are dimerized by the interaction between the CH3 antibody constant domains.
A wild-type Fc domain forms the minimum structure that binds to an Fc receptor, e.g., FcγRI, FcγRIIa, FcγRIIb, FcγRIIIa, FcγRIIIb, and FcγRIV. In some embodiments, the Fc domain in an antibody of the present disclosure comprises one or more amino acid substitutions, additions or insertions, deletions, or any combinations thereof that lead to decreased effector function such as decreased antibody-dependent cell-mediated cytotoxicity (ADCC), decreased complement-dependent cytolysis (CDC), decreased antibody-dependent cell-mediated phagocytosis (ADCP), or any combinations thereof. For example, an antibody of the present disclosure can exhibit decreased binding (e.g., minimal binding or absence of binding) to a human Fc receptor and decreased binding (e.g., minimal binding or absence of binding) to complement protein C1q; decreased binding (e.g., minimal binding or absence of binding) to human FcγRI, FcγRIIA, FcγRIIB, FcγRIIIB, FcγRIIIB, or any combinations thereof, and C1q; altered or reduced antibody-dependent effector function, such as ADCC, CDC, ADCP, or any combinations thereof; and so forth. Exemplary mutations include without limitation one or more amino acid substitutions at E233, L234, L235, G236, G237, D265, D270, N297, E318, K320, K322, A327, A330, P331, or P329 (numbering according to the EU index of Kabat (Sequences of Proteins of Immunological Interest, 5th Ed. Public Health Service, National Institutes of Health, Bethesda, Md. (1991)).
In some embodiments, an antibody of the present disclosure has reduced or ablated binding to CD16a, CD32a, CD32b, CD32c, and CD64 Fcγ receptors. In some embodiments, an antibody with a non-native Fc region described herein exhibits at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to an antibody comprising a wild-type Fc region. In some embodiments, an antibody with a non-native Fc region as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to an antibody comprising a wild-type Fc region.
In some embodiments, the Fc variants herein are minimally glycosylated or have reduced glycosylation relative to a wild-type sequence. In some embodiments, deglycosylation is accomplished with a mutation of N297A, or by mutating N297 to any amino acid which is not N.
In some embodiments, variants of antibody IgG constant regions (e.g., Fc variants) possess a reduced capacity to specifically bind Fcγ receptors or have a reduced capacity to induce phagocytosis. In some embodiments, variants of antibody IgG constant regions (e.g., Fc variants) possess a reduced capacity to specifically bind Fcγ receptors and have a reduced capacity to induce phagocytosis. For example, in some embodiments, an Fc domain is mutated to lack effector functions, typical of a “dead” Fc domain. For example, in some embodiments, an Fc domain includes specific amino acid substitutions that are known to minimize the interaction between the Fc domain and an Fcγ receptor. In some embodiments, an Fc domain monomer is from an IgG1 antibody and includes one or more of amino acid substitutions L234A, L235A, G237A, and N297A (amino acid position numbering as designated according to the EU numbering system per Kabat et al., 1991). In some embodiments, one or more additional mutations are included in such IgG1 Fc variant. Non-limiting examples of such additional mutations for human IgG1 Fc variants include E318A and K322A. In some instances, a human IgG1 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer mutations in total as compared to wild-type human IgG1 sequence. In some embodiments, one or more additional deletions are included in such IgG1 Fc variant. For example, in some embodiments, the C-terminal lysine of the Fc IgG1 heavy chain constant region is deleted, for example to increase the homogeneity of the polypeptide when the polypeptide is produced in bacterial or mammalian cells. In some instances, a human IgG1 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5 or 4 or fewer deletions in total as compared to wild-type human IgG1 sequence.
In some embodiments, an Fc domain monomer is from an IgG2 antibody and includes amino acid substitutions A330S, P331S, or both A330S and P331S. The aforementioned amino acid positions are defined according to Kabat, et al. (1991). The Kabat numbering of amino acid residues can be determined for a given antibody by alignment at regions of homology of the sequence of the antibody with a “standard” Kabat numbered sequence. In some embodiments, the Fc variant comprises a human IgG2 Fc sequence comprising one or more of A330S, P331S and N297A amino acid substitutions (amino acid position numbering as designated according to the EU numbering system per Kabat, et al. (1991). In some embodiments, one or more additional mutations are included in such IgG2 Fc variants. Non-limiting examples of such additional mutations for human IgG2 Fc variant include V234A, G237A, P238S, V309L and H268A (as designated according to the EU numbering system per Kabat et al. (1991)). In some instances, a human IgG2 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3 or fewer mutations in total as compared to wild-type human IgG2 sequence. In some embodiments, one or more additional deletions are included in such IgG2 Fc variant.
When the Fc variant is an IgG4 Fc variant, in some embodiments, such Fc variant comprises a S228P, E233P, F234V, L235A, L235E, or delG236 mutation (amino acid position numbering as designated according to Kabat, et al. (1991)). In some instances, a human IgG4 Fc variant has up to 12, 11, 10, 9, 8, 7, 6, 5, 4, 3, 2 or 1 mutation(s) in total as compared to wild-type human IgG4 sequence.
In some embodiments, the Fc variant exhibits reduced binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits ablated binding to an Fc receptor of the subject compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits a reduction of phagocytosis compared to the wild-type human IgG Fc region. In some embodiments, the Fc variant exhibits ablated phagocytosis compared to the wild-type human IgG Fc region.
Antibody-dependent cell-mediated cytotoxicity, which is also referred to herein as ADCC, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain cytotoxic cells (e.g., Natural Killer (NK) cells and neutrophils) enabling these cytotoxic effector cells to bind specifically to an antigen-bearing target cell and subsequently kill the target cell. Antibody-dependent cell-mediated phagocytosis, which is also referred to herein as ADCP, refers to a form of cytotoxicity in which secreted Ig bound onto Fc receptors (FcRs) present on certain phagocytic cells (e.g., macrophages) enabling these phagocytic effector cells to bind specifically to an antigen-bearing target cell and subsequently engulf and digest the target cell. Ligand-specific high-affinity IgG antibodies directed to the surface of target cells can stimulate the cytotoxic or phagocytic cells and can be used for such killing. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit reduced ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in ADCC or ADCP compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, antibodies comprising an Fc variant as described herein exhibit ablated ADCC or ADCP as compared to a polypeptide construct comprising a wild-type Fc region.
Complement-directed cytotoxicity, which is also referred to herein as CDC, refers to a form of cytotoxicity in which the complement cascade is activated by the complement component C1q binding to antibody Fc. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in C1q binding compared to a polypeptide construct comprising a wild-type Fc region. In some cases, polypeptide constructs comprising an Fc variant as described herein exhibit reduced CDC as compared to a polypeptide construct comprising a wild-type Fc region. In some embodiments, polypeptide constructs comprising an Fc variant as described herein exhibit at least a 5%, 10%, 15%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or greater reduction in CDC compared to a polypeptide construct comprising a wild-type Fc region. In some cases, antibodies comprising an Fc variant as described herein exhibit negligible CDC as compared to a polypeptide construct comprising a wild-type Fc region.
Fc variants herein include those that exhibit reduced binding to an Fcγ receptor compared to the wild-type human IgG Fc region. For example, in some embodiments, an Fc variant exhibits binding to an Fcγ receptor that is less than the binding exhibited by a wild-type human IgG Fc region to an Fcγ receptor. In some instances, an Fc variant has reduced binding to an Fcγ receptor by a factor of 10%, 20% 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100% (fully ablated effector function). In some embodiments, the reduced binding is for any one or more Fcγ receptors, e.g., CD16a, CD32a, CD32b, CD32c, or CD64.
In some instances, the Fc variants disclosed herein exhibit a reduction of phagocytosis compared to its wild-type human IgG Fc region. Such Fc variants exhibit a reduction in phagocytosis compared to its wild-type human IgG Fc region, wherein the reduction of phagocytosis activity is e.g., by a factor of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, 96%, 97%, 98%, 99% or 100%. In some instances, an Fc variant exhibits ablated phagocytosis compared to its wild-type human IgG Fc region.
In some embodiments, an antibody of the present disclosure is conjugated to an agent. In some embodiments, the agent is a cytotoxic agent, including but not limited to the exemplary cytotoxic agents described herein. In some embodiments, the agent is a label, including but not limited to the exemplary labels described herein.
In some embodiments, the agent is a moiety that modulates the immune system. For example, the moiety may target and/or modulate the function of a cell expressing SIRP-α on its surface, such as a small molecule that modulates a cellular signaling pathway of the cell expressing SIRP-α, e.g., an IDO/TDO inhibitor, AhR inhibitor, arginase inhibitor, A2a R inhibitor, TLR agonists, STING agonist, or Rig-1 agonist. In some embodiments, the moiety may recruit another macromolecule or cell into proximity with a cell expressing SIRP-α on its surface. In some embodiments, the moiety comprises a cytokine, e.g., IL2, IL7, IL-10, IL15, or IFN. In some embodiments, the moiety (e.g., a small molecule) modulates the activity of a cytokine, e.g., IL2, IL7, IL-10, IL15, or IFN. In some embodiments, the moiety comprises a cancer vaccine (comprising, e.g., DNA, RNA, peptide, or other cellular component(s)). In some embodiments, the moiety comprises an adjuvant. In some embodiments, the moiety comprises a CpG oligonucleotide. In some embodiments, the moiety affects antibody purification, screening, and/or display. In some embodiments, the moiety also affects the degree of binding to Fc receptors or the degree of phagocytosis reduction.
In some embodiments, fusion partners are linked to the Fc variant sequence via a linker sequence. In some embodiments, the linker sequence generally comprises a small number of amino acids, such as less than ten amino acids, although longer linkers are also utilized. In some cases, the linker has a length less than 10, 9, 8, 7, 6, or 5 amino acids or shorter. In some cases, the linker has a length of at least 10, 11, 12, 13, 14, 15, 20, 25, 30, or 35 amino acids or longer. Optionally, in some embodiments, a cleavable linker is employed.
In some embodiments, a fusion partner is a targeting or signal sequence that directs an Fc variant protein and any associated fusion partners to a desired cellular location or to the extracellular media. In some embodiments, certain signaling sequences target a protein to be either secreted into the growth media, or into the periplasmic space, located between the inner and outer membrane of the cell. In some embodiments, a fusion partner is a sequence that encodes a peptide or protein that enables purification or screening. Such fusion partners include, but are not limited to, polyhistidine tags (His-tags) (for example His6 and His10) or other tags for use with Immobilized Metal Affinity Chromatography (IMAC) systems (e.g., Ni+2 affinity columns), GST fusions, MBP fusions, Strep-tag, the BSP biotinylation target sequence of the bacterial enzyme BirA, and epitope tags which are targeted by antibodies (for example c-myc tags, flag-tags, and the like).
In some embodiments, such tags are useful for purification, for screening, or both. For example, in some embodiments, an Fc variant is purified using a His-tag by immobilizing it to a Ni+2 affinity column, and then after purification the same His-tag is used to immobilize the antibody to a Ni+2 coated plate to perform an ELISA or other binding assay.
Various fusion partners that enable a variety of selection methods are available. For example, by fusing the members of an Fc variant library to the gene III protein, phage display can be employed. In some embodiments, fusion partners enable Fc variants to be labeled. Alternatively, in some embodiments, a fusion partner binds to a specific sequence on the expression vector, enabling the fusion partner and associated Fc variant to be linked covalently or noncovalently with the nucleic acid that encodes them.
In some embodiments, when a fusion partner is a therapeutic moiety, the therapeutic moiety is, e.g., a cytotoxic agent, a peptide, a protein, an antibody, a siRNA, or a small molecule.
In some embodiments, an antibody of the present disclosure is bound to various carriers or labels and used to detect the presence of specific antigen expressing cells. Examples of carriers include glass, polystyrene, polypropylene, polyethylene, dextran, nylon, amylases, natural and modified celluloses, polyacrylamides, agaroses, and magnetite. The nature of the carrier can be either soluble or insoluble. Various different labels and methods of labeling are known. Examples of labels include enzymes, radioisotopes, fluorescent compounds, colloidal metals, chemiluminescent compounds, and bio-luminescent compounds. Various techniques for binding labels to antibodies disclosed herein are available. In some embodiments, the antibodies are coupled to low molecular weight haptens. These haptens are then specifically detected by means of a second reaction. For example, in some embodiments, the hapten biotin is used with avidin or the haptens dinitrophenol, pyridoxal, or fluorescein are detected with specific anti-hapten antibodies (e.g., anti-dinitrophenol antibodies, anti-pyridoxal antibodies, and anti-fluorescein antibodies respectively). In some embodiments, the antibodies described herein are utilized in vitro for binding assays, such as immune assays. For example, in some embodiments, the antibodies are utilized in liquid phase or bound to a solid phase carrier. In some embodiments, antibodies utilized for immunoassays are detectably labeled in various ways.
Methods of Treatment
Certain aspects of the present disclosure relate to treating a disease or disorder using an antibody described herein. In some embodiments, the disease is cancer. In some embodiments, the disease is an autoimmune or inflammatory disease.
For example, provided herein are methods of treating or delaying progression of cancer in an individual by administering an effective amount of an antibody of the present disclosure. Without wishing to be bound to theory, it is thought that the antibodies described herein may be useful in the treatment of cancer, e.g., by abrogating the cancer's ability to inhibit phagocytosis and immune surveillance through the CD47: SIRP-α signaling axis, or by otherwise enhancing activation of the immune system (such as by activation of dendritic cells).
In some embodiments, an antibody of the present disclosure is administered in combination with a second antibody, e.g., an antibody that binds an antigen expressed by the cancer (e.g., an effective amount of the second antibody, which in some embodiments as described above may be considered in the context of administering an anti-SIRP-α antibody of the present disclosure). Exemplary antigens expressed by cancers are known in the art and include without limitation CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, EphA4, BCMA, Mucin 1, Mucin 16, PTK7, PD-L1, STEAP1, Endothelin B Receptor, mesothelin, EGFRvIII, ENPP3, SLC44A4, GNMB, nectin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin αVβ3, integrin α5β1, MET, IGF1R, TRAILR1, TRAILR2, RANKL, FAP, Tenascin, Ley, EpCAM, CEA, gpA33, PSMA, TAG72, a mucin, CAIX, EPHA3, folate receptor α, GD2, GD3, and an MHC/peptide complex comprising a peptide from NY-ESO-1/LAGE, SSX-2, a MAGE family protein, MAGE-A3, gp100/pmel117, Melan-A/MART-1, gp75/TRP1, tyrosinase, TRP2, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MUC1, PRAME, survivin, BRCA1, BRCA2, CDK4, CML66, MART-2, p53, Ras, β-catenin, TGF-βRII, HPV E6, or HPV E7. For example, in some embodiments, an antibody of the present disclosure is administered in combination with a monoclonal antibody that binds CD123 (also known as IL-3 receptor alpha), such as talacotuzumab (also known as CSL362 and JNJ-56022473). In some embodiments, an antibody of the present disclosure is administered in combination with a monoclonal antibody that binds EGFR (such as cetuximab). In some embodiments, the second antibody includes one or more effector functions, e.g., effector functions that are associated with Fc receptor (FcR) engagement on immune cells including without limitation ADCC or ADCP, and/or complement-dependent cytotoxicity (CDC). Without wishing to be bound to theory, it is thought that combining such an antibody with an antibody of the present disclosure is particularly advantageous, e.g., to direct FcR-expressing leukocytes to target a tumor cell to which the second antibody is bound while also inhibiting the responsiveness of SIRP-α expressed by the leukocyte to any CD47 expressed by the tumor cell with the SIRP-α antibody.
In some embodiments, an antibody of the present disclosure is administered in combination with a second antibody that binds an antigen expressed by an NK cell. Exemplary antigens expressed by an NK cell include, without limitation, NKR-P1A (KLRB1), CD94 (NKG2A), KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94 (NKG2C/E), NKG2D, CD160 (BY55), CD16 (FcγRIIIA), NKp46 (NCR1), NKp30 (NCR3), NKp44 (NCR2), DNAM1 (CD226), CRTAM, CD27, NTB-A (SLAMF6), PSGL1, CD96 (Tactile), CD100 (SEMA4D), NKp80 (KLRF1, CLEC5C), SLAMF7 (CRACC, CS1, CD319), and CD244 (2B4, SLAMF4).
In some embodiments, an antibody of the present disclosure is administered in combination with an immunotherapeutic agent (e.g., an effective amount of the immunotherapeutic agent, which in some embodiments as described above may be considered in the context of administering an anti-SIRP-α antibody of the present disclosure). An immunotherapeutic agent may refer to any therapeutic that targets the immune system and promotes a therapeutic redirection of the immune system, such as a modulator of a costimulatory pathway, cancer vaccine, recombinantly modified immune cell, etc. Exemplary and non-limiting immunotherapeutic agents are described infra. Without wishing to be bound to theory, it is thought that the antibodies of the present disclosure are suitable for use with immunotherapeutic agents due to complementary mechanisms of action, e.g., in activating both macrophages and other immune cells such as Teffector cells to target tumor cells.
In some embodiments, the immunotherapeutic agent comprises an antibody. Exemplary antigens of immunotherapeutic antibodies are known in the art and include without limitation BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Siglec-15, FGL-1, CD200, CD200R, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, arginase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF-β RI, TGF-β RII, c-Kit, CD244, L-selectin/CD62L, CD11b, CD11c, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS. Immunotherapeutic agents that are approved or in late-stage clinical testing include, without limitation, ipilimumab, pembrolizumab, nivolumab, atezolizumab, avelumab, durvalumab, and the like. In certain embodiments, an antibody of the present disclosure is administered in combination with an inhibitor of the PD-L1/PD-1 pathway, e.g., an anti-PD-L1 or anti-PD-1 antibody. As demonstrated herein, combined administration of an anti-SIRP-α antibody of the present disclosure and an inhibitor of the PD-L1/PD-1 pathway can result in synergistic anti-tumor activity.
In some embodiments, the immunotherapeutic agent comprises a vaccine, oncolytic virus, adoptive cell therapy, cytokine, or small molecule immunotherapeutic agent. Examples of such immunotherapeutic agents are known in the art. For example, adoptive cell therapies and therapeutics can include without limitation chimeric antigen receptor T-cell therapy (CAR-T), tumor infiltrating lymphocytes (TILs), TCR engineered NK cell, and macrophage cell products. Vaccines can include without limitation polynucleotide vaccines, polypeptide vaccines, or cell-based (e.g., tumor or dendritic cell-based) vaccines. Various cytokines useful for the treatment of cancer are known and include without limitation IL-2, IL-15, IL-7, IL-10, IL-12, IL21, TNFa, IFNs, GM-CSF, and engineered cytokine mutants. Small molecule immunotherapeutic agents can include without limitation IDO/TDO inhibitors, AhR inhibitors, arginase inhibitors, A2a R inhibitors, TLR agonists, STING agonists, and Rig-1 agonists.
In some embodiments, an antibody of the present disclosure is administered in combination with a chemotherapeutic agent or small molecule anti-cancer agent. In some embodiments, an antibody of the present disclosure is administered in combination with an immunotherapeutic agent and a chemotherapeutic agent or small molecule anti-cancer agent. For example, it is thought that kinase inhibitors or other inhibitors of signaling pathways (e.g., PAK4, PI3K, etc.) may be useful in combination with modulation of the immune system for treating cancer. As such, the antibodies of the present disclosure may find use in combination with one or more chemotherapeutic agents and/or small molecules (e.g., kinase inhibitors) for treating cancer. Non-limiting examples of chemotherapeutic agents and/or anti-cancer agents contemplated for use in combination with an antibody of the present disclosure are provided infra.
In some embodiments, an antibody of the present disclosure is administered in combination with a therapeutic agent (e.g., a chemotherapeutic/cytotoxic agent) including and not limited to methotrexate (RHEUMATREX®, Amethopterin) cyclophosphamide (CYTOXAN®), thalidomide (THALIDOMID®), acridine carboxamide, Actimid®, actinomycin, 17-N-allylamino-17-demethoxygeldanamycin, aminopterin, amsacrine, anthra-cycline, antineoplastic, antineoplaston, 5-azacytidine, azathioprine, BL22, bendamustine, biricodar, bleomycin, bortezomib, b ostatin, busulfan, calyculin, camptothecin, capecitabine, carboplatin, cetuximab, chlorambucil, cispla-tin, cladribine, clofarabine, cytarabine, dacarbazine, dasatinib, daunorubicin, decitabine, dichloroacetic acid, discode olide, docetaxel, doxorubicin, epirubicin, epothilone, eribulin, estramustine, etoposide, exatecan, exisulind, ferruginol, floxuridine, fludarabine, fluorouracil, fosfestrol, fotemustine, ganciclovir, gemcitabine, hydroxyurea, IT-101, idarubicin, ifosfamide, imiquimod, irinotecan, irofulven, ixabepilone, laniquidar, lapatinib, lenalidomide, lomustine, lurtotecan, mafosfamide, masoprocol, mechlorethamine, melphalan, mercaptopurine, mitomycin, mitotane, mitoxan-trone, nelarabine, nilotinib, oblimersen, oxaliplatin, PAC-1, paclitaxel, pemetrexed, pentostatin, pipobroman, pixantrone, plicamycin, procarbazine, proteasome inhibitors (e.g., bortezomib), raltitrexed, rebeccamycin, Revlimid®, rubite-can, SN-38, salinosporamide A, satraplatin, streptozotocin, swainsonine, tariquidar, taxane, tegafur-uracil, temozolo-mide, testolactone, thioTEPA, tioguanine, topotecan, tra-bectedin, tretinoin, triplatin tetranitrate, tris(2-chloroethyl) amine, troxacitabine, uracil mustard, valrubicin, vinblastine, vincristine, vinorelbine, vorinostat, zosuquidar, or the like.
In some embodiments, an antibody of the present disclosure is administered in combination with a targeted small molecule inhibitor. For example, in some embodiments, an antibody of the present disclosure is administered in combination with a VEGFR/PDGFR inhibitor (e.g., sorafenib, sunitinib, lenvatinib, vandetanib, cabozatinib, apatinib, pazopanib, axitinib, or regorafenib), EGFR inhibitor (e.g., erlotinib, gefitinib, or osimertinib), MEK inhibitor (e.g., trametinib, cobimetinib, binimetinib, or selumetinib), ALK inhibitor (e.g., crizotinib, ceritinib, alectinib, brigatinib, lorlatinib, entrectinib, TSR-011, CEP-37440, or X-396), CDK4/6 inhibitor (e.g., palbociclib, ribociclib, or abemaciclib), PARP inhibitor (e.g., olaparib, rucaparib, niraparib, talazoparib, pamiparib, veliparib, CEP 9722, or E7016), mTOR inhibitor, KRAS inhibitor, TRK inhibitor (e.g., larotrectinib), BCL2 inhibitor (e.g., venetoclax), IDH inhibitor (e.g., ivosidenib or enasidenib), hypomethylation agent (e.g., decitabine or azacitidine), PI3K inhibitor, or DDR (e.g., CHK, ATM, or ATR) inhibitor.
In some embodiments, an antibody of the present disclosure is administered in combination with a therapeutic agent including and not limited to 3F8, 8H9, Abagovomab, Abciximab, Abituzumab, Abrilumab, Actoxumab, Adalimumab, Adecatumumab, Aducanumab, Afelimomab, Afutuzumab, Alacizumab pegol, ALD518, Alemtuzumab, Alirocumab, Altumomab pentetate, Amatuximab, Anatumomab mafenatox, Anetumab ravtansine, Anifrolumab, kinzumab (IMA-638), Apolizumab, Arcitumomab, Ascrinvacumab, Aselizumab, Atezolizumab, Atinumab, Atlizumab (tocilizumab), Atorolimumab, Bapineuzumab, Basiliximab, Bavituximab, Bectumomab, Begelomab, Belimumab, Benralizumab, Bertilimumab, Besilesomab, Bevacizumab, Bezlotoxumab, Biciromab, Bimagrumab, Bimekizumab, Bivatuzumab mertansine, Blinatumomab, Blosozumab, Bococizumab, Brentuximab vedotin, Briakinumab, Brodalumab, Brolucizumab, Brontictuzumab, Canaki-numab, Cantuzumab mertansine, Cantuzumab ravtansine, Caplacizumab, Capromab pendetide, Carlumab, Catumaxomab, cBR96-doxorubicin immunoconjugate, CC49, Cedelizumab, Certolizumab pegol, Cetuximab, Ch. 14.18, Citatuzumab bogatox, Cixutumumab, Clazakizumab, Clenoliximab, Clivatuzumab tetraxetan, Codrituzumab, Coltuximab ravtansine, Conatumumab, Concizumab, Crenezumab, CR6261, Dacetuzumab, Daclizumab, Dalotuzumab, Dapi-rolizumab pegol, Daratumumab, Dectrekumab, Demcizumab, Denintuzumab mafodotin, Denosumab, Derlotuximab biotin, Detumomab, Dinutuximab, Diridavumab, Dorlimomab aritox, Drozitumab, Duligotumab, Dupilumab, Durvalumab, Dusigitumab, Ecromeximab, Eculizumab, Edobacomab, Edrecolomab, Efalizumab, Engumab, Eldelumab, Elgemtumab, Elotuzumab, Elsilimomab, Emactuzumab, Emibetuzumab, Enavatuzumab, Enfortumab vedotin, Enlimomab pegol, Enoblituzumab, Enokizumab, Enoticumab, Ensituximab, Epitumomab cituxetan, Epratu-zumab, Erlizumab, Ertumaxomab, Etaracizumab, Etrolizumab, Evinacumab, Evolocumab, Exbivirumab, Fanolesomab, Faralimomab, Farletuzumab, Fasinumab, FBTA05, Felvizumab, Fezakinumab, Ficlatuzumab, Figitumumab, Firivumab, Flanvotumab, Fletikumab, Fontolizumab, Foralumab, Foravirumab, Fresolimumab, Fulranumab, Futuximab, Galiximab, Ganitumab, Gantenerumab, Gavilimomab, Gemtuzumab ozogamicin, Gevokizumab, Giren-tuximab, Glembatumumab vedotin, Golimumab, Gomiliximab, Guselkumab, Ibalizumab, Ibritumomab tiuxetan, Icrucumab, Idarucizumab, Igovomab, IMAB362, Imalumab, Imciromab, Imgatuzumab, Inclacumab, Indatuximab ravtansine, Indusatumab vedotin, In iximab, Intetumumab, Inolimomab, Inotuzumab ozogamicin, Ipilimumab, Iratumumab, Isatuximab, Itolizumab, Ixekizumab, Keliximab, Labetuzumab, Lambrolizumab, Lampalizumab, Lebrikizumab, Lemalesomab, Lenzilumab, Lerdelimumab, Lexatumumab, Libivirumab, Lifastuzumab vedotin, Ligelizumab, Lilotomab satetraxetan, Lintuzumab, Lirilumab, Lodelcizumab, Lokivetmab, Lorvotuzumab mertansine, Lucatumumab, Lulizumab pegol, Lumiliximab, Lumretuzumab, Mapatumumab, Margetuximab, Maslimomab, Mavrilimumab, Matuzumab, Mepolizumab, Metelimumab, Milatuzumab, Minretumomab, Mitumomab, Mogamulizumab, Morolimumab, Motavizumab, Moxetumomab pasudotox, Muromonab-CD3, Nacolomab tafenatox, Namilumab, Naptumomab estafenatox, Namatumab, Natalizumab, Nebacumab, Necitumumab, Nemolizumab, Nerelimomab, Nesvacumab, Nimotuzumab, Nivolumab, Nofetumomab me entan, Obiltoxaximab, Ocaratuzumab, Ocrelizumab, Odulimomab, Ofatumumab, Olaratumab, Olokizumab, Omalizumab, Onartuzumab, Ontuxizumab, Opicinumab, Oportuzumab monatox, Oregovomab, Orticumab, Otelixizumab, Otlertuzumab, Oxelumab, Ozanezumab, Ozoralizumab, Pagibaximab, Palivizumab, Panitumumab, Pankomab, Panobacumab, Parsatuzumab, Pascolizumab, Pasotuxizumab, Pateclizumab, Patritumab, Pembrolizumab, Pemtumomab, Perakizumab, Pertuzumab, Pexelizumab, Pidilizumab, Pinatuzumab vedotin, Pintumomab, Placulumab, Polatuzumab vedotin, Ponezumab, Priliximab, Pritoxaximab, Pritumumab, PRO 140, Quilizumab, Racotumomab, Radretumab, Ravirumab, Ralpancizumab, Ramucirumab, Ranibizumab, Raxibacumab, Refanezumab, Regavirumab, Reslizumab, Rilotumumab, Rinucumab, Rituximab, Robatumumab, Roledumab, Romosozumab, Rontalizumab, Rovelizumab, Ruplizumab, Samalizumab, Sarilumab, Satumomab pendetide, Secukinumab, Seribantumab, Setoxaximab, Sevirumab, Sibrotuzumab, SGN-CD19A, SGN-CD33A, Sifalimumab, Siltuximab, Simtuzumab, Siplizumab, Sirukumab, Sotuzumab vedotin, Solanezumab, Solitomab, Sonepcizumab, Sontuzumab, Stamulumab, Sulesomab, Suvizumab, Tabalumab, Tacatuzumab tetraxetan, Tadocizumab, Talizumab, Tanezumab, Taplitumomab paptox, Tarextumab, Te bazumab, Telimomab aritox, Tenatumomab, Teneliximab, Teplizumab, Teprotumumab, Tesidolumab, TGN1412, Ticilimumab (tremelimumab), Tildrakizumab, Tigatuzumab, TNX650, Tocilizumab (atlizumab), Toralizumab, Tosatoxumab, Tositumomab, Tovetumab, Tralokinumab, Trastuzumab, TRBS07, Tregalizumab, Tremelimumab, Tucotuzumab celmoleukin, Tuvirumab, Ublituximab, Ulocuplumab, Urelumab, Urtoxazumab, Ustekinumab, Vandortuzumab vedotin, Vantictumab, Vanucizumab, Vapaliximab, Varlilumab, Vatelizumab, Vedolizumab, Veltuzumab, Vepalimomab, Vesencumab, Visilizumab, Volociximab, Vorsetuzumab mafodotin, Votumumab, Zalutumumab, Zanolimumab, Zatuximab, Ziralimumab, or Zolimomab aritox.
Combination treatments comprising an antibody of the present disclosure and multiple additional agents (e.g., as described supra) are contemplated. For example, in some embodiments, an antibody of the present disclosure is administered in combination with a chemotherapeutic/cytotoxic agent and an antibody or targeted small molecule inhibitor. In some embodiments, an antibody of the present disclosure is administered in combination with a chemotherapeutic/cytotoxic agent and an immunotherapeutic agent. In some embodiments, an antibody of the present disclosure is administered in combination with an antibody or targeted small molecule inhibitor and an immunotherapeutic agent.
Any cancer type known in the art may be included, such as but not limited to carcinoma, sarcoma, lymphoma, leukemia, lymphoma, and blastoma. More particular examples of such cancers include, but are not limited to, lung cancer, squamous cell cancer, brain tumors, glioblastoma, head and neck cancer, hepatocellular cancer, colorectal cancer (e.g., colon or rectal cancers), liver cancer, bladder cancer, gastric or stomach cancer, pancreatic cancer, cervical cancer, ovarian cancer, cancer of the urinary tract, breast cancer, peritoneal cancer, uterine cancer, salivary gland cancer, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, anal carcinoma, penile carcinoma, melanoma, multiple myeloma and B-cell lymphoma (including non-Hodgkin's lymphomas (NHL)); acute lymphoblastic leukemia (ALL); chronic lymphocytic leukemia (CLL); acute myeloid leukemia (AML); Merkel cell carcinoma; hairy cell leukemia; chronic myeloblastic leukemia (CML); and associated metastases.
In addition to cancer therapies, the antibodies provided herein are useful in therapies in which monoclonal antibodies are administered for the purpose of depleting cells, e.g., in the treatment of inflammatory diseases by depletion immune cells. For such purposes the an antibody provided herein is administered in combination with a second therapeutic antibody, e.g. with rituximab for depletion of B cells in inflammatory diseases and autoimmune conditions; alemtuzumab for multiple sclerosis; OKT3 for immunosuppression; others for bone marrow transplant conditioning; and the like.
Further provided herein are methods of treating or delaying progression of an autoimmune disease or an inflammatory disease in an individual by administering an effective amount of an antibody of the present disclosure. Autoimmune diseases and inflammatory diseases amenable to treatment according to the disclosure include, but are not limited to, multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, endometriosis, glomerulonephritis, myasthenia gravis, idiopathic pulmonary fibrosis, fibrotic diseases (e.g., pulmonary fibrosis, liver cirrhosis, atrial fibrosis, endomyocardial fibrosis, myelofibrosis, or retroperitoneal fibrosis), asthma, acute respiratory distress syndrome (ARDS), vasculitis, and inflammatory autoimmune myositis. In some embodiments, an antibody of the present disclosure is administered in combination with a therapeutic agent, such as an immunosuppressive, anti-inflammatory, or immunomodulatory agent. In some embodiments, an antibody provided herein is used in the treatment of an autoimmune disease or an inflammatory disease, e.g., multiple sclerosis, rheumatoid arthritis, a spondyloarthropathy, systemic lupus erythematosus, an antibody-mediated inflammatory or autoimmune disease, graft versus host disease, sepsis, diabetes, psoriasis, psoriatic arthritis, atherosclerosis, Sjogren's syndrome, progressive systemic sclerosis, scleroderma, acute coronary syndrome, ischemic reperfusion, Crohn's Disease, ulcerative colitis, endometriosis, glomerulonephritis, IgA nephropathy, polycystic kidney disease, myasthenia gravis, idiopathic pulmonary fibrosis, fibrotic disease (e.g., pulmonary fibrosis, liver cirrhosis, atrial fibrosis, endomyocardial fibrosis, myelofibrosis, or retroperitoneal fibrosis), asthma, atopic dermatitis, acute respiratory distress syndrome (ARDS), vasculitis, or inflammatory autoimmune myositis.
In some embodiments, an antibody of the present disclosure is part of a pharmaceutical formulation, e.g., including the antibody and one or more pharmaceutically acceptable carriers. Pharmaceutical compositions and formulations as described herein can be prepared by mixing the active ingredients (such as an antibody or a polypeptide) having the desired degree of purity with one or more optional pharmaceutically acceptable carriers (Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980)), in the form of lyophilized formulations or aqueous solutions. Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG). In some embodiments, an antibody of the present disclosure is lyophilized.
In some embodiments, an individual is administered a dose normalized to the body weight of the individual. In some embodiments, an individual is administered a dose of about 10 μg/kg, about 50 μg/kg, about 100 μg/kg, about 200 μg/kg, about 300 μg/kg, about 400 μg/kg, about 500 μg/kg, about 600 μg/kg, about 700 μg/kg, about 800 μg/kg, about 900 μg/kg, about 1,000 μg/kg, about 1,100 μg/kg, 1,200 μg/kg, 1,300 μg/kg, 1,400 μg/kg, 1,500 μg/kg, 1,600 μg/kg, 1,700 μg/kg, 1,800 μg/kg, 1,900 μg/kg, about 2,000 μg/kg, about 3000 μg/kg, about 4000 μg/kg, about 5000 μg/kg, about 6000 μg/kg, about 7000 μg/kg, about 8000 μg/kg, about 9000 μg/kg, about 10 mg/kg, about 20 mg/kg, about 30 mg/kg, about 40 mg/kg, about 50 mg/kg, about 60 mg/kg, about 70 mg/kg, about 80 mg/kg about 90 mg/kg, about 100 mg/kg, about 200 mg/kg, about 300 mg/kg, about 400 mg/kg, about 500 mg/kg, about 600 mg/kg, about 700 mg/kg, about 800 mg/kg, about 900 mg/kg, or about 1000 mg/kg of an antibody of the present disclosure.
In some embodiments, the period of time that an antibody of the present disclosure is administered to the individual is any suitable period as determined by the stage of the disease, the patient's medical history and the attending physician's discretion. Examples of such suitable periods include, but are not limited to, at least about 3 months, at least about 4 months, at least about 5 months, at least about 6 months, at least about 7 months, at least about 8 months, at least about 9 months, at least about 10 months, at least about 11 months, at least about 12 months, at least about 13 months, at least about 14 months, at least about 15 months, at least about 16 months, at least about 17 months, at least about 18 months, at least about 19 months, at least about 20 months, at least about 21 months, at least about 22 months, at least about 23 months, or at least about 24 months or longer. In particular aspects, the treatment period is continued for longer than 24 months, if desired, such as for 30 months, 31 months, 32 months, 33 months, 34 months, 35 months, 36 months, or longer than 36 months. In some embodiments, the period is 6 months, 1 year or 2 years. In another embodiment, the period of time of dosing for any of the methods described herein is for at least about 2 weeks, at least about 4 weeks, at least about 8 weeks, at least about 16 weeks, at least about 17 weeks, at least about 18 weeks, at least about 19 weeks, at least about 20 weeks, at least about 24 weeks, at least about 28 weeks, at least about 32 weeks, at least about 36 weeks, at least about 40 weeks, at least about 44 weeks, at least about 48 weeks, at least about 52 weeks, at least about 60 weeks, at least about 68 weeks, at least about 72 weeks, at least about 80 weeks, at least about 88 weeks, at least about 96 weeks, or at least about 104 weeks.
EXAMPLESThe present disclosure will be more fully understood by reference to the following examples. The examples should not, however, be construed as limiting the scope of the present disclosure. It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims.
Example 1: Identification of Antibodies with Novel Binding Specificities to SIRP-α ProteinsMethods
Antibody Production
The following proteins were used for immunization. Each includes a human or mouse SIRP-α peptide fused to a modified Fc region (either a human IgG4 Fc with a hinge region containing an S228P mutation, or an L234A/L235A/G237A/N297A human IgG1 Fc designated as IgG1_AAA_N297A) for increased immunogenicity.
The above proteins were used to immunize wild-type chickens, SynVH chickens which are transgenic chickens containing VH from human and VL from chicken, or chickens with fully human “HuMAB” immunoglobulin loci (Crystal Bioscience; see, e.g., WO2012162422, WO2011019844, and WO2013059159). Chickens were immunized with varied schedules having alternating doses of antigen. An exemplary immunization schedule is as follows: initial immunization with 100 μg dose of antigen having the sequence of SEQ ID NO:1 at week 1, boost of 100 μg of antigen having the sequence of SEQ ID NO: 2 at week 3, draw at week 4, boost with 50 μg dose of antigen having the sequence of SEQ ID NO: 1 at week 5, draw at week 6, boost with 50 μg of antigen having the sequence of SEQ ID NO: 2 at week 7, and draw at week 8. Additional descriptions of chicken immunization may be found, e.g., in Mettler Izquierdo, S. et al. (2016) Microscopy (Oxf) 1-16.
Compared with the mammalian SIRP-α sequences, the sequence of chicken SIPRα was found to be significantly more divergent. Without wishing to be bound to theory, it was thought that the divergence between mammalian and chicken SIRP-α sequences would provide unique opportunities to generate antibodies that cross-react across multiple mammalian SIRP-α proteins. For example, it may be difficult to generate anti-SIRP-α antibodies that cross-react with the murine sequence from a mouse host due to immune tolerance. Moreover, the greater divergence between the chicken and mammalian immune systems may lead to a greater diversity in antibody production.
Without wishing to be bound to theory, it is thought that antibodies with cross-reactive binding among human, cynomologus, and/or murine proteins may allow for characterization of antibodies in both animal models and clinical testing. Antibodies with isoform- and/or variant-specific binding may be useful for personalized medicine approaches to specific human populations and/or studies on specific variants of interest.
Determination of Koff
Binding of the antibody clones to various SIRP proteins was determined using surface plasmon resonance (SPR) detection on a ProteOn XPR36 instrument (Bio-Rad, Hercules, Calif.) using phosphate buffered saline (PBS, pH 7.4) supplemented with 0.01% Tween-20 (PBST) as running buffer. The pre-filtered media containing the secreted antibodies was used directly for the assay. First, anti-Human IgG Fc (BR-1008-39, GE Healthcare) was amine-coupled onto a GLC sensor chip to generate the capture surfaces for the antibodies. About 4000 RU per flow cell of immobilized anti-human IgG Fc is achieved. Each clone is screened using the same method as follows. The SIRP analytes used for the screen were SIRP-α from various species (human v1, human v2, cynomolgus, mouse 129, BL6, BALBc, NOD), human SIRP-β, and human SIRP-γ; SEQ ID NOs:5, 6, 11, 7, 9, 10, 8, 13, and 15, respectively.
˜5-10 uL of pre-filtered media in 10 mM sodium acetate buffer (pH4.5) was injected for 2 mins at 30 ul/min, followed by buffer flow for 1 min at 100 uL/min. SIRP analyte (100 nM) was injected for 1 min at 100 uL/min, followed by a dissociation cycle of 10 mins. Regeneration of the chip surface was accomplished by flowing 3M Magnesium Chloride for 1 min at 25 uL/min in both orientations, followed by buffer flow for 1 min at 100 uL/min. Biosensor data were double-referenced by subtracting the interspot data (containing no immobilized anti-human IgG Fc) from the reaction spot data (immobilized anti-human IgG Fc) and then subtracting the response of a buffer “blank” analyte injection from that of an analyte injection. Binding was fitted using a 1:1 Langmuir and Koff (1/S) values calculated. All SPR assays were performed at 25° C.
Determination of KD
The interactions of anti-SIRPα antibodies with SIRPα from various species (human v1, human v2, cynomolgus, mouse 129, BL6, BALBc, NOD), SIRPβ and SIRPγ were analyzed using two methods, direct immobilization of the antibodies (via GLC chip) or capture via biotinylated Protein A (via NLC chip), according to the following protocols. All experiments were performed at 25° C. using a SPR-based ProteOn XPR36 biosensor (BioRad, Inc, Hercules, Calif.) equipped with GLC or NLC sensor chips. Antibodies were expressed using FreeStyle™ 293-FS cells (Thermo Fisher). Purification was carried out by standard Protein A affinity column chromatography and eluted antibodies were stored in PBS buffer.
The running buffer was PBS pH 7.4 with 0.01% Tween-20 (PBST+). All analytes were used at their nominal concentrations as determined by A280 Absorbance and using their molar calculated extinction coefficient. Analytes were injected in a “one-shot” kinetic mode as described elsewhere (see, e.g., Bravman, T. et al. (2006)Anal. Biochem. 358:281-288).
For the method using GLC chip, the analytes were injected and flowed over anti-SIRPα antibodies immobilized (˜1000 RUs) on GLC chips using Proteon Amine Coupling Kit. For the immobilization step, GLC chip was activated with EDAC/Sulpho-NHS 1:1 (Biorad) diluted 1/100 for 300 s at 25 μL/min. Anti-SIRPα antibodies were diluted to 80 nM concentration in 10 mM sodium acetate buffer pH 4.5 and immobilized to the chip at 30 μL/min for 50 s. Chip was inactivated with ethanolamine for 300 s at 25 μL/min. The analytes (e.g., SIRP-α from different species, SIRP-β, SIRP-γ) were injected in a “one-shot” kinetic mode at nominal concentrations of 100, 33, 11, 3.7, 1.2 and 0 nM. Association times were monitored for 90 s at 100 μL/min, and dissociation times were monitored for 1200 s. The surfaces were regenerated with a 2:1 v/v blend of Pierce IgG elution buffer/4M NaCl.
Alternatively, KD determination was performed using antibody capture via an NLC chip. In this case, 15 ug/mL biotinylated protein A (Thermofisher) was injected at 30 uL/min for 120 s over the NLC chip to obtain an immobilization response of ˜1000-1200 RUs. Next, anti-SIRPα antibodies (˜160 nM) were injected for 80 s at 30 uL/min. The analytes (SIRPα from different species, SIRP-β and SIPR-γ) were subsequently injected in a “one-shot” kinetic mode at nominal concentrations of 100, 33, 11, 3.7, 1.2 and 0 nM. Association times were monitored for 60 s at 25 μL/min, and dissociation times were monitored for 120 s. The surfaces were regenerated with a 2:1 v/v blend of Pierce IgG elution buffer/4M NaCl.
Biosensor data were double-referenced by subtracting the interspot data (containing no immobilized protein) from the reaction spot data (immobilized protein) and then subtracting the response of a buffer “blank” analyte injection from that of an analyte injection. Double-referenced data were fit globally to a simple Langmuir model and the KD value was calculated from the ratio of the apparent kinetic rate constants (KD=kd/ka).
Results
The binding kinetics of various antibody clones to selected mouse SIRP-α proteins were determined. Mouse proteins that were tested include BALBc (SEQ ID NO: 10), BL6 (SEQ ID NO:9), NOD (SEQ ID NO:8), and m129 (SEQ ID NO:7) SIRP-α proteins. The results are summarized in Tables B-E below. Variable domain sequences for AB21 and AB25 are shown in Table J1.
As used herein, antibody clones are referred to by clone ID number. In addition, the notation “S[clone number]” refers to an sc-Fv-Fc format; the notation “AB[clone number]” refers to a full IgG antibody format; the notation “AB[clone number]b” refers to a mouse IgG1 N297A format; and “AB[clone number]c” refers to a mouse IgG2a format.
These results demonstrate that the AB21 and AB25 antibody clones bound to all four mouse SIRP-α proteins, making these antibodies suitable for characterization in in vivo mouse models.
Example 2: Functional Properties of Anti-SIRP-α AntibodiesThe previous Example describes the identification and characterization of anti-SIRP-α antibodies. These antibodies were next examined in animal models to explore SIRP-α's biological effects on tumor growth.
As noted above, antibody clones labeled as “b” were tested as full-length mouse IgG1 antibodies with an N297A mutation. Antibody clones labeled as “c” were tested as full-length mouse IgG2a antibodies.
Methods
In Vivo Anti-Tumor Activity
For the MC38 syngeneic mouse colon carcinoma model, MC38 cells were implanted subcutaneously in C57BL/6 mice and randomized into groups (8-10 mice/group). Treatment groups included vehicle (PBS), AB25b, AB25c, and AB27b. All anti-SIRPα antibodies had a mouse IgG1 Fc region bearing an N297A mutation except for AB25c, which had a mouse IgG2a. Treatment was initiated when tumors were an average of 60-65 mm3, day 7 post implant. Mice were dosed intraperitoneally (IP) at 10 mg/kg twice a week for three weeks for anti-SIRPα. Animals were sacrificed when tumors reached a volume of ˜2000 mm3.
Results
The in vivo anti-tumor effects of various anti-SIRP-α antibodies were assayed in a syngeneic mouse colon carcinoma model. The anti-tumor activities of blocking anti-SIRP-α antibodies AB25b, AB25c, and AB27b were examined in an MC38 syngeneic mouse colon carcinoma model to assess their single agent activities. The blocking anti-SIRP-α antibodies AB25b, AB25c, and AB27b delayed tumor formation at 10 mg/kg as compared to vehicle alone (
These results demonstrate the efficacy of anti-SIRP-α antibody treatment in inhibiting tumor growth in vivo. Blocking anti-SIRP-α antibodies were found to block in vivo tumor growth.
Example 3: Humanization of Anti-SIRP-α AntibodiesThe Examples above describe the generation and characterization of anti-SIRP-α antibodies having a fully human heavy chain and a chicken light chain. In order to humanize the chicken-derived light chains, chicken HVRs of these antibodies were grafted onto various human lambda light chain frameworks.
Methods
Humanization
Antibodies were humanized using standard techniques. For measuring production yield, equal volume of Expi293 cultures expressing anti-SIRPα antibodies were purified by Protein A affinity chromatography. After buffer exchange into PBS, the protein concentration was determined by A280 and expressed in mg/mL.
Results
In order to design humanized light chains, each chicken light chain sequence was aligned to the closest human germline framework by IgBLAST (NCBI). Using this analysis, the closest match to the chicken lambda light chain framework is human IGLV3 (see SEQ ID NOs:27-30).
In another approach, a literature search was undertaken to determine the optimal human lambda light chain framework sequences to pair with a human VH3 sequences (the human heavy chain used for these antibodies). Based on these analyses, it was thought that human VH3 would pair well with human IGLV1 and IGLV2. See Glanville, J. et al. (2009) Proc. Natl. Acad. Sci. 106:20216-20221; Lloyd, C. et al. (2009) Protein Eng. Des. Sel. 22:159-168; and Jayaram, N. et al. (2012) Protein Eng. Des. Sel. 25:523-529.
Therefore, six humanized light chains were created: Hum1 (AB25 HVRs+human IGLV3 framework; SEQ ID NO:25), Hum2 (AB25 HVRs+human IGLV1 framework), Hum3 (AB66 HVRs+human IGLV3 framework), Hum4 (AB66 HVRs+human IGLV1 framework), Hum5 (AB25 HVRs+human IGLV2 framework), and Hum6 (AB21 HVRs+human IGLV1 framework).
Each of the 6 humanized light chains was paired with the AB21 heavy chain. Antibodies were expressed as described above. Surprisingly, human IGLV1 framework sequences resulted in decreased antibody expression regardless of the heavy chain. This refers to the heavy chain pairings with Hum2, Hum4 and Hum6. The results are summarized in
Selected antibodies were also characterized for binding to a variety of SIRP proteins, e.g., to human SIRP-α v1 (SEQ ID NO:5), human SIRP-α v2 (SEQ ID NO:6), cynomolgus SIRP-α (SEQ ID NO: 11), mouse BALB/c SIRP-α (SEQ ID NO:10), and human SIRP-γ (SEQ ID NO: 15). These data are also summarized in
Additional VL domains Hum9 and Hum8 were generated based on the Hum1 VL domain. Compared to Hum1, Hum9 contains 4 amino acid substitutions near or in HVR-L1 and -L2 that increase the humanness of the light chain to greater than or equal to 85% identity to human light chain sequence. Compared to Hum1, Hum8 contains 5 amino acid substitutions respectively near or in HVR-L1 and -L2 that increase the humanness of the light chain to greater than or equal to 85% identity to human light chain sequence. Hum1, Hum8 and Hum9 VLs when paired with heavy chain VH domain all_mut_AB21 (carrying germline mutations; SEQ ID NO:26) produced anti-SIRP-α antibodies that bind to human SIRP-α v1 with affinity equal or better than 10 pM (Table M).
Example 4: Induction of Phagocytosis and Dendritic Cell Activation by Anti-SIRP-α AntibodiesVarious anti-SIRP-α antibodies were next examined in phagocytosis and dendritic cell activation assays.
Methods
Tumor Cell Line Culturing
DLD-1 (human colorectal adenocarcinoma) cells were maintained in growth medium comprised of RPMI (Gibco) supplemented with 10 percent heat-inactivated Fetal Bovine Serum (Gibco), one percent penicillin/streptomycin (Gibco), and one percent Glutamax (Gibco).
Derivation and Culture of Human Monocyte-Derived Macrophages
Trima residuals were received from Blood Centers of the Pacific and diluted 1:4 with Phosphate Buffered Saline (PBS, Gibco). Diluted blood was split into four tubes and underlayed with 20 ml Ficoll-Paque Plus (GE Healthcare). Tubes were centrifuged for 30 minutes at 400×g. PBMCs were collected from the interface and resuspended in FACS buffer (PBS with 0.5 percent Bovine Serum Albumin (Gibco)). CD14+ monocytes were purified by negative selection using the Monocyte Isolation Kit II (Miltenyi Biotec) and LS columns (Miltenyi Biotec) according to the manufacturer's protocol.
For nonpolarized macrophages, CD14+ monocytes were seeded into 15 cm tissue culture plates (Corning) at 10 million cells per dish in 25 ml IMDM (Gibco) supplemented with 10 percent human AB serum (Corning), one percent penicillin/streptomycin, and one percent Glutamax. Cells were cultured for seven to ten days.
For M2 polarized macrophages, CD14+ monocytes were seeded into 15 cm tissue culture plates (Corning) at 6 million cells per dish in 25 ml RPMI(Gibco) supplemented with 10 fetal bovine serum (Thermo Fisher), one percent penicillin/streptomycin, and one percent Glutamax, and 50 ng/ml M-CSF (Miltenyi). Cells were cultured for seven to ten days.
In Vitro Phagocytosis Assays
DLD-1 cells were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TrypLE Select (Gibco) for 10 minutes at 37° C. Cells were centrifuged, washed in PBS, and resuspended in medium. Cells were labeled with the Celltrace CFSE Cell Proliferation kit (Thermo Fisher) according to the manufacturer's instructions and resuspended in IMDM. Macrophages were detached from culture plates by washing twice with 20 ml PBS and incubation in 10 ml TrypLE Select for 20 minutes at 37° C. Cells were removed with a cell scraper (Corning), washed in PBS, and resuspended in IMDM.
Phagocytosis assays were assembled in ultra-low attachment U-bottom 96 well plates (Corning) containing 100,000 DLD-1 cells, 50,000 macrophages, five-fold serial dilutions of anti-SIRP-α antibody from 100 nM to 6.4 pM, and cetuximab (Absolute Antibody) at 1 or 0.01 ug/ml or control antibody of the same isotype (Southern Biotech). Plates were incubated two hours at 37° C. in a humidified incubator with 5 percent carbon dioxide. Cells were pelleted by centrifugation for five minutes at 400×g and washed in 250 μl FACS buffer. Macrophages were stained on ice for 15 minutes in 50 μl FACS buffer containing 10 μl human FcR Blocking Reagent (Miltenyi Biotec), 0.5 μl anti-CD33 BV421 (Biolegend), and 0.5 μl anti-CD206 APC-Cy7 (Biolegend). Cells were washed in 200 μl FACS buffer, washed in 250 μl PBS, and stained on ice for 30 minutes in 50 μl Fixable Viability Dye eFluor 506 (ebioscience) diluted 1:1000 in PBS. Cells were washed twice in 250 μl FACS buffer and fixed for 30 minutes on ice in 75 μl Cytofix (BD Biosciences). Cells were washed in 175 μl FACS buffer and resuspended in 75 μl FACS buffer. Cells were analyzed on a FACS Canto II (BD Biosciences), with subsequent data analysis by Flowjo 10.7 (Treestar). Dead cells were excluded by gating on the e506-negative population. Macrophages that had phagocytosed tumor cells were identified as cells positive for CD33, CD206, and CFSE.
Dendritic Cell Activation Assays
Balb/c mice (n=3/group) were intravenously injected with a human IgG1 control, various anti-SIRP-α antibodies, mouse IgG control, or vehicle (PBS) at 10 mg/kg. Five hours post injection, spleens were harvested and processed into single cell suspension by mechanical dissociation. Activation marker CD86, MHCII and CCR7 level on CD4+ splenic dendritic cells was measured by flow cytometry.
Results
Humanized antibodies described above were tested for their effects on phagocytosis of EGFR(+) DLD-1 cells by M2 macrophages in combination with the anti-EGFR antibody cetuximab (
Next, various anti-SIRP-α antibodies were examined for their effects on in vivo dendritic cell activation (
Methods
In Vivo Anti-Tumor Activity
For the CT26 syngeneic mouse colon carcinoma model, CT26 cells were implanted subcutaneously in BALB/c mice and randomized into groups (8-9 mice/group). Treatment groups included vehicle (PBS), AB25b, anti-PD-L1, and AB25b/anti-PD-L1. Anti-PD-L1 is generated by fusing the VH and VL domain of Atezolizumab with mouse IgG1 Fc region bearing an N297A mutation. All anti-SIRP-α antibodies also have a mouse IgG1 Fc region bearing an N297A mutation. Treatment was initiated when tumors were an average of 75-80 mm3, day 7 or 8 post implant. Mice were dosed intraperitoneally (IP) at 3 mg/kg or 10 mg/kg twice a week for three weeks for anti-SIRPα antibodies and three doses at 3 mg/kg, five days apart for anti-PD-L1. Animals were sacrificed when tumors reached a volume of ˜2000 mm3.
For the MC38 syngeneic mouse colon carcinoma model, MC38 cells were implanted subcutaneously in C57BL/6 mice and randomized into groups (8-10 mice/group). Treatment groups included vehicle (PBS), AB25b, anti-PD1 (clone RMP1-14, BioXCell), and AB25b/anti-PD1. All anti-SIRPα antibodies had a murine IgG1 Fc region bearing an N297A mutation except for AB25c. Treatment was initiated when tumors were an average of 60-65 mm3, day 7 post implant. Mice were dosed intraperitoneally (IP) at 10 mg/kg twice a week for three weeks for anti-SIRPα and three doses at 2 mg/kg for anti-PD1. Animals were sacrificed when tumors reached a volume of ˜2000 mm3.
Results
Anti-tumor activity of the blocking AB25b anti-SIRP-α antibody was tested alone and in combination with an anti-PD-L1 antibody in the CT26 syngeneic mouse colon carcinoma model. As shown in
Next, the anti-tumor activities of the AB25b anti-SIRP-α antibody were tested alone and in combination with an anti-PD-1 antibody in the MC38 syngeneic mouse colon carcinoma model. As shown in
A summary of antibodies described herein and their properties is provided in Table K. Additional binding data are provided in Tables L and N.
Example 6: Novel Anti-SIRP-α Antibody Light Chains Engineered to Remove Potential Liability Hot SpotsDue to the properties of blocking anti-SIRP-α antibodies AB21 and AB25 described above, an antibody comprising the variant AB21 VH domain (SEQ ID NO:26) and the humanized Hum1 VL domain (SEQ ID NO:25) was selected for analysis. The sequence of antibody light chains comprising the Hum1 humanized variable light chain domain described above was analyzed for potential liability hot spots, e.g., deamidation or glycation sites.
Protein deamidation is a post-translational modification in which the side chain amide of a glutamine or asparagine residue is converted into an acidic carboxylate group. Non-enzymatic deamidation of asparagine is faster than that of glutamine, and hence presents a higher physiological significance and greater potential liability risk in the manufacturing and storage of polypeptide-based therapeutics.
Glycation refers to the non-enzymatic glycosylation or Mallard reaction of proteins, which primarily occurs at the e-amino group of lysine, or a free amino group. The side chains of arginine, histidine, tryptophan, and cysteine residues represent additional potential glycation sites. Amadori-modified proteins are an early glycation product and undergo further reactions that give rise to advance glycation end products (AGEs).
The analyses of the Hum1-containing light chains identified sites where engineering may be desired to limit risk due, e.g., to modifications that may occur during manufacturing, storage, and/or drug development of anti-SIRP-α antibodies. This Example describes the testing and construction of Hum1 variants that remove these potential liabilities.
Methods
Peptide Mapping Analysis
For trypsin digests, samples were diluted in 6M Guanidine HCl and 1 mM EDTA. 10 mM DTT and 10 mM iodoacetamide were used to reduce and alkylate the samples, respectively. The buffer was than exchanged to 0.1M Tris-HCl and samples were incubated for 4 hours for digestion. For chymotrypsin digests, samples were diluted in 100 mM ammonium bicarbonate. 1% progenta anionic acid labile surfactant was added. Again, 10 mM DTT and 10 mM iodoacetamide were used to reduce and alkylate the samples respectively. Samples were incubated overnight.
The mass spectral data were acquired by Waters Acuity UHPLC in line with a Q Exactive Hybrid Quadrupole-Orbitrap (Thermo Scientific, San Jose Calif.). Column used is Agilent AdvanceBio Peptide Mapping (C18, 1×150 mm ID). Reversed phase solvents were used and the gradient used was 2% to 40% buffer over 41 minutes. Full MS scan range was 250-2000 m/z. Peptide searches and relative abundance was analysed using Byonic and Byologic from Protein Metrics. Precursor Mass Accuracy of 10 ppm and fragment mass accuracy of 20 ppm was adopted.
Determination of KD
The interactions of anti-SIRPα antibodies with SIPRa from various species (human v1, human v2, cynomolgus, mouse 129, BL6, BALBc, NOD), SIRPb and SIRPg were analyzed using direct immobilization of the antibodies. All experiments were performed at 25° C. using a SPR-based ProteOn XPR36 biosensor (BioRad, Inc, Hercules, Calif.) equipped with GLC sensor chips. Antibodies were expressed using FreeStyle™ 293-FS cells (Thermo Fisher). Purification was carried out by standard Protein A affinity column chromatography and eluted antibodies were stored in PBS buffer.
The running buffer was PBS pH 7.4 with 0.01% Tween-20 (PBST+). All analytes were used at their nominal concentrations as determined by A280 Absorbance and using their molar calculated extinction coefficient. Analytes were injected in a “one-shot” kinetic mode as described elsewhere (see, e.g., Bravman, T. et al. (2006)Anal. Biochem. 358:281-288).
For immobilization using GLC chip, the analytes were injected and flowed over anti-SIRP-α antibodies immobilized (˜1000 RUs) on GLC chips using Proteon Amine Coupling Kit. For the immobilization step, GLC chip was activated with EDAC/Sulpho-NHS 1:1 (Biorad) diluted 1/100 for 300 s at 25 μL/min. Anti-SIRP-α antibodies were diluted to 80 nM concentration in 10 mM sodium acetate buffer pH 4.5 and immobilized to the chip at 30 μL/min for 50 s. Chip was inactivated with ethanolamine for 300 s at 25 μL/min. The analytes (e.g., SIRP-α from different species, SIRP-β, SIRP-γ) were injected in a “one-shot” kinetic mode at nominal concentrations of 100, 33, 11, 3.7, 1.2 and 0 nM. Association times were monitored for 90 s at 100 uL/min, and dissociation times were monitored for 1200 s. The surfaces were regenerated with a 2:1 v/v blend of Pierce IgG elution buffer/4M NaCl.
Biosensor data were double-referenced by subtracting the interspot data (containing no immobilized protein) from the reaction spot data (immobilized protein) and then subtracting the response of a buffer “blank” analyte injection from that of an analyte injection. Double-referenced data were fit globally to a simple Langmuir model and the KD value was calculated from the ratio of the apparent kinetic rate constants (KD=kd/ka).
Results
An anti-SIRP-α antibody (antibody PC336) comprising a light chain (SEQ ID NO:47) with the Hum1 VL domain (SEQ ID NO:25) and a human IGLC1 lambda constant domain (SEQ ID NO:37), and a heavy chain (SEQ ID NO:61) with the AB21 MutAll VH domain (SEQ ID NO:26) and a constant region (SEQ ID NO:34) comprising a human IgG2Da Fc region (comprising A330S and P331S mutations, amino acid position numbering according to EU) was carried out by trypsin and chymotrypsin digestion as described above. Overall sequence coverage of heavy chain was 100% (444 out of 444 amino acids), and light chain was 98.6% (211 out of 214 amino acids). Variable domain and full chain sequences for all antibodies are provided in Tables J1 and J2.
These analyses revealed three light chain residues that were modified by glycation. Table F shows the glycation observed in the light chain. A total of 3 glycated peptides were isolated. Of these, it was observed that ˜48% of the peptide with the sequence of SEQ ID NO:65 was glycated. The glycation modification was assigned to K104 (numbering based on sequential numbering of amino acids for light chain, not Kabat). FIG. 7 shows the total extracted ion chromatography, area under the curve (XIC, AUC) of the glycated versus unmodified form of peptides of antibody PC336.
Peptide mapping of a second anti-SIRP-α antibody (antibody PC333) comprising the same light chain (SEQ ID NO:47) and a heavy chain (SEQ ID NO:58) with the AB21 MutAll VH domain (SEQ ID NO:26) and a constant region (SEQ ID NO:31) comprising a wild-type human IgG1 Fc region was also carried out. Similar to what was observed for antibody 336, the lysine residue at position 104 of the light chain was also observed to be glycated in this antibody (˜34% of peptides; see Table G).
Peptide mapping also revealed the presence of deamidated residues in the Hum1-containing light chain of antibody PC301, which comprises a light chain (SEQ ID NO:63) with the Hum1 VL domain (SEQ ID NO:25) and a human IGLC2 lambda constant domain (SEQ ID NO:38), and a heavy chain (SEQ ID NO:59) with the AB21 MutAll VH domain (SEQ ID NO:26) and a constant region (SEQ ID NO:32) comprising a human IgG1 AAA N297A Fc region (comprising L234A, L235A, G237A, and N297A mutations, amino acid position numbering according to EU). As shown in
Post-translational modifications such as deamidation and glycation are undesirable for drug development. This is due to potential issues with product heterogeneity during drug manufacture. Therefore, it is desirable to limit modifications even though these modifications did not appear to affect binding affinities of the anti-SIRP-α antibodies.
To remove the potentially deamidated residues (N171/N172), 4 deamidation site variants were first tested. Antibody PC334 contained the original Hum1 VL+IGLC1 light chain (SEQ ID NO:47). Antibody PC338 contained a light chain with the original Hum1 VL domain and the N172D variant constant domain (SEQ ID NO:48). Antibody PC339 contained a light chain with the original Hum1 VL domain and the N171D variant constant domain (SEQ ID NO:49). Antibody PC340 contained a light chain with the original Hum1 VL domain and the N171D,N172S deamidation site variant constant domain (SEQ ID NO:50). Antibody PC341 contained a light chain with the original Hum1 VL domain and the N171S,N172D deamidation site variant constant domain (SEQ ID NO:51). All antibodies had a heavy chain comprising the AB21HC mut all VH domain (SEQ ID NO:26) and a constant region (SEQ ID NO:32) comprising the human IgG1 AAA N297A Fc region (full heavy chain sequence as shown in SEQ ID NO:59). The results of the binding assay are shown in Table H. All four mutants bound with equivalent affinity to human SIRP-α v1, as compared with the wildtype antibody.
Next, the glycation site variants were tested. The region of the Hum1 VL domain with the glycation site is shown in
Antibody PC334 contained the original Hum1 VL+IGLC1 light chain (SEQ ID NO:47). Antibody PC341 contained a light chain with the original Hum1 VL domain and the N171S,N172D (abbreviated “SD”) deamidation site variant constant domain (SEQ ID NO:51). Antibodies PC345, PC346, and PC347 also contained the SD deamidation site variant constant domain, but included the Hum1 variant 1, 2, and 3 VL domains, respectively (SEQ ID NOs:53, 55, and 57, respectively). All antibodies had a heavy chain comprising the AB21HC mut all VH domain (SEQ ID NO:26) and a constant region (SEQ ID NO:32) comprising the human IgG1 AAA N297A Fc region (full heavy chain sequence as shown in SEQ ID NO:59). The results of the binding assay are shown in Table I1.
As shown in Tables H and I1, all antibodies bound with equivalent affinity to human SIRP-α v1, as compared with the wildtype antibody. These results demonstrate that the variants engineered to remove deamidation and glycation liability hot spots had no effect on binding to SIRP-α.
Based on the above results, 6 preferred light chain variants were generated, and the alignment of the respective sequences (SEQ ID NOs:52-57) are shown in
Anti-SIRP-α antibodies with different Fc regions and light chain constant domains were tested for their effect on phagocytosis in order to understand how these sequences impact the biological properties of anti-SIRP-α antibodies.
Methods
For functional depletion of dendritic cells, peripheral blood mononuclear cells (PBMC) were isolated from Trima residuals of healthy individuals with Ficoll-Paque Plus. 500,000 PBMCs were incubated in u-bottom 96 well plates (coming) with anti-SIRP at a concentration of 10 ug/mL for 48 hrs at 37 C. For flow cytometry, cells were incubated in human FcR blocking reagent and stained with a cocktail of fluorochrome-labeled antibodies against lin—(CD3, CD14, CD16, CD19, CD56) and HLADR. Fixable viability dye was used to identify live cells. After staining, cells were washed and fixed with 0.5% paraformaldehyde in PBS. Prior to acquisition, absolute counting beads were added and samples were acquired with Canto II flow cytometer and analyzed using FlowJo software.
Phagocytosis was measured using the in vitro assay described in Example 4.
Results
Humanized anti-SIRP-α antibodies with different Fc regions were tested for their effects on phagocytosis of EGFR(+) DLD-1 cells by M2 macrophages in combination with the anti-EGFR antibody cetuximab (
Next, anti-SIRP-α antibodies with different Fc regions (or corresponding isotype controls) were tested for their ability to deplete different cell types from donor PBMCs. All antibodies had the light chain sequence of SEQ ID NO:55 and the VH domain sequence of SEQ ID NO:26. As shown in
Anti-SIRP-α antibodies were also tested for binding affinity to human SIRP-α v1; NOD, C57BL/6, and BALBc mouse SIRP-α; human SIRP-β; and human SIRP-γ. Antibodies tested included the following heavy and light chains: PC301: light chain of SEQ ID NO:63 and heavy chain of SEQ ID NO:59; PC334: light chain of SEQ ID NO:47 and heavy chain of SEQ ID NO:59; and PC367: light chain of SEQ ID NO:55 and heavy chain of SEQ ID NO:129.
Human IgG2 antibodies are thought to exist in disulfide-based isoforms (A, B, and AB), and the introduction of C232S or C233S mutations into human IgG2 constant regions has been reported to reduce heterogeneity caused by disulfide shuffling (Lightle, S. et al. (2010) Protein Sci. 19:753-762). Each of these mutations is thought to force IgG2 antibodies into isoform A. In addition, the lambda light chain is also thought to promote isoform A abundance. Anti-SIRP-α antibodies with wild-type IgG2 (
The effect of the light chain constant domain on the ability of anti-SIRP-α antibodies to enhance phagocytosis was also examined. All antibodies had the VH domain sequence of SEQ ID NO:26 and the VL domain sequence of SEQ ID NO: 18. Anti-SIRP-α antibodies with lambda and kappa light chains showed similar enhancement of phagocytosis, both in the context of a wild-type IgG2 Fc- (
Although the foregoing disclosure has been described in some detail by way of illustration and example for purposes of clarity of understanding, the descriptions and examples should not be construed as limiting the scope of the present disclosure. The disclosures of all patent and scientific literature cited herein are expressly incorporated in their entirety by reference.
Claims
1. An isolated antibody that binds an extracellular domain of a human SIRP-α polypeptide, wherein the antibody comprises:
- (a) a heavy chain comprising a heavy chain variable (VH) domain that comprises the amino acid sequence of SEQ ID NO:26; and
- (b) a light chain comprising a light chain variable (VL) domain that comprises an amino acid sequence according to the formula SYELTQPPSVSVSPGQTARITCSGGSYSSYYYAWYQQKPGQAPVTLIYSDDKRPSNIPER FSGSSSGTTVTLTISGVQAEDEADYYCGGYDQSSYTNPFGX1GTX2X3TVL (SEQ ID NO:71), wherein X1 is G or T; X2 is K, Q, or R; and X3 is L or V, and wherein the VL domain does not comprise the sequence of SEQ ID NO:25.
2. The antibody of claim 1, wherein the VL domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:39-41.
3. The antibody of claim 1, wherein the light chain further comprises a light chain constant (CL) domain sequence that comprises an amino acid sequence according to the formula GQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPS KQSX4X5KYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS (SEQ ID NO:72), wherein X4X5 is ND, DN, DS, or SD.
4. The antibody of claim 1, wherein the light chain further comprises a light chain constant (CL) domain sequence that comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:43-46.
5. The antibody of claim 1, wherein the light chain further comprises a kappa light chain constant (CL) domain.
6. The antibody of claim 5, wherein the light chain comprises the amino acid sequence of SEQ ID NO:36.
7. The antibody of claim 1, wherein the light chain further comprises a lambda light chain constant (CL) domain.
8. The antibody of claim 7, wherein the light chain comprises the amino acid sequence of SEQ ID NO:37 or SEQ ID NO:38.
9. The antibody of claim 1, wherein the light chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:48-57.
10. The antibody of claim 1, wherein the antibody is a scFv-Fc antibody.
11. The antibody of claim 1, wherein the antibody is a monoclonal antibody.
12. The antibody of claim 1, wherein the heavy chain comprises a heavy chain constant domain that comprises an Fc region.
13. The antibody of claim 12, wherein the Fc region is a human Fc region selected from the group consisting of an IgG1 Fc region, an IgG2 Fc region, and an IgG4 Fc region.
14. The antibody of claim 12, wherein the Fc region is a human IgG1 Fc region.
15. The antibody of claim 12, wherein the Fc region is a human IgG1 Fc region comprising L234A, L235A, and G237A substitutions, amino acid position numbering according to EU.
16. The antibody of claim 15, wherein the Fc region further comprises an N297A substitution, amino acid position numbering according to EU.
17. The antibody of claim 12, wherein the Fc region is a human IgG2 Fc region.
18. The antibody of claim 12, wherein the Fc region is a human IgG2 Fc region comprising A330S and P331S substitutions, amino acid position numbering according to EU.
19. The antibody of claim 17, wherein the Fc region comprises an N297A substitution, amino acid position numbering according to EU.
20. The antibody of claim 12, wherein the Fc region is a human IgG4 Fc region, and wherein the heavy chain comprises an S228P substitution, amino acid position numbering according to EU.
21. The antibody of claim 12, wherein the heavy chain constant domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:31-35.
22. The antibody of claim 12, wherein the heavy chain constant domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:33, 34, and 137.
23. The antibody of claim 12, wherein the heavy chain constant domain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:132-139.
24. The antibody of claim 1, wherein the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:58-62.
25. The antibody of claim 1, wherein the heavy chain comprises an amino acid sequence selected from the group consisting of SEQ ID NOs:60, 61, and 129.
26. The antibody of claim 1, wherein:
- (a) the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:52;
- (b) the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:53;
- (c) the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:54;
- (d) the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (e) the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:56; or (f) the heavy chain comprises the amino acid sequence of SEQ ID NO:62, and the light chain comprises the amino acid sequence of SEQ ID NO:57.
27. The antibody of claim 1, wherein:
- (a) the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:52;
- (b) the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:52;
- (c) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:52;
- (d) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:52;
- (e) the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:53;
- (f) the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:53;
- (g) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:53;
- (h) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:53;
- (i) the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:54;
- (j) the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:54;
- (k) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:54;
- (l) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:54;
- (m) the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (n) the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (o) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (p) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (q) the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:56;
- (r) the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:56;
- (s) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:56;
- (t) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:56;
- (u) the heavy chain comprises the amino acid sequence of SEQ ID NO:58, and the light chain comprises the amino acid sequence of SEQ ID NO:57;
- (v) the heavy chain comprises the amino acid sequence of SEQ ID NO:59, and the light chain comprises the amino acid sequence of SEQ ID NO:57;
- (w) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:57; or
- (x) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:57.
28. The antibody of claim 1, wherein:
- (a) the heavy chain comprises the amino acid sequence of SEQ ID NO:60, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (b) the heavy chain comprises the amino acid sequence of SEQ ID NO:61, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (c) the heavy chain comprises the amino acid sequence of SEQ ID NO:129, and the light chain comprises the amino acid sequence of SEQ ID NO:55;
- (d) the heavy chain comprises the amino acid sequence of SEQ ID NO:124, and the light chain comprises the amino acid sequence of SEQ ID NO:52; or
- (e) the heavy chain comprises the amino acid sequence of SEQ ID NO:124, and the light chain comprises the amino acid sequence of SEQ ID NO:55.
29. The antibody of claim 1, wherein the antibody enhances phagocytosis by a macrophage expressing a human SIRP-α polypeptide.
30. The antibody of claim 1, wherein the antibody enhances activation of a dendritic cell expressing a human SIRP-α polypeptide.
31. The antibody of claim 1, wherein the antibody inhibits in vivo growth of a tumor that expresses CD47.
32. The antibody of claim 1, wherein the antibody is conjugated to an agent.
33. The antibody of claim 1, wherein the antibody is a bispecific antibody.
34. The antibody of claim 33, wherein the antibody comprises a first antigen binding domain that binds an extracellular domain of a human SIRP-α polypeptide and a second antigen binding domain that binds an antigen expressed by a cancer cell.
35. The antibody of claim 34, wherein the antigen expressed by the cancer cell is selected from the group consisting of CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, EphA4, BCMA, PD-L1, PTK7, STEAP1, Endothelin B Receptor, mesothelin, ENPP3, SLC44A4, GNMB, nectin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin αVβ3, integrin α5β1, MET, IGF1R, TRAILR1, TRAILR2, RANKL, FAP, Tenascin, Ley, EpCAM, CEA, gpA33, PSMA, TAG72, a mucin, CAIX, EPHA3, folate receptor α, GD2, and GD3.
36. The antibody of claim 33, wherein the antibody comprises a first antigen binding domain that binds an extracellular domain of a human SIRP-α polypeptide and a second antigen binding domain that binds an antigen expressed by an immune cell.
37. The antibody of claim 36, wherein the antigen expressed by the immune cell is selected from the group consisting of BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Siglec-15, FGL-1, CD200, CD200R, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, arginase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF-βRI, TGF-βRII, c-Kit, CD244, L-selectin/CD62L, CD11b, CD11c, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS.
38. The antibody of claim 33, wherein the antibody comprises a first antigen binding domain that binds an extracellular domain of a human SIRP-α polypeptide and a second antigen binding domain that binds an antigen expressed by a natural killer (NK) cell.
39. The antibody of claim 38, wherein the antigen expressed by the NK cell is selected from the group consisting of NKR-P1A, CD94, KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94, NKG2D, CD160, CD16, NKp46, NKp30, NKp44, DNAM1, CRTAM, CD27, NTB-A, PSGL1, CD96, CD100, NKp80, SLAMF7, and CD244.
40. A method of treating or delaying progression of cancer in an individual, the method comprising administering to the individual an effective amount of the antibody of claim 1.
41. The method of claim 40, further comprising administering to the individual an effective amount of a second antibody that binds an antigen expressed by the cancer.
42. The method of claim 41, wherein the antigen expressed by the cancer is selected from the group consisting of CD19, CD20, CD22, CD30, CD33, CD38, CD52, CD56, CD70, CD74, CD79b, CD123, CD138, CS1/SLAMF7, Trop-2, 5T4, EphA4, BCMA, PTK7, STEAP1, Endothelin B Receptor, mesothelin, ENPP3, SLC44A4, GNMB, nectin 4, NaPi2b, LIV-1A, Guanylyl cyclase C, DLL3, EGFR, HER2, VEGF, VEGFR, integrin αVβ3, integrin α5β1, MET, IGF1R, TRAILR1, TRAILR2, RANKL, FAP, Tenascin, Ley, EpCAM, CEA, gpA33, PSMA, TAG72, a mucin, CAIX, EPHA3, folate receptor α, GD2, and GD3.
43. The method of claim 40, further comprising administering to the individual an effective amount of an immunotherapeutic agent.
44. The method of claim 43, wherein the immunotherapeutic agent comprises a second antibody, vaccine, oncolytic virus, adoptive cell therapy, cytokine, or small molecule agent.
45. The method of claim 44, wherein the second antibody binds to an antigen selected from the group consisting of BDCA2, BDCA4, ILT7, LILRB1, LILRB2, LILRB3, LILRB4, LILRB5, Siglec-3, Siglec-7, Siglec-9, Siglec-15, FGL-1, CD200, CD200R, CSF-1R, CD40, CD40L, CD163, CD206, DEC205, CD47, CD123, arginase, IDO, TDO, AhR, EP2, COX-2, CCR2, CCR-7, CXCR1, CX3CR1, CXCR2, CXCR3, CXCR4, CXCR7, TGF-β RI, TGF-β RII, c-Kit, CD244, L-selectin/CD62L, CD11b, CD11c, CD68, 41BB, CTLA4, PD1, PD-L1, PD-L2, TIM-3, BTLA, VISTA, LAG-3, CD28, OX40, GITR, CD137, CD27, HVEM, CCR4, CD25, CD103, KIrg1, Nrp1, CD278, Gpr83, TIGIT, CD154, CD160, TNFR2, PVRIG, DNAM, and ICOS.
46. The method of claim 45, wherein the second antibody binds to PD-1.
47. The method of claim 45, wherein the second antibody binds to PD-L1.
48. The method of claim 40, further comprising administering to the individual an effective amount of a second antibody that binds an antigen expressed by a natural killer (NK) cell.
49. The method of claim 48, wherein the antigen expressed by the NK cell is selected from the group consisting of NKR-P1A, CD94, KLRG1, KIR2DL5A, KIR2DL5B, KIR2DL1, KIR2DL2, KIR2DL3, KIR2DS2, KIR2DS3, KIR2DS4, KIR2DS5, KIR3DS1, KIR2DS1, CD94, NKG2D, CD160, CD16, NKp46, NKp30, NKp44, DNAM1, CRTAM, CD27, NTB-A, PSGL1, CD96, CD100, NKp80, SLAMF7, and CD244.
50. The method of claim 40, further comprising administering to the individual an effective amount of a chemotherapeutic agent or small molecule anti-cancer agent.
51. The method of claim 40, further comprising administering to the individual an effective amount of a targeted small molecule inhibitor.
52. The method of claim 51, wherein the targeted small molecule inhibitor is a VEGFR and/or PDGFR inhibitor, EGFR inhibitor, ALK inhibitor, CDK4/6 inhibitor, PARP inhibitor, mTOR inhibitor, KRAS inhibitor, TRK inhibitor, BCL2 inhibitor, IDH inhibitor, PI3K inhibitor, DNA damage response (DDR) inhibitor, or hypomethylation agent.
53. The method of claim 35, wherein the mucin is Mucin 1 or Mucin 16.
54. The method of claim 35, wherein the EGFR is EGFRvIII.
55. The method of claim 34, wherein the antigen expressed by the cancer cell is an WIC/peptide complex comprising a peptide from NY-ESO-1/LAGE, SSX-2, a MAGE family protein, gp100/pmel17, Melan-A/MART-1, a tyrosinase, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MUC1, PRAME, survivin, BRCA1, BRCA2, CDK4, CML66, MART-2, p53, Ras, β-catenin, TGF-βRII, HPV E6, or HPV E7.
56. The method of claim 55, wherein the MAGE family protein is MAGE-A3.
57. The method of claim 55, wherein the tyrosinase is gp75/TRP1 or TRP2.
58. The method of claim 42, wherein the mucin is Mucin 1 or Mucin 16.
59. The method of claim 42, wherein the EGFR is EGFRvIII.
60. The method of claim 36, wherein the antigen expressed by the cancer cell is an MHC/peptide complex comprising a peptide from NY-ESO-1/LAGE, SSX-2, a MAGE family protein, gp100/pmel17, Melan-A/MART-1, a tyrosinase, CEA, PSA, TAG-72, immature laminin receptor, MOK/RAGE-1, WT-1, SAP-1, BING-4, EpCAM, MUC1, PRAME, survivin, BRCA1, BRCA2, CDK4, CML66, MART-2, p53, Ras, β-catenin, TGF-βRII, HPV E6, or HPV E7.
61. The method of claim 60, wherein the MAGE family protein is MAGE-A3.
62. The method of claim 60, wherein the tyrosinase is gp75/TRP1 or TRP2.
| RE30985 | June 29, 1982 | Cartaya |
| 4560655 | December 24, 1985 | Baker |
| 4657866 | April 14, 1987 | Kumar |
| 4676980 | June 30, 1987 | Segal et al. |
| 4767704 | August 30, 1988 | Cleveland et al. |
| 4816567 | March 28, 1989 | Cabilly et al. |
| 4927762 | May 22, 1990 | Darfler |
| 5122469 | June 16, 1992 | Mather et al. |
| 5545806 | August 13, 1996 | Lonberg et al. |
| 5545807 | August 13, 1996 | Surani et al. |
| 5569825 | October 29, 1996 | Lonberg et al. |
| 5571894 | November 5, 1996 | Wels et al. |
| 5587458 | December 24, 1996 | King et al. |
| 5625126 | April 29, 1997 | Lonberg et al. |
| 5633425 | May 27, 1997 | Lonberg et al. |
| 5641870 | June 24, 1997 | Rinderknecht et al. |
| 5661016 | August 26, 1997 | Lonberg et al. |
| 5731168 | March 24, 1998 | Carter et al. |
| 5869046 | February 9, 1999 | Presta et al. |
| 6075181 | June 13, 2000 | Kucherlapati et al. |
| 6143559 | November 7, 2000 | Michael et al. |
| 6150584 | November 21, 2000 | Kucherlapati et al. |
| 6180370 | January 30, 2001 | Queen |
| 6248516 | June 19, 2001 | Winter et al. |
| 7575893 | August 18, 2009 | Simmons |
| 8088896 | January 3, 2012 | Tesar et al. |
| 8592644 | November 26, 2013 | Harriman et al. |
| 9151760 | October 6, 2015 | Weissman et al. |
| 9352037 | May 31, 2016 | van den Berg |
| 9380769 | July 5, 2016 | Leighton et al. |
| 9399682 | July 26, 2016 | Jaiswal et al. |
| 9493575 | November 15, 2016 | Jaiswal et al. |
| 9605076 | March 28, 2017 | Jaiswal et al. |
| 9611329 | April 4, 2017 | Jaiswal et al. |
| 9623079 | April 18, 2017 | Willingham et al. |
| 9624305 | April 18, 2017 | Jaiswal et al. |
| 9765143 | September 19, 2017 | Jaiswal et al. |
| 9771428 | September 26, 2017 | Weiskopf et al. |
| 9790275 | October 17, 2017 | van den Berg |
| 9920122 | March 20, 2018 | van den Berg |
| 10064925 | September 4, 2018 | Tseng et al. |
| 10081680 | September 25, 2018 | Weiskopf |
| 10184004 | January 22, 2019 | Weiskopf et al. |
| 10301387 | May 28, 2019 | Willingham et al. |
| 10329354 | June 25, 2019 | Leeper et al. |
| 10344094 | July 9, 2019 | Weissman et al. |
| 10611842 | April 7, 2020 | Liu et al. |
| 10618976 | April 14, 2020 | Weissman et al. |
| 10723803 | July 28, 2020 | Weiskopf et al. |
| 10780117 | September 22, 2020 | Weissman et al. |
| 10781256 | September 22, 2020 | Weiskopf et al. |
| 10851164 | December 1, 2020 | Van Eenennaam et al. |
| 20020114807 | August 22, 2002 | Berg et al. |
| 20030026803 | February 6, 2003 | Barclay |
| 20030054415 | March 20, 2003 | Buhring et al. |
| 20040147731 | July 29, 2004 | Parkos |
| 20040213792 | October 28, 2004 | Clemmons et al. |
| 20060263356 | November 23, 2006 | Endl et al. |
| 20080160013 | July 3, 2008 | Clemmons et al. |
| 20100215640 | August 26, 2010 | Clemmons et al. |
| 20100239578 | September 23, 2010 | Danska et al. |
| 20130189253 | July 25, 2013 | Danska et al. |
| 20140065169 | March 6, 2014 | Jaiswal et al. |
| 20140161825 | June 12, 2014 | Jaiswal et al. |
| 20140242095 | August 28, 2014 | Wang et al. |
| 20160186150 | June 30, 2016 | Deming et al. |
| 20160333093 | November 17, 2016 | Weiskopf et al. |
| 20170114134 | April 27, 2017 | Clemmons et al. |
| 20170151282 | June 1, 2017 | Discher et al. |
| 20170247464 | August 31, 2017 | Poirier et al. |
| 20180105600 | April 19, 2018 | Pons et al. |
| 20180155424 | June 7, 2018 | van den Berg |
| 20180214524 | August 2, 2018 | Weissman et al. |
| 20180244748 | August 30, 2018 | Gill et al. |
| 20180312587 | November 1, 2018 | Van Eenennaam et al. |
| 20180312600 | November 1, 2018 | Poirier et al. |
| 20190119396 | April 25, 2019 | Liu et al. |
| 20190127477 | May 2, 2019 | Poirier et al. |
| 20190134089 | May 9, 2019 | Liu et al. |
| 20190153095 | May 23, 2019 | Matozaki et al. |
| 20190233515 | August 1, 2019 | Jaiswal et al. |
| 20190275150 | September 12, 2019 | Pincetic et al. |
| 20190322986 | October 24, 2019 | Keller et al. |
| 20190359707 | November 28, 2019 | Pincetic et al. |
| 20200102387 | April 2, 2020 | Abbasian et al. |
| 20200129557 | April 30, 2020 | Shizuru et al. |
| 20200223923 | July 16, 2020 | Schnorr et al. |
| 20200262918 | August 20, 2020 | Liu et al. |
| 20200297842 | September 24, 2020 | Puro et al. |
| 20200354469 | November 12, 2020 | Weiskopf et al. |
| 2242512 | April 2016 | EP |
| 3482772 | June 2017 | EP |
| 3308641 | July 2019 | EP |
| 2931752 | August 2019 | EP |
| 3180363 | September 2019 | EP |
| 3186395 | September 2019 | EP |
| 3421601 | December 2019 | EP |
| 3043181 | April 2020 | EP |
| 3209691 | July 2020 | EP |
| 3209769 | August 2020 | EP |
| WO-1987/000195 | January 1987 | WO |
| WO-1990/003430 | April 1990 | WO |
| WO-1991/010741 | July 1991 | WO |
| WO-1993/016185 | August 1993 | WO |
| WO-1994/004690 | March 1994 | WO |
| WO-1996/033735 | October 1996 | WO |
| WO-1996/034096 | October 1996 | WO |
| WO-1997/048723 | December 1997 | WO |
| WO-1998/024893 | June 1998 | WO |
| WO-1999/040940 | August 1999 | WO |
| WO-2005/014653 | February 2005 | WO |
| WO-2009/111014 | September 2009 | WO |
| WO-2011/019844 | February 2011 | WO |
| WO-2012/162422 | November 2012 | WO |
| WO-2013/056352 | April 2013 | WO |
| WO-2013/059159 | April 2013 | WO |
| WO-2015/138600 | September 2015 | WO |
| WO-2016/063233 | April 2016 | WO |
| WO-2017/178653 | October 2017 | WO |
| WO-2018/057669 | March 2018 | WO |
| WO-2018190719 | October 2018 | WO |
| WO-2018/210793 | November 2018 | WO |
| WO-2018210795 | November 2018 | WO |
| WO-2020013170 | January 2020 | WO |
| WO-2020099653 | May 2020 | WO |
- Zhang, Jing, Su-Bee Tan, and Zhi-Gang Guo. “CD47 decline in pancreatic islet cells promotes macrophage-mediated phagocytosis in type I diabetes.” World journal of diabetes 11.6 (2020): 239. (Year: 2020).
- Janeway, Charles A. “Immunobiology: The Immune System in Health and Disease.” (2005) (Year: 2005).
- Ludwig, Ralf J., et al. “Mechanisms of autoantibody-induced pathology.” Frontiers in immunology 8 (2017): 603 (Year: 2017).
- Kipriyanov, Sergey M., and Fabrice Le Gall. “Generation and production of engineered antibodies.” Molecular biotechnology 26.1 (2004): 39-60. (Year: 2004).
- Janeway, A. C., et al. “Immunobiology: the immune system in health and disease. London.” Current Biology (1997): 3:1-3:11. (Year: 1997).
- Araghi et al., (2014). “Flow cytometric immunophenotyping of feline bone marrow cells and haematopoietic progenitor cells using anti-human antibodies,” J. Feline Med. Surg. 16(4):265-74.
- Barclay et al., (2014). “The interaction between signal regulatory protein alpha (SIRPα) and CD47: structure, function, and therapeutic target,” Annu. Rev. Immunol., 32:25-50.
- Chin et al., (2008). “Immune intervention with monoclonal antibodies targeting CD152 (CTLA-4) for autoimmune and malignant diseases,” Chang Gung Med J., 31(1):1-15.
- George et al. (1998). “Differential effects of anti-beta2-glycoprotein I antibodies on endothelial cells and on the manifestations of experimental antiphospholipid syndrome,” Circulation, 97:900-906.
- Jiang et al., (2005). “A Novel Peptide Isolated from a Phage Display Peptide Library with Trastuzumab Can Mimic Antigen Epitope of HER-2,” J. Biol. Chem., 280(6):4656-4662.
- Krieg et al. (2005). “Functional analysis of B and T lymphocyte attenuator engagement on CD4+ and CD8+ T cells,” Journal of Immunology (Baltimore, MD. : 1950), vol. 175, No. 10, pp. 6420-6427.
- Liu et al., (2007). “Functional elements on SIRPalpha IgV domain mediate cell surface binding to CD47,” J. Mol. Biol., 365(3):680-93.
- Riemer et al., (2005). “Matching of trastuzumab (Herceptin) epitope mimics onto the surface of Her-2/neu-a new method of epitope definition,” Mol. Immunol., 42:1121-1124.
- Rudikoff et al. (1982). “Single amino acid substitution altering antigen-binding specificity,” Proc. Nat. Acad. Sci., vol. 79, pp. 1979-1983, Immunology.
- Sim et al. (2019). “Discovery of high affinity, pan-allelic, and pan-mammalian reactive antibodies against the myeloid checkpoint receptor SIRPα,” MAbs. 11(6):1036-1052.
- Winkler et al. (2000). “Changing the antigen binding specificity by single point mutations of an anti-p24 (HIV-1) antibody,” J Immunol. 165(8):4505-14.
- Almagro and Fransson (2008). “Humanization of antibodies,” Front. Biosci. 13:1619-1633.
- Baca et al. (1997). “Antibody humanization using monovalent phage display,” J. Biol. Chem., 272(16):10678-10684.
- Barclay, A.N. and Brown, M.H. (2006). “The SIRP family of receptors and immune regulation,” Nat. Rev. Immunol., 6(6):457-464.
- Barnes et al. (1980). “Methods for growth of cultured cells in serum-free medium,” Anal. Biochem. 102:255-70.
- Boerner et al. (1991). “Production of antigen-specific human monoclonal antibodies from in vitro-primed human splenocytes,” J. Immunol., 147(1):86-95.
- Bravman, T. et al. (2006). “Exploring “one-shot” kinetics and small molecule analysis using the ProteOn XPR36 array biosensor,” Anal. Biochem., 358(2):281-288.
- Brennan et al. (1985). “Preparation of bispecific antibodies by chemical recombination of monoclonal immunoglobulin G1 fragments,” Science, 229(4708):81-3.
- Bruggemann et al. (1993). “Designer mice: the production of human antibody repertoires in transgenic animals,” Year in Immunol., 7:33-40.
- Carter et al. (1992). “High level Escherichia coli expression and production of a bivalent humanized antibody fragment,” Biotechnology, 10(2):163-167.
- Carter et al. (1992). “Humanization of an anti-p185HER2 antibody for human cancer therapy,” Proc. Natl. Acad. Sci. USA, 89(10):4285-9.
- Chothia and Lesk, (1987). “Canonical structures for the hypervariable regions of immunoglobulins,” J. Mal. Biol., 196(4):901-917.
- Clackson et al. (1991). “Making antibody fragments using phage display libraries,” Nature, 352: 624-628.
- Fellouse (2004). “Synthetic antibodies from a four-amino-acid code: a dominant role for tyrosine in antigen recognition,” Proc. Natl. Acad. Sci. USA, 101(34):12467-12472.
- Fishwild et al. (1996). “High-avidity human IgG kappa monoclonal antibodies from a novel strain of minilocus transgenic mice,” Nature Biotechnol., 14(7):845-851.
- Glanville, J. et al. (2009). “Precise determination of the diversity of a combinatorial antibody library gives insight into the human immunoglobulin repertoire,” Proc. Natl. Acad. Sci., 106(48):20216-20221.
- Graham et al. (1977). “Characteristics of a human cell line transformed by DNA from human adenovirus type 5,” J. Gen Viral., 36(1):59-74.
- Griffiths et al. (1993). “Human anti-self antibodies with high specificity from phage display libraries,” EMBO J, 12(2):725-734.
- Gruber et al. (1994). “Efficient tumor cell lysis mediated by a bispecific single chain antibody expressed in Escherichia coli,” J. Immunol, 152(11):5368-74.
- Ham et al. (1979). “Media and growth requirements,” Meth. Enz., 58:44-93.
- Hamers-Casterman et al. (1993). “Naturally occurring antibodies devoid of light chains,” Nature, 363(6428):446-448.
- Hatherley, D. et al. (2007). “The structure of the macrophage signal regulatory protein alpha (SIRPalpha) inhibitory receptor reveals a binding face reminiscent of that used by T cell receptors,” J. Biol. Chem., 282(19):14567-75.
- Hatherley, D. et al. (2008). “Paired receptor specificity explained by structures of signal regulatory proteins alone and complexed with CD47,” Mal. Cell, 31(2):266-77.
- Hatherley, D. et al. (2009). “Structure of signal-regulatory protein alpha: a link to antigen receptor evolution,” J. Biol. Chem., 284(39):26613-9.
- Hollinger et al. (1993). “‘Diabodies’: small bivalent and bispecific antibody fragments,” Proc. Natl. Acad. Sci. USA, 90(14):6444-6448.
- Hongo et al. (1995). “Development and characterization of murine monoclonal antibodies to the latency-associated peptide of transforming growth factor beta 1,” Hybridoma, 14(3):253-260.
- Hoogenboom and Winter (1992). “By-passing immunisation. Human antibodies from synthetic repertoires of germline VH gene segments rearranged in vitro,” J. Mol. Biol., 227(2):381-388.
- Hoogenboom, H.R. (2002). “Overview of antibody phage-display technology and its applications,” Methods in Molecular Biology, 178:1-37.
- Hudson et al. (2003). “Engineered antibodies,” Nat. Med., 9(1):129-134.
- International Search Report and Written Opinion directed to PCT Application No. PCT/US2019/023238, dated May 20, 2019, 6 pages.
- Jakobovits et al. (1993). “Analysis of homozygous mutant chimeric mice: deletion of the immunoglobulin heavy-chain joining region blocks B-cell development and antibody production,” Proc. Natl. Acad. Sci. USA, 90(36):2551-5.
- Jakobovits et al. (1993). “Germ-line transmission and expression of a human-derived yeast artificial chromosome,” Nature, 362(6417):255-258.
- Jayaram, N. et al. (2012). “Germline VH/VL pairing in antibodies,” Protein Eng. Des. Sel., 25(10):523-529.
- Jones et al. (1986). “Replacing the complementarity-determining regions in a human antibody with those from a mouse,” Nature, 321(6069):522-525.
- Kharitonenkov, A. et al. (1997). “A family of proteins that inhibit signalling through tyrosine kinase receptors,” Nature, 386(6621):181-6.
- Kim, E.J. et al. (2013). “SHPS-1 and a synthetic peptide representing its ITIM inhibit the MyD88, but not TRIF, pathway of TLR signaling through activation of SHP and PI3K in THP-1 cells,” Inflammation Research, 62(4):377-86.
- Kohler and Milstein, (1975). “Continuous cultures of fused cells secreting antibody of predefined specificity,” Nature, 256(5517):495-97.
- Kostelny et al. (1992). “Formation of a bispecific antibody by the use of leucine zippers.” J. Immunol., 148(5):1547-1553.
- Lee et al. (2004). “Bivalent antibody phage display mimics natural immunoglobulin,” J. Immunol. Methods, 284(1-2):119-132.
- Lee et al. (2004). “High-affinity human antibodies from phage-displayed synthetic Fab libraries with a single framework scaffold,” J. Mol. Biol., 340(5):1073-1093.
- Lee, W. Y. et al. (2010). “The role of cis dimerization of signal regulatory protein alpha (SIRPalpha) in binding to CD47,” J. Biol. Chem., 285(49):37953-63.
- Lee, W.Y. et al. (2007). “Novel structural determinants on SIRP alpha that mediate binding to CD47,”J. Immunol., 179(11):7741-50.
- Li et al. (2006). “Optimization of humanized IgGs in glycoengineered Pichia pastoris,” Nat. Biotech., 24(2):210-215.
- Lloyd, C. et al. (2009). “Modelling the human immune response: performance of a 1011 human antibody repertoire against a broad panel of therapeutically relevant antigens,” Protein Eng. Des. Sel., 22(3):159-168.
- Lonberg (2008). “Fully human antibodies from transgenic mouse and phage display platforms,” Curr. Opin. Immunol., 20(4):450-459.
- Lonberg and Huszar (1995) “Human antibodies from transgenic mice,” Intern. Rev. Immunol., 13(1):65-93.
- Lonberg et al. (1994). “Antigen-specific human antibodies from mice comprising four distinct genetic modifications,” Nature, 368(6474):856-859.
- Majeti, R. et al. (2009). “CD47 is an adverse prognostic factor and therapeutic antibody target on human acute myeloid leukemia stem cells,” Cell, 138(2):286-99.
- Marks et al. (1992). “By-passing immunization. Human antibodies from V-gene libraries displayed on phage,” J. Mol. Biol., 222(3): 581-597.
- Marks et al. (1992). “By-passing immunization: building high affinity human antibodies by chain shuffling,” Biotechnology, 10(7):779-783.
- Mather (1980). “Establishment and characterization of two distinct mouse testicular epithelial cell lines,” Biol. Reprod., 23(1):243-252.
- Mather et al. (1982). “Culture of testicular cells in hormone-supplemented serum-free medium,” Annals N.Y. Acad. Sci., 383:44-68.
- Mettler Izquierdo, S. et al. (2016). “High-efficiency antibody discovery achieved with multiplexed microscopy,” Microscopy (Oxf), 341-52.
- Morimoto et al. (1992). “Single-step purification of F(ab′)2 fragments of mouse monoclonal antibodies (immunoglobulins G1) by hydrophobic interaction high performance liquid chromatography using TSKgel Phenyl-5PW,” Journal of Biochemical and Biophysical Methods, 24(1-2):107-117.
- Morrison (1994). “Immunology. Success in specification,” Nature, 368(6474):812-813.
- Morrison et al. (1984). “Chimeric human antibody molecules: mouse antigen-binding domains with human constant region domains,” Proc. Natl. Acad. Sci. USA, 81(21):6851-6855.
- Murata, Y. et al. (2014). The CD47-SIRPα signalling system: its physiological roles and therapeutic application, The Journal of Biochemistry, 155(6):335-344.
- Nakaishi, A. et al. (2008). “Structural insight into the specific interaction between murine SHPS-1/SIRP alpha and its ligand CD47,” J. Mal. Biol. 375:650-60.
- Neuberger (1996). “Generating high-avidity human Mabs in mice,” Nature Biotechnol., 14(7):826.
- Ochi, F. et al. (1997). “Epidermal growth factor stimulates the tyrosine phosphorylation of SHPS-1 and association of SHPS-1 with SHP-2, a SH2 domain-containing protein tyrosine phosphatase,” Biochem. Biophys. Res. Commun., 239(2):483-7.
- Presta (1992). “Antibody engineering,” Curr. Op. Struct. Biol. 2:593-596.
- Presta et al. (1993). “Humanization of an antibody directed against IgE,” J. Immunol., 151(5):2623-32.
- Riechmann et al. (1988). “Reshaping human antibodies for therapy,” Nature, 332(6162):323-327.
- Seiffert, M. et al. (2001). “Signal-regulatory protein a (SIRPa) but not SIRPb is involved in T-cell activation, binds to CD47 with high affinity, and is expressed on immature CD34+CD38− hematopoietic cells,” Blood, 97(9):2741-2749.
- Sheriff et al. (1996). “Redefining the minimal antigen-binding fragment,” Nature Struct. Biol., 3(9):733-736.
- Sidhu et al. (2004). “Phage-displayed antibody libraries of synthetic heavy chain complementarity determining regions,” J. Mol. Biol., 338(2): 299-310.
- Sims et al. (1993). “A humanized CD18 antibody can block function without cell destruction,” J. Immunol., 151(4):2296-308.
- Spiess, C. et al. (2015). “Alternative molecular formats and therapeutic applications for bispecific antibodies,” Mal. Immunol., 67(2 Pt A):95-106.
- Treffers et al., (2018). “Genetic variation of human neutrophil Fcγ receptors and SIRPα in antibody-dependent cellular cytotoxicity towards cancer cells,” European Journal of Immunology 48(2):344-354.
- Urlaub et al. (1980). “Isolation of Chinese hamster cell mutants deficient in dihydrofolate reductase activity,” Proc. Natl. Acad. Sci. USA, 77(7):4216-20.
- Van Der Heijden, J. (Jul. 1, 2014). “Genetic Variation in Human Fc Gamma Receptors: Functional Consequences of Polymorphisms and Copy Number Variation,” located at <https://dare.uva.nl/search?identifier=54e3332e-a8c8-4fec-a49d-833b35617f2f> last visited on Sep. 7, 2017, pp. 115-135, 22 pages.
- Vollmers and Brandlein, (2005). “Death by stress: natural IgM-induced apoptosis,” Methods and Findings in Experimental and Clinical Pharmacology, 27(3):185-91.
- Vollmers and Brandlein, (2005). “The ‘early birds’: natural IgM antibodies and immune surveillance,” Histology and Histopathology, 20(3):927-937.
- Weiskopf, K. et al. (2013). “Engineered SIRPα variants as immunotherapeutic adjuvants to anticancer antibodies,” Science, 341(6141):88-91.
- Willingham, S.B. et al. (2012). “The CD47-signal regulatory protein alpha (SIRPa) interaction is a therapeutic target for human solid tumors,” 109(17):6662-7.
- Winter et al. (1994). “Making antibodies by phage display technology,” Ann. Rev. Immunol., 12:433-455.
- Yi. et al. (2015). “Splenic dendritic cells survey red blood cells for missing self-CD47 to trigger adaptive immune responses,” Immunity, 433(4):764-775.
- Zhao, X.W. et al. (2011). “CD47-signal regulatory protein-α (SIRPα) interactions form a barrier for antibody-mediated tumor cell destruction,” Proc. Natl. Acad. Sci., 108(45):18342-7.
- BioLegend. (2016). “Purified anti-human CD172a/b (SIRPa/b) Antibody,” https://www.biolegend.com/en-gb/global-elements/pdf-popup/purified-anti-human-cd172a-b-sirpalpha-beta-antibody-4028?filename=Purified%20anti-human%20CD172ab%20SIRPalphabeta%20Antibody.pdf&pdfgen=true, Retrieved: Dec. 15, 2017.
- Nettleship, J. et al. (2013). “Crystal structure of signal regulatory protein gamma (SIRPg) in complex with an antibody Fab fragment”, BMC Structural Biology, 13(13):1-8.
- Seiffert, M. et al. (1999). “Human Signal-Regulatory Protein Is Expressed on Normal, But Not on Subsets of Leukemic Myeloid Cells and Mediates Cellular Adhesion Involving Its Counterreceptor CD47,” Blood, 94(11):3633-3643.
- Takenaka, K. et al. (2007). “Polymorphism in Sirpa modulates engraftment of human hematopoietic stem cells,” Nat. Immunol., 8(12):1313-23.
- Champe et al. (1995). “Monoclonal antibodies that block the activity of leukocyte function-associated antigen 1 recognize three discrete epitopes in the inserted domain of CD11a,” J. Biol. Chem., 270(3):1388-1394.
- International Search Report and Written Opinion directed to PCT Application No. PCT/US2017/052592, dated Dec. 20, 2017, 22 pages.
- Yanagita, T. et al. (2017). “Anti-SIRPα antibodies as a potential new tool for cancer immunotherapy,” JCI Insight, 2(1):e89140.
- Hlavacek et al. (1999). “Steric Effects on Multivalent Ligand-Receptor Binding: Exclusion of Ligand Sites by Bound Cell Surface Receptors,” Biophysical Journal, vol. 76, Issue 6, pp. 3031-3043.
- Pluckthun et al. (1997). “New protein engineering approaches to multivalent and bispecific antibody fragments,” Immunotechnology, 3(2):83-105.
- U.S. Appl. No. 17/337,180, filed Jun. 2, 2021, titled “Antibodies Against Signal-Regulatory Protein Alpha and Methods of Use,” inventor Pons et al., Applicant ALX Oncology Inc.
- U.S. Appl. No. 17/337,348, filed Jun. 2, 2021, titled “Antibodies Against Signal-Regulatory Protein Alpha and Methods of Use,” inventor Pons et al., Applicant ALX Oncology Inc.
- U.S. Appl. No. 17/337,176, filed Jun. 2, 2021, titled “Antibodies Against Signal-Regulatory Protein Alpha and Methods of Use,” inventor Pons et al., Applicant ALX Oncology Inc.
- “Focused Peptide Mapping Analyses of light chains from anti-SIRP-α antibodies,” by Applicant, dated Oct. 8, 2021, 2 pages.
Type: Grant
Filed: Mar 20, 2019
Date of Patent: Apr 5, 2022
Patent Publication Number: 20190352419
Assignee: ALX ONCOLOGY INC. (South San Francisco, CA)
Inventors: Jaume Pons (San Carlos, CA), Bang Janet Sim (Brisbane, CA), Hong Wan (Foster City, CA), Tracy Chia-Chien Kuo (San Mateo, CA)
Primary Examiner: Michael Szperka
Assistant Examiner: Lia E Taylor
Application Number: 16/359,799
International Classification: C07K 16/28 (20060101); A61P 35/00 (20060101); A61K 45/06 (20060101);