POLYMERASE VARIANTS

The present disclosure provides variant Pol6 polymerase polypeptides, compositions comprising the Pol6 variant polypeptides, and methods for using the variant Pol6 polypeptides for determining the sequencing of nucleic acids, for example, by nanopore sequencing. The variant Pol6 polymerases possess decreased rates of dissociation of template from the polymerase-template complex, which result in increased processivity relative to the parental Pol6 polypeptides from which they are derived.

Skip to: Description  ·  Claims  · Patent History  ·  Patent History
Description
CROSS-REFERENCE

The present application is a divisional of U.S. patent application Ser. No. 15/443,964, filed Feb. 27, 2017, which claims the benefit of U.S. Provisional Patent Application Ser. No. 62/301,619, filed Feb. 29, 2016, which is incorporated herein by reference in its entirety.

SEQUENCE LISTING

The instant application contains a Sequence Listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety. Said ASCII copy, created on Feb. 26, 2020, is named P33451US2_SeqList_ST25 and is 52,905 bytes in size.

TECHNICAL FIELD

Modified DNA polymerases are provided. The DNA polymerases comprise mutations that enhance the processivity of the polymerases, in particular, in methods for nanopore sequencing.

BACKGROUND

Nanopores have recently emerged as a label-free platform for interrogating sequence and structure in nucleic acids. Data are typically reported as a time series of ionic current as DNA sequence is determined when an applied electric field is applied across a single pore controlled by a voltage-clamped amplifier. Hundreds to thousands of molecules can be examined at high bandwidth and spatial resolution.

A crucial obstacle to the success of nanopores as a reliable DNA analysis tool is the processivity, which affects average read length. This and other desirable properties can be enhanced by modifying polymerases to increase the amount of sequence information obtained from a sequencing reaction.

SUMMARY OF THE INVENTION

In one aspect, a variant Pol6 enzyme having polymerase activity is provided. The variant Pol6 enzyme comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F. In some embodiments, the variant Pol6 is attached to a monomeric or an oligomeric nanopore.

In another aspect, a composition comprising a variant Pol6 enzyme having polymerase activity is provided. In some embodiments, the composition comprises a variant Pol6 enzyme that comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F. In some embodiments, the variant Pol6 is attached to a monomeric or an oligomeric nanopore.

In another aspect, a plurality of polynucleotides encoding a variant Pol6 enzyme is provided. In some embodiments, the plurality of polynucleotides encode a variant Pol6 enzyme that comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F.

In another aspect, provided is an expression vector comprising a polynucleotide encoding a variant Pol6 enzyme having polymerase activity. In some embodiments, the expression vector comprises any one of a plurality of polynucleotides that encode a variant Pol6 enzyme that comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F.

In another aspect, a plurality of host cells each transformed or transfected with an expression vector encoding a variant Pol6 enzyme having polymerase activity is provided. In some embodiments, variant Pol6 enzyme comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F.

In another aspect, a method is provided for preparing a variant Pol6 enzyme having polymerase activity. In some embodiments, the method comprises culturing host cells that are transformed or transfected with an expression vector encoding any one of the variant Pol6 polymerases described herein. In some embodiments, the method provided is for preparing a variant Pol6 enzyme that comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F. In some embodiments, the method further comprises isolating the variant Pol6 enzyme.

In another aspect, provided is a biochip for sequencing a nucleic acid sample. The biochip comprises a plurality of nanopore sequencing complexes, which comprise a variant Pol6 polymerase as described elsewhere herein, wherein the variant polymerase is attached to nanopore formed in a membrane and disposed adjacent to an electrode. In some embodiments, the variant Pol6 enzyme that comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, 1570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F.

In another aspect, a method for nanopore sequencing a nucleic acid sample is provided. The method comprises (a) providing tagged nucleotides to a nanopore sequencing complex comprising a variant Pol6 as described elsewhere herein, wherein an individual tagged nucleotide of said tagged nucleotides contains a tag coupled to a nucleotide, which tag is detectable with the aid of the nanopore; (b) under a high concentration of salt, carrying out a polymerization reaction with the aid of the variant Pol6 enzyme of the nanopore sequencing complex, thereby incorporating an individual tagged nucleotide of the tagged nucleotides into a growing strand complementary to a single stranded nucleic acid molecule from the nucleic acid sample; and (c) detecting, with the aid of the nanopore, a tag associated with the individual tagged nucleotide during incorporation of the individual tagged nucleotide, wherein the tag is detected with the aid of the nanopore while the nucleotide is associated with the variant Pol6 polymerase. The variant Pol6 enzyme that comprises a polypeptide having an amino acid sequence at least 70% identical to full-length parent polypeptide of SEQ ID NO:2, and a modification at one or more positions selected corresponding to amino acids from V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E585, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585. In some embodiments, the modification at one or more positions is a substitution to amino acid K, R, H, Y, F, W, and/or T. In some embodiments, the modification at one or more positions is selected from G438K, E565K, E585K, L731K, E585K-L731K, M738K, and E585K-M738K. In some embodiments, the modification produces a variant polypeptide having increased processivity relative to the parent polypeptide. In some embodiments, the increased processivity comprises a decrease in the rate of template dissociation that is at least two-fold less than that of the parental Pol6. In some embodiments, the processivity of the variant Pol6 comprises an increase in read length produced by the variant Pol6 that is greater than the read length produced by the unmodified parent Pol6. In some embodiments, the variant Pol6 further comprises amino acid substitutions D44A, S366A, T529M, and A547F. In some embodiments, the nucleic acid sample is double stranded DNA. In some embodiments, the nucleic acid sample is single stranded DNA. In some embodiments, the nucleic acid sample is reverse transcribed RNA. In some embodiments, the nanopore is a monomeric nanopore e.g. OmpG. In other embodiments, the nanopore is an oligomeric nanopore e.g. an alpha-hemolysin nanopore. In some embodiments the nanopore sequencing is performed at high concentration of salt that is at least 100 mM salt.

BRIEF DESCRIPTION OF THE DRAWINGS

FIG. 1 illustrates the minimal catalytic steps required for single-nucleotide incorporation by DNA polymerase. The reaction begins with the binding of free DNA polymerase enzyme (E) to a duplex primer/template DNA complex (DNAn) resulting in a binary enzyme-DNA complex (E⋅DNAn). kon.DNA denotes the rate of association of the enzyme with the template; and koff.DNA denotes the rate of dissociation of the enzyme from the enzyme-DNA complex. The equilibrium determined by the kon.DNA and koff.DNA rates defines the static processivity of the polymerase-template complex. Thus, the static processivity of the enzyme can be increased by an increase in the rate of association, kon.DNA, and/or a decrease in the rate of dissociation, koff.DNA Addition of the correct nucleotide (dNTP) in the presence of divalent cations, such as Mg2+, promotes the enzyme-DNA-dNTP ternary complex formation (E⋅DNAn⋅dNTP⋅Mg2+). The kon, nucleotide denotes the rate of nucleotide binding of the enzyme. The koff, nucleotide denotes the rate of nucleotide dissociation form the enzyme template complex. The equilibrium determined by the kon, nucleotide and koff, nucleotide defines the replicative processivity of the polymerase. Thus, the replicative processivity of the polymerase can be increased by an increase in the rate of nucleotide association, kon, nucleotide, and/or a decrease in the rate of nucleotide dissociation, koff, nucleotide. The binding of the dNTP induces the first conformational change of the enzyme in the ternary complex. A phosphodiester bond is formed between the a-phosphate of the incoming dNTP and the 3′-OH of the template/primer terminus to produce an added nucleotide base to the primer terminus (E*⋅DNAn+1⋅PPi). The reaction generates a pyrophosphate (PPi) and a proton. A second conformational change allows for the release of the PPi to complete a cycle of nucleotide incorporation.

FIG. 2 illustrates an exemplary template used in the displacement assay. Reference is made to Example 3.

FIG. 3 A-D is a graph showing representative data from a static displacement assay for a parental Pol6 polymerase ((A); Pol6-44-D44A; SEQ ID NO:4), and variant Pol6 polymerases Pol6-44-D44A-E585K ((B); SEQ ID NO:6); Pol6-44-A44D-E585K+L731K ((C); SEQ ID NO:7); and Pol6-44-A44D-E585K+M738K ((D); SEQ ID NO:8). Reference is made to Example 3.

DETAILED DESCRIPTION

The invention will now be described in detail by way of reference only using the following definitions and examples. All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.

Unless defined otherwise herein, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Singleton, et al., DICTIONARY OF MICROBIOLOGY AND MOLECULAR BIOLOGY, 2D ED., John Wiley and Sons, New York (1994), and Hale & Marham, THE HARPER COLLINS DICTIONARY OF BIOLOGY, Harper Perennial, NY (1991) provide one of skill with a general dictionary of many of the terms used in this invention. Although any methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, the preferred methods and materials are described. Practitioners are particularly directed to Sambrook et al., 1989, and Ausubel FM et al., 1993, for definitions and terms of the art. It is to be understood that this invention is not limited to the particular methodology, protocols, and reagents described, as these may vary.

Numeric ranges are inclusive of the numbers defining the range. The term about is used herein to mean plus or minus ten percent (10%) of a value. For example, “about 100” refers to any number between 90 and 110.

Unless otherwise indicated, nucleic acids are written left to right in 5′ to 3′ orientation; amino acid sequences are written left to right in amino to carboxy orientation, respectively.

The headings provided herein are not limitations of the various aspects or embodiments of the invention, which can be had by reference to the specification as a whole. Accordingly, the terms defined immediately below are more fully defined by reference to the specification as a whole.

All patents and publications, including all sequences disclosed within such patents and publications, referred to herein are expressly incorporated by reference.

DEFINITIONS

The term “processivity” herein refers to the ability of a polymerase to remain attached to the template and perform multiple modification reactions. “Modification reactions” include but are not limited to polymerization, and exonucleolytic cleavage. In some embodiments, “processivity” refers to the ability of a DNA polymerase to perform a sequence of polymerization steps without intervening dissociation of the enzyme from the growing DNA chains. Typically, “processivity” of a DNA polymerase is measured by the number of nucleotides (for example 20 nts, 300 nts, 0.5-1 kb, or more) that are incorporated i.e. polymerized by a polymerase into a growing DNA strand prior to the dissociation of the DNA polymerase from the growing DNA strand. The processivity of DNA synthesis by a DNA polymerase is defined as the number of nucleotides that a polymerase can incorporate into DNA during a single template binding event, before dissociating from a DNA template. The overall efficiency of DNA synthesis increases when the processivity of a polymerase increases. “Processivity” can depend on the nature of the polymerase, the sequence of a DNA template, and reaction conditions, for example, salt concentration, temperature or the presence of specific proteins. As used herein, the term “high processivity” refers to a processivity higher than 20 nts (e.g., higher than 40 nts, 60 nts, 80 nts, 100 nts, 120 nts, 140 nts, 160 nts, 180 nts, 200 nts, 220 nts, 240 nts, 260 nts, 280 nts, 300 nts, 320 nts, 340 nts, 360 nts, 380 nts, 400 nts, or higher) per association/dissociation with the template. The higher the processivity of a polymerase, that greater the number of nucleotides that can be incorporated prior to dissociation of the polymerase from the template, and therefore, the longer the sequence (read length) that can be obtained. Processivity can be measured according the methods defined herein and in WO 01/92501 A1 (MJ Bioworks, Inc., Improved Nucleic Acid Modifying Enzymes, published 6 Dec. 2001). Processivity encompasses static processivity and replicative processivity.

The term “static processivity” herein refers to the permanence of a polymerase-template complex in the absence of nucleotide incorporation i.e. in the absence of polynucleotide synthesis, as determined by the rate of association of polymerase with template, kon.DNA, and the rate of dissociation of polymerase from the polymerase-template complex koff⋅DNA. Static processivity is defined in the absence of polynucleotide synthesis.

The term “replicative processivity” herein refers to the permanence of a polymerase-template complex in the during nucleotide incorporation i.e. in the presence of polynucleotide synthesis, as determined by the rate of association of polymerase with template, kon.nucleotide, and the rate of dissociation of polymerase from the polymerase-template complex koff⋅nucleotide.

The term “association rate”, when used in reference to a given polymerase, herein refers to the rate at which a polymerase associates with a template. The association rate can be interpreted as a time constant for association (“kon, DNA”) of a polymerase with a nucleic acid template under a defined set of reaction conditions. Some exemplary assays for measuring the dissociation time constant of a polymerase are described further below. In some embodiments, the dissociation time constant can be measured in units of inverse time, e.g., sec−1 or min−1.

The term “dissociation rate”, when used in reference to a given polymerase, herein refers to the rate at which a polymerase dissociates from the template of the polymerase-template complex. The dissociation rate can be interpreted as a time constant for dissociation (“koff, DNA”) of a polymerase from a nucleic acid template under a defined set of reaction conditions. Some exemplary assays for measuring the dissociation time constant of a polymerase are described further below. In some embodiments, the dissociation time constant can be measured in units of inverse time, e.g., sec−1 or min−1.

The term “read length” herein refers to the number of nucleotides that a polymerase incorporates into a nucleic acid strand in a template-dependent manner prior to dissociation from the template.

The term “high concentration of salt” herein refers to a concentration of salt i.e. monovalent salt that is at least 100 mM and up to 1 M salt.

The terms “polynucleotide” and “nucleic acid” are herein used interchangeably to refer to a polymer molecule composed of nucleotide monomers covalently bonded in a chain. Single stranded DNA (ss deoxyribonucleic acid; ssDNA), double stranded DNA (dsDNA) and RNA (ribonucleic acid) are examples of polynucleotides.

The term “amino acid” in its broadest sense, herein refers to any compound and/or substance that can be incorporated into a polypeptide chain. In some embodiments, an amino acid has the general structure H2N—C(H)(R)—COOH. In some embodiments, an amino acid is a naturally-occurring amino acid. In some embodiments, an amino acid is a synthetic amino acid; in some embodiments, an amino acid is a D-amino acid; in some embodiments, an amino acid is an L-amino acid. “Standard amino acid” refers to any of the twenty standard L-amino acids commonly found in naturally occurring peptides. “Nonstandard amino acid” refers to any amino acid, other than the standard amino acids, regardless of whether it is prepared synthetically or obtained from a natural source. As used herein, “synthetic amino acid” encompasses chemically modified amino acids, including but not limited to salts, amino acid derivatives (such as amides), and/or substitutions. Amino acids, including carboxy- and/or amino-terminal amino acids in peptides, can be modified by methylation, amidation, acetylation, and/or substitution with other chemical without adversely affecting their activity. Amino acids may participate in a disulfide bond. The term “amino acid” is used interchangeably with “amino acid residue,” and may refer to a free amino acid and/or to an amino acid residue of a peptide. It will be apparent from the context in which the term is used whether it refers to a free amino acid or a residue of a peptide. It should be noted that all amino acid residue sequences are represented herein by formulae whose left and right orientation is in the conventional direction of amino-terminus to carboxy-terminus.

The term “nanopore sequencing complex” herein refers to a nanopore linked to an enzyme, e.g., a polymerase, which in turn is associated with a polymer, e.g., a polynucleotide or a protein. The nanopore sequencing complex is positioned in a membrane, e.g., a lipid bilayer, where it functions to identify polymer components, e.g., nucleotides or amino acids.

The term “enzyme-polymer complex” herein refers to an enzyme, e.g., polymerase that is associated/coupled with a polymer, e.g., polynucleotide or protein.

The term “enzyme-nanopore complex” herein refers to a nanopore that is associated/coupled with a sequencing enzyme e.g. a variant Pol6 polymerase. In some embodiments, the nanopore can be reversibly or irreversibly bound to the sequencing enzyme.

The terms “alpha-hemolysin,” “α-hemolysin,” “aHL,” “αHL,” “a-HL” and “αa-HL” are used interchangeably and herein refer to a protein that self-assembles into a heptameric water-filled transmembrane nanopore channel.

The term “OmpG” herein refers to an Outer Membrane Protein G monomeric nanopore.

The term “nucleotide” herein refers to a monomeric unit of DNA or RNA consisting of a sugar moiety (pentose), a phosphate, and a nitrogenous heterocyclic base. The base is linked to the sugar moiety via the glycosidic carbon (1′ carbon of the pentose) and that combination of base and sugar is a nucleoside. When the nucleoside contains a phosphate group bonded to the 3′ or 5′ position of the pentose it is referred to as a nucleotide. A sequence of operatively linked nucleotides is typically referred to herein as a “base sequence” or “nucleotide sequence,” and is represented herein by a formula whose left to right orientation is in the conventional direction of 5′-terminus to 3′-terminus.

The term “nucleotide analog” herein refers to analogs of nucleoside triphosphates, e.g., (S)-Glycerol nucleoside triphosphates (gNTPs) of the common nucleobases: adenine, cytosine, guanine, uracil, and thymidine (Horhota et al. Organic Letters, 8:5345-5347 [2006]).

The term “tag” herein refers to a detectable moiety that may be atoms or molecules, or a collection of atoms or molecules. A tag may provide an optical, electrochemical, magnetic, or electrostatic (e.g., inductive, capacitive) signature, which may be detected with the aid of a nanopore.

The term “tagged nucleotide” herein refers to a nucleotide having a tag attached at its terminal phosphate.

The term “sequencing enzyme” herein refers to the enzyme of a nanopore sequencing complex where it serves to identify polymer components, e.g., nucleotides or amino acids.

The term “polymerase” herein refers to an enzyme that catalyzes the polymerization of nucleotide (i.e., the polymerase activity). The term polymerase encompasses DNA polymerases, RNA polymerases, and reverse transcriptases. -A “DNA polymerase” catalyzes the polymerization of deoxynucleotides. An “RNA polymerase” catalyzes the polymerization of ribonucleotides. A “reverse transcriptase” catalyzes the polymerization of deoxynucleotides that are complementary to an RNA template.

The terms “template DNA molecule” and “template strand” are used interchangeably herein to refer to a strand of a nucleic acid from which a complementary nucleic acid strand is synthesized by a DNA polymerase, for example, in a primer extension reaction.

The term “sample polynucleotide” herein refers to a polynucleotide obtained from a sample, e.g., a biological sample.

The term “template-dependent manner” refers to a process that involves the template dependent extension of a primer molecule (e.g., DNA synthesis by DNA polymerase). The term “template-dependent manner” typically refers to polynucleotide synthesis of RNA or DNA wherein the sequence of the newly synthesized strand of polynucleotide is dictated by the well-known rules of complementary base pairing (see, for example, Watson, J. D. et al., In: Molecular Biology of the Gene, 4th Ed., W. A. Benjamin, Inc., Menlo Park, Calif. (1987)).

The term “nanopore” herein refers to a channel or passage formed or otherwise provided in a membrane. A membrane may be an organic membrane, such as a lipid bilayer, or a synthetic membrane, such as a membrane formed of a polymeric material. The nanopore may be disposed adjacent or in proximity to a sensing circuit or an electrode coupled to a sensing circuit, such as, for example, a complementary metal oxide semiconductor (CMOS) or field effect transistor (FET) circuit. In some examples, a nanopore has a characteristic width or diameter on the order of 0.1 Nm to about 1000 nm. Some nanopores are proteins. OmpG and alpha-hemolysin are examples of a protein nanopore.

The term “monomeric nanopore” herein refers to a nanopore protein that consists of a single subunit. OmpG is an example of a monomeric nanopore.

The term “oligomeric nanopore” herein refers to nanopores that can be composed of multiple identical subunits, multiple distinct subunits, or a mixture of identical and distinct subunits. Nanopores with identical subunits are termed “homo-oligomeric nanopores”. Nanopores containing two or more distinct polypeptide subunits are termed “hetero-oligomeric nanopores”. Alpha-hemolysin is an example of an oligomeric nanopore.

The term “wild-type” herein refers to a gene or gene product (e.g., a protein) that has the characteristics of that gene or gene product when isolated from a naturally occurring source.

The term “parental” or “parent” herein refers to a protein, e.g., a nanopore or enzyme, to which modifications, e.g., substitution(s), insertion(s), deletion(s), and/or truncation(s), are made to produce variants thereof. This term also refers to the polypeptide with which a variant is compared and aligned. The parent may be a naturally occurring (wild type) polypeptide, or it may be a variant thereof, prepared by any suitable means.

The term “mutation” herein refers to a change introduced into a parental sequence, including, but not limited to, substitutions, insertions, deletions (including truncations). The consequences of a mutation include, but are not limited to, the creation of a new character, property, function, phenotype or trait not found in the parental sequence.

The term “variant” herein refers to a modified protein e.g. a variant Pol6 polymerase, which displays altered characteristics when compared to the parental protein, e.g., altered processivity.

The term “purified” herein refers to a polypeptide that is present in a sample at a concentration of at least 95% by weight, or at least 98% by weight of the sample in which it is contained.

Nomenclature

In the present description and claims, the conventional one-letter and three-letter codes for amino acid residues are used.

For ease of reference, polymerase variants of the application are described by use of the following nomenclature:

Original amino acid(s): position(s): substituted amino acid(s). According to this nomenclature, for instance the substitution of serine by an alanine in position 242 is shown as:

    • Glu585Lys or E585K

Multiple mutations are separated by plus signs, i.e.:

    • Glu585Lys+Leu731Lys or E585K+L731K
      representing mutations in positions 585 and 731 substituting glutamic acid and Leucine acid for Lysine and Leucine for Lysine, respectively.

When one or more alternative amino acid residues may be inserted in a given position it is indicated as: E585K/R or E585K or E585R.

Variant Pol6 Polymerase Polypeptides

In nanopore sequencing, high salt concentrations boost the signal to noise ratio for ionic-current-based nanopore measurements. However, at high salt concentrations, the polymerase-DNA template complex becomes unstable, and leads to high polymerase turnover rates and diminished detection of sequential nucleotide additions i.e. length of sequence reads, during polymerization reactions.

The present disclosure provides variant Pol6 polymerase polypeptides, compositions comprising the Pol6 variant polypeptides, and methods for using the variant Pol6 polypeptides for determining the sequencing of nucleic acids, for example, by nanopore sequencing. The variant Pol6 polymerases possess decreased rates of dissociation of template from the polymerase-template complex, which result in increased processivity relative to the parental Pol6 polypeptides from which they are derived. The increased processivity is obtained at high salt concentrations, as described elsewhere herein.

The polymerase variants provided for herein can be used in the chip-based polynucleotide sequencing as described in WO2013/188841 (Genia Technologies, Inc., Chip Set-Up and High-Accuracy Nucleic Acid Sequencing, published 19 Dec. 2013).

Desired characteristics of a polymerase that finds use in sequencing DNA are:

    • a. Slow koff nucleotide, and/or slow koff,DNA
    • b. Fast kon,nucleotide and/or fast kon,DNA
    • c. High fidelity
    • d. Low exonuclease activity
    • e. DNA strand displacement
    • f. kchem
    • g. Increased stability
    • h. Increased processivity
    • i. Salt tolerance
    • j. Compatible with attachment to nanopore
    • k. Ability to incorporate a polyphosphates having 4, 5, 6, 7 or 8 phosphates, e.g., quadraphosphate, pentaphosphate, hexaphosphate, heptaphosphate or octophosphate nucleotide
    • l. Sequencing accuracy
    • m. Long read lengths, i.e., long continuous reads.
      The Pol6 polymerase variants provided herein comprise modifications that are engineered to increase processivity, and which may be combined with additional modifications that impart or enhance one or more of the desired characteristics of a polymerase for sequencing polynucleotides e.g. DNA.

In one aspect, the disclosure provides for variant Pol6 polymerase polypeptides that display increased processivity when compared to the parental polypeptides form which they are derived. The variant Pol6 polypeptides possess long, intrinsic, replicative porcessivity under native low salt conditions. As illustrated in FIG. 1, the processivity of a polymerase e.g. variant Pol6, is related to the static processivity and the replicative processivity. The static processivity is the ability of the polymerase-template complex to remain associated in the absence of polymerization of nucleotides, and is therefore dependent on the rates of association, kon, DNA, and the rate of dissociation, koff, DNA. Thus, static processivity can be increased by an increase in kon, DNA, and/or a decrease in koff, DNA. In the presence of nucleotides and Mg2+ the polymerase carries out sequential rounds of nucleotide incorporation until it dissociates from the polymerase-template complex, as determined by the polymerase's dissociation rate from the polymerase-template complex (koff,DNA). The replicative processivity is the ability of the polymerase, when complexed with template, to incorporate nucleotides in a template-dependent manner. Thus, the overall processivity of the polymerase is dependent on its static and its replicative processivity. Thus, the porcessivity of a polymerase can be increased by an increase in static processivity and/or replicative processivity.

In some embodiments, the parental polypeptide is a wild-type Pol6 polypeptide. The variant Pol6 polypeptides can be derived from a wild-type parental Clostridium phage phiCPV4 wild type sequence (SEQ ID NO:1) nucleic acid coding region plus a His-tag; SEQ ID NO:1, protein coding region) and available elsewhere (National Center for Bioinformatics or Gen Bank Accession Numbers AFH27113). A wild-type parental Pol6 polymerase can be a homolog of the parent Pol6 from Clostridium that can be used as a starting point for providing variant polymerases having increased processivity. It will be appreciated that other polymerases having a high degree of homology to the Clostrium phage sp. strain phiCPV4 may serve as a parental Pol6 without defeating the scope of the compositions and methods provided herein. Homologs of the parental Pol6 from Clostridium phage can share sequence identity with the Pol6 from Clostridium phage (SEQ ID NO:1) of at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99%. For example, a variant Pol6 can be derived from a homolog of the Clostridium phage that is at least 70% identical to the parental Pol6 from Clostridium phage.

In other embodiments, the variant Pol6 polypeptides can be derived from a variant parental Pol6. In some embodiments, the variant parental Pol6 polymerase is the Pol6 polymerase of SEQ ID NO:2 In other embodiments, the variant parental Pol6 polymerase comprises modifications that remove/decrease the exonuclease activity of the polymerase (U.S. Provisional Application P529). In yet other embodiments, the polymerase can be mutated to reduce the rate at which the polymerase incorporates a nucleotide into a nucleic acid strand (e.g., a growing nucleic acid strand). In some cases, the rate at which a nucleotide is incorporated into a nucleic acid strand can be reduced by functionalizing the nucleotide and/or template strand to provide steric hindrance, such as, for example, through methylation of the template nucleic acid strand. In some instances, the rate is reduced by incorporating methylated nucleotides (P521). In other embodiments, the parental polypeptide is a Pol6 variant to which additional mutations have been introduced to improve the desired characteristics of a polymerase used in nanopore sequencing. The variant Pol6 can share sequence identity with the parental Pol6 of SEQ ID NO:2 of at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 98%, or at least 99%. The amino acid positions responsible for DNA interaction were predicted based on crystal structures of Phi29 bound to DNA template (Berman et al., EMBO J. 2007Jul. 25; 26(14): 3494-3505).

In some embodiments, the modification of one or more amino acids at the DNA binding site can be one or more of a substitution, a deletion or an insertion, which modification(s) retain the polymerase activity of the variant polymerase, and decrease the rate of dissociation of polynucleotide from the Pol-DNA complex relative to that of the parent Pol6. The amino acid modification(s) can be made at one or more of amino acid residues corresponding to amino acid residues V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585, of SEQ ID NO:2. In some embodiments, the variant Pol6 enzyme having polymerase activity, comprises an amino acid sequence at least 70% identical to that of the full-length parental Pol6 of SEQ ID NO:2, and has a modification at one or more of amino acids corresponding to amino acid residues V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, 1295, Y342, V436, S437, G438, Q439, E440, and E585, of SEQ ID NO:2.

In some embodiments, the mutation of one or more amino acids of the DNA binding site is a substitution to a positively charged amino acid. For example, any one or more of amino acids corresponding to amino acid residues V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, 1737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, 1295, Y342, V436, S437, G438, Q439, E440, and E585 of SEQ ID NO:2 can be mutated to a K, R, or H. In some embodiments, the mutation of the one or more amino acids of the DNA binding site is a substitution to K. For example, the variant Pol6 polymerase can comprise amino one or both of amino acid substitutions E585K, L731K, and M738K. In some embodiments the variant Pol6 polymerase comprises substitution E585K. In other embodiments, the Pol6 polymerase comprises substitutions E585K+L731K. In yet other embodiments, the Pol6 polymerase comprises substitutions E585K+M738K. In other embodiments, at least two, at least three, at least four, at least five, at least six amino acids or more of the DNA binding site are mutated. The resulting variant Pol6 enzymes retain polymerase activity, and display a decreased rate of dissociation of polynucleotide form the Pot-DNA complex relative to the rate of dissociation displayed in the parent polymerase that lacks the same mutations. In some embodiments, the modification of the parent Pol6 produces a variant Pol6 polymerase having a rate of dissociation from the template that is at least 2-fold less that of the parent Pol6. Modifications of the parent Pol6 can produce variant Pol6 polymerases having a rate of dissociation from the template that is at least 3-fold less that of the parent Pol6, at least 4-fold less that of the parent Pol6, at least 5-fold less that of the parent Pol6, at least 6-fold less that of the parent Pol6, at least 7-fold less that of the parent Pol6, at least 8-fold less that of the parent Pol6, at least 9-fold less that of the parent Pol6, at least 10-fold less that of the parent Pol6.

The decreased rate of dissociation form template enables the production of longer reads. The average read length of the polymerized product produced by the variant Pol6 polymerases provided herein is greater than that produced by using the corresponding unmodified parental Pol6 polymerase. In some embodiments, the read length produced by the variant Pol6 polymerase is at least 100, at least 200, at least 300, at least 400, at least 500, or more nucleotides longer than the read obtained using the unmodified parent Pol6 polymerase.

In another aspect, the accuracy of the variant Pol6 polymerases provided herein can be measured in terms of zero-error reads obtained from the variant Pol6 polymerase reaction that are greater than 100, 200, 300, 400, 500, 750, 1000, 5000, 10000, 100000 nucleotides in length. The accuracy of the variant Pol6 polymerase, (including for example accuracy in a given sequencing reaction) can be measured in terms of the total number of “perfect” (i.e., zero-error) reads obtained from a polymerase reaction that are greater than 100, 200, 300, 400, 500, 750, 1000, 5000, 10000, 100000 nucleotides in length. The accuracy of the poly-merase can be measured in terms of the longest perfect read (typically measured in terms of number of nucleotides included in the read) that is obtained from a polymerase reaction.

In some embodiments, a variant Pol6 polymerase can be assessed against a known or reference polymerase under similar or identical conditions. In some embodiments, the conditions can include sequencing a nucleic acid molecule in the presence of high ionic strength solution. In some embodiments, the variant Pol6 polymerases provided herein catalyze DNA polymerization in solutions of high salt concentrations i.e. high salt solutions, at which they display the increased processivity relative to their parental Pol6. In some embodiments, the increased processivity is displayed at a high salt concentration that can be about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800 mM or grater. Typical salts include salts of metal elements. The high salt solutions can include one or more of a potassium salt, sodium salt, cesium salt, calcium salt, cobalt, nickel, aluminum, manganese, zinc, and lithium. Salts can also include the bicarbonate, sulfate, chloride, carbonate, nitrate, nitrite, bromide, citrate, acetate, cyanide, oxide or phosphate salt of a metal element known to those of skill in the art. In some embodiments, the salt is potassium glutamate (K-glu), potassium chloride (KCl), potassium sulfate (K2SO4), potassium nitrate (KNO3), cesium chloride (CsCl), or cesium nitrate (CsNO3). In some embodiments, the high salt solution includes K-Glu (potassium glutamate) or other monovalent salt. In addition, a mineral salt useful in the invention can include a mixture or blend of mineral salts. Blends of mineral salts that can be used in the invention include K-Glu and KCl, K-Glu and K2SO4, K-Glu and KNO3, K-Glu and CsCl, K-Glu and CsNO3, K-Glu and KNO3, K-Glu and CsCl, K-Glu and CsNO3, K-Glu and CsCl, K-Glu and CsNO3, KCl and K2SO4, KCl and KNO3, KCl and CsCl, KCl and CsNO3, K2SO4 and KNO3, K2SO4 and CsCl, K2SO4 and CsNO3, KNO3 and CsCl, KNO3 and CsNO3, and CsCl and CsNO3. The foregoing salts may be used in the sequencing polymerization reactions at a concentration in the range of 50 to 1 M, in the range of 100 to 800 mM, in the range of 200 to 700 mM, in the range of 300 to 600 mM, in the range of 400 to 500 mM. In some embodiments, the high salt concentration can be of at least 150 mM and up to 500mM. In other embodiments, the high concentration of salt can be greater than 500 mM.

The rate of polymerization of the variant Pol6 polymerases at high salt concentrations is at least 1 base/second, at least 5 bases/second, at least 10 bases/second, at least 20 bases/second, at least 30 bases/second, at least 40 bases/second, at least 50 bases/second, or more. In some embodiments, the rate of polymerization of the variant Pol6 polymerase is at least 1 base/second at 100 mM salt, 1 base/second at 200 mM salt, at least 1 base/second at 300 mM salt, at least 1 base/second at 400 mM salt, at least 1 base/second at 500 mM salt, at least 1 base/second at 600 mM salt, at least 1 base/second at 700 mM s alt, at least 1 base/second at 800 mM salt, at least 1 base/second at 800 mM salt, at least 1 base/second at 900 mM salt, at least 1 base/second at 1M salt. In some embodiments, the rate of polymerization of the variant Pol6 polymerase is between 1 and 10 bases/second at 100 mM salt, between 1 and 10 bases/second at 200 mM salt, between 1 and 10 bases/second at 300 mM salt, between 1 and 10 bases/second at 400 mM salt, between 1 and 10 bases/second at 500 mM salt, between 1 and 10 bases 600 mM salt, between 1 and 10 bases at 700 mM salt, between 1 and 10 bases/second at 800 mM salt, between 1 and 10 bases/second at 800 mM salt, between 1 and 10 bases/second at 900 mM salt, or between 1 and 10 bases/second at 1M salt.

DNA Sequence Encoding Pol6 Variants

DNA sequences encoding a wild-type parent Pol6 may be isolated from any cell or microorganism producing the Pol6 in question, using various methods well known in the art.

Examples of DNA sequences that encode wild-type Clostridium phage phiCPV4 i.e. wild-type Pol6, are provided herein as nucleotides 28-2220 of SEQ ID NO:3, and as nucleotides 421 to 2610 of SEQ ID NO:5. In addition to the wild-type Pol6, SEQ ID NO:3 comprises at its 5′ end nucleotides that encode a histidine tag (His6; HHHHHH; SEQ ID NO:9). SEQ ID NO:5 comprises at its 5′ end nucleotides that encode histidine tag (His6 (SEQ ID NO: 9)) and a SpyCatcher peptide SGDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATM ELRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKAT KGDAHI (SEQ ID NO:10).

First, a genomic DNA and/or cDNA library can be constructed using chromosomal DNA or messenger RNA from the organism that produces the Pol6 to be studied. Then, if the amino acid sequence of the Pol6 is known, homologous, labeled oligonucleotide probes may be synthesized and used to identify Pol6 -encoding clones from a genomic library prepared from the organism in question. Alternatively, a labeled oligonucleotide probe containing sequences homologous to a known Pol6 gene can be used as a probe to identify Pol6-encoding clones, using hybridization and washing conditions of lower stringency.

Alternatively, the DNA sequence encoding the Pol6 may be prepared synthetically by established standard methods, e.g. the phosphoroamidite method described by S. L. Beaucage and M. H. Caruthers (1981) or the method described by Matthes et al. (1984). In the phosphoroamidite method, oligonucleotides are synthesized, e.g. in an automatic DNA synthesizer, purified, annealed, ligated and cloned in appropriate vectors.

Finally, the DNA sequence may be of mixed genomic and synthetic origin, mixed synthetic and cDNA origin or mixed genomic and cDNA origin, prepared by ligating fragments of synthetic, genomic or cDNA origin (as appropriate, the fragments corresponding to various parts of the entire DNA sequence), in accordance with standard techniques. The DNA sequence may also be prepared by polymerase chain reaction (PCR) using specific primers, for instance as described in U.S. Pat. No. 4,683,202 or R. K. Saiki et al. (1988).

Site-Directed Mutagenesis

Once a Pol6-encoding DNA sequence has been isolated or synthesized, and desirable sites for mutation identified, mutations may be introduced using synthetic oligonucleotides. These oligonucleotides contain nucleotide sequences flanking the desired mutation sites; mutant nucleotides are inserted during oligonucleotide synthesis. In a specific method, a single-stranded gap of DNA, bridging the Pol6-encoding sequence, or portion thereof, is created in a vector carrying the Pol6 gene. Then the synthetic nucleotide, bearing the desired mutation, is annealed to a homologous portion of the single-stranded DNA. The remaining gap is then filled in with DNA polymerase I (Klenow fragment) and the construct is ligated using T4 ligase. A specific example of this method is described in Morinaga et al. (1984). U.S. Pat. No. 4,760,025 discloses the introduction of oligonucleotides encoding multiple mutations by performing minor alterations of the cassette. However, an even greater variety of mutations can be introduced at any one time by the Morinaga method, because a multitude of oligonucleotides, of various lengths, can be introduced. Other methods that effect site-directed mutagenesis include Kunkel's method, cassette mutagenesis, and PCR site-directed mutagenesis. Alternative methods for providing variants include gene shuffling, e.g., as described in WO 95/22625 (from Affymax Technologies N.V.) or in WO 96/00343 (from Novo Nordisk A/S), or other corresponding techniques resulting in a hybrid enzyme comprising the mutation(s), e.g., substitution(s) and/or deletion(s), in question.

Expression of Pol6 Variants

A DNA sequence encoding an Pol6 variant can be used to express a Pol6, using an expression vector, which typically includes control sequences encoding a promoter, operator, ribosome binding site, translation initiation signal, and, optionally, a repressor gene or various activator genes. Examples of vectors that can be used for expressing variant Pol6 include the vectors of the pET expression system (Novagen).

A recombinant expression vector carrying DNA sequences may be any vector, which may conveniently be subjected to recombinant DNA procedures, and the choice of vector will often depend on the host cell into which it is to be introduced. Thus, the vector may be an autonomously replicating vector, i.e., a vector which exists as an extrachromosomal entity, the replication of which is independent of chromosomal replication, e.g., a plasmid, a bacteriophage or an extrachromosomal element, minichromosome or an artificial chromosome. Alternatively, the vector may be one which, when introduced into a host cell, is integrated into the host cell genome and replicated together with the chromosome(s) into which it has been integrated.

The procedures used to ligate the DNA construct encoding an Pol6 variant, and to insert it into suitable vectors containing the information necessary for replication, are well known to persons skilled in the art (cf., for instance, Sambrook et al., Molecular Cloning: A Laboratory Manual, Fourth Edition, Cold Spring Harbor, 2012).

A Pol6 variant can be produced in a cell that may be of a higher organism such as a mammal or an insect, but is preferably a microbial cell, e.g., a bacterial or a fungal (including yeast) cell. Examples of suitable bacteria are gram-negative bacteria such as E. coli, or gram-positive bacteria such as Bacillus sp., e.g. Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Geobacillus stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus circulars, Bacillus lautus, Bacillus megaterium, Bacillus thuringiensis, or Streptomyces sp., e.g. Streptomyces lividans or Streptomyces murinus. A yeast organism may be selected from a species of Saccharomyces or Schizosaccharomyces, e.g. Saccharomyces cerevisiae, or from a filamentous fungus Aspergillus sp., e.g. Aspergillus oyzae or Aspergillus niger. The host cell is typically bacterial and preferably E. coli.

In a further aspect, a method of producing an Pol6 variant is provided, which method comprises cultivating a host cell as described above under conditions conducive to the production of the variant and recovering the variant from the cells and/or culture medium. The medium used to cultivate the cells may be any conventional medium suitable for growing the host cell in question and obtaining expression of the Pol6 variant. Suitable media are available from commercial suppliers or may be prepared according to published recipes (e.g., as described in catalogues of the American Type Culture Collection).

The Pol6 variant secreted from the host cells may conveniently be recovered from the culture medium by well-known procedures, including separating the cells from the medium by centrifugation or filtration, and precipitating proteinaceous components of the medium by means of a salt such as ammonium sulfate, followed by the use of chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like. In some embodiments, purification of the variant Pol6 may be obtained by affinity chromatography of Pol6 polypeptides linked to an affinity tag. Several affinity or epitope tags that can be used in the purification of the Pol6 variants include hexahistidine tag (SEQ ID NO: 9), FLAG tag, Strep II tag, streptavidin-binding peptide (SBP) tag, calmodulin-binding peptide (CBP), glutathione S-transferase (GST), maltose-binding protein (MBP), S-tag, HA tag, and c-Myc tag. In some embodiments, a hexahistidine tag (SEQ ID NO: 9) is used in the purification of Pol6. The affinity tag can be covalently attached to the variant Pol6 polypeptide by a protein linker. Alternatively, the affinity tag can be encoded by the nucleic acid that comprises the sequence encoding the variant Pol6, and be expressed as a fusion protein. For example, in some embodiments, a His6 tag (SEQ ID NO: 9) is expressed N-terminal to the variant Pol6 polypeptide (SEQ ID NO:2). In other embodiments, the His6 tag (SEQ ID NO: 9) can be expressed adjacent to a linker e.g. SpyCatcher, and N-terminal to the Pol6 to provide a His6-SpyCatcher-Pol6 polypeptide (SEQ ID NO:4). The SpyCatcher polypeptide can be covalently bound to a nanopore that comprises the SpyTag peptide AHIVMVDAYKPTK (SEQ ID NO:11).

Pol6 Nanopore Sequencing Complexes—Attachment of Pol6 to Nanopore

Nanopore sequencing with the aid of the variant Pol6 polymerases is accomplished by Pol6 nanopore sequencing complexes, which are formed by linking the variant Pol6 polymerase to a nanopore. In some embodiments, a variant Pol6 polymerase is contacted with the sample DNA template to form the Pol6-DNA complex, which is subsequently linked to a nanopore to form the Pol6 nanopore sequencing complex. In other embodiments, the Pol6 polymerase is first attached to the nanopore, and subsequently contacted with the sample DNA template to form the Pol6 nanopore sequencing complex. Methods for assembling nanopore sequencing complexes are described in U.S. Provisional Application No. 62/281,719 filed on Jan. 21, 2016.

Measurements of ionic current flow through a nanopore are made across a nanopore that have been reconstituted into a lipid membrane. In some instances, the nanopore is inserted in the membrane (e.g., by electroporation, by diffusion). The nanopore can be inserted by a stimulus signal such as electrical stimulus, pressure stimulus, liquid flow stimulus, gas bubble stimulus, sonication, sound, vibration, or any combination thereof. In some cases, the membrane is formed with aid of a bubble and the nanopore is inserted in the membrane with aid of an electrical stimulus. In other embodiments, the nanopore inserts itself into the membrane. Methods for assembling a lipid bilayer, forming a nanopore in a lipid bilayer, and sequencing nucleic acid molecules can be found in PCT Patent Publication Nos. WO2011/097028 and WO2015/061510, which are incorporated herein by reference in their entirety.

The variant Pol6 alone or when complexed as a Pol6-DNA template complex can be attached to the nanopore prior to the nanopore being inserted into the lipid membrane or following the insertion of the nanopore into the lipid membrane.

The nanopores of the Pol6 nanopore sequencing complex include without limitation biological nanopores, solid state nanopores, and hybrid biological-solid state nanopores. Biological nanopores of the Pol6 nanopore sequencing complexes include OmpG from E. coli, sp., Salmonella sp., Shigella sp., and Pseudomonas sp., and alpha hemolysin from S. aureus sp., MspA from M. smegmatis sp. The nanopores may be wild-type nanopores, variant nanopores, or modified variant nanopores.

Variant nanopores can be engineered to possess characteristics that are altered relative to those of the parental enzyme. See, for example, U.S. patent application Ser. No. 14/924,861 filed Oct. 28, 2015, entitled “alpha-Hemolysin Variants with Altered Characteristics” (which is incorporated by reference herein in its entirety). In some embodiments, the characteristics are altered relative to the wild-type enzyme. In some embodiments, the variant nanopore of the nanopore sequencing complex is engineered to reduce the ionic current noise of the parental nanopore from which it is derived. An example of a variant nanopore having an altered characteristic is the OmpG nanopore having one or more mutations at the constriction site (U.S. Provisional Patent Application No. 62/222,197, entitled “OmpG Variants”, filed on Sep. 22, 2015, which is incorporated by reference herein in its entirety), which decrease the ionic noise level relative to that of the parent OmpG. The reduced ionic current noise provides for the use of these OmpG nanopore variants in single molecule sensing of polynucleotides and proteins. In other embodiments, the variant OmpG polypeptide can be further mutated to bind molecular adapters, which while resident in the pore slow the movement of analytes, e.g., nucleotide bases, through the pore and consequently improve the accuracy of the identification of the analyte (Astier et al., J Am Chem Soc 10.1021/ja057123+, published online on Dec. 30, 2005).

Modified variant nanopores are typically multimeric nanopores whose subunits have been engineered to affect inter-subunit interaction (U.S. Provisional Patent Application Nos. 62/232,175 and 62/244,852, entitled “Alpha-Hemolysin Variants”, filed on Sep. 24, 2015 and Oct. 22, 2015, respectively, which are incorporated by reference herein in their entirety). Altered subunit interactions can be exploited to specify the sequence and order with which monomers oligomerize to form the multimeric nanopore in a lipid bilayer. This technique provides control of the stoichiometry of the subunits that form the nanopore. An example of a multimeric nanopore whose subunits can be modified to determine the sequence of interaction of subunits during oligomerization is an aHL nanopore.

In some embodiments, a single Pol6 polymerase is attached to each nanopore. In other embodiments, two or more Pol6 polymerase are attached to a monomeric nanopore or to a subunit of an oligomeric nanopore.

Means of Attaching

The variant Pol6 alone or when complexed as a Pol6-DNA template complex can be attached to the nanopore in any suitable way. Attaching enzyme-polymer complexes to nanopores may be achieved using the SpyTag/SpyCatcher peptide system (Zakeri et al. PNAS109:E690-E697 [2012]) native chemical ligation (Thapa et al., Molecules 19:14461-14483 [2014]), sortase system, (Wu and Guo, J Carbohydr Chem 31:48-66 [2012]; Heck et al., Appl Microbiol Biotechnol 97:461-475 [2013]), transglutaminase systems (Dennler et al., Bioconjug Chem 25:569-578 [2014]), formylglycine linkage (Rashidian et al., Bioconjug Chem 24:1277-1294 [2013]), or other chemical ligation techniques known in the art.

In some instances, the variant Pol6 polymerase is linked to the nanopore using Solulink™ chemistry. Solulink™ can be a reaction between HyNic (6-hydrazino-nicotinic acid, an aromatic hydrazine) and 4FB (4-formylbenzoate, an aromatic aldehyde). In some instances, the polymerase is linked to the nanopore using Click chemistry (available from LifeTechnologies, for example).

In some cases, zinc finger mutations are introduced into the nanopore molecule and then a molecule is used (e.g., a DNA intermediate molecule) to link the Pol6 polymerase to the zinc finger sites on the nanopore e.g. α-hemolysin.

Additionally, variant Pol6 alone or when complexed as a Pol6-DNA template complex enzyme-polymer complex, can be attached to a nanopore, e.g., aHL, OmpG, by means of a linker molecule that is attached to a nanopore at an attachment site. In some cases, the Pol6-DNA complex is attached to the nanopore with molecular staples. In some instances, molecular staples comprise three amino acid sequences (denoted linkers A, B and C). Linker A can extend from a nanopore monomer, Linker B can extend from the polymerase alone or from the polymerase of the polymerase-DNA complex, and Linker C then can bind Linkers A and B (e.g., by wrapping around both Linkers A and B) and thus linking the variant polymerase Pol6 alone or as variant Pol6-DNA complex to the nanopore. Linker C can also be constructed to be part of Linker A or Linker B, thus reducing the number of linker molecules.

Other linkers that may find use in attaching the variant Pol6 polymerase to a nanopore are direct genetic linkage (e.g., (GGGGS)1-3 amino acid linker (SEQ ID NO: 14)), transglutaminase mediated linking (e.g., RSKLG (SEQ ID NO: 15)), sortase mediated linking, and chemical linking through cysteine modifications. Specific linkers contemplated as useful herein are (GGGGS)1-3 (SEQ ID NO: 14), K-tag (RSKLG (SEQ ID NO: 15)) on N-terminus, ΔTEV site (12-25), ΔTEV site+N-terminus of SpyCatcher (12-49).

An exemplary method for attaching a Pol6-DNA complex to a nanopore in a membrane involves attaching a linker molecule to a nanopore or mutating a nanopore to have an attachment site and then attaching a polymerase-polynucleotide complex to the attachment site or attachment linker. The polymerase-polynucleotide complex is attached to the attachment site or attachment linker after the nanopore is inserted in the membrane. In some cases, a polymerase-polynucleotide complex is attached to each of a plurality of nanopores that are inserted into a membrane and disposed over wells and/or electrodes of a biochip.

In some embodiments, the enzyme of the enzyme-polymer complex is expressed as a fusion protein that comprises a linker peptide. In some embodiments, a polymerase is the enzyme of the enzyme-polymer complex, and a polynucleotide is the polymer. The polymerase of the polymerase-polynucleotide complex is expressed as a fusion protein that comprises a SpyCatcher polypeptide, which can be covalently bound to a nanopore that comprises a SpyTag peptide (Zakeri et al. PNAS109:E690-E697 [2012]).

A variant Pol6-DNA complex may be attached to a nanopore using methods described, for example, in PCT/US2013/068967 (published as WO2014/074727; Genia Technologies, Inc.), PCT/US2005/009702 (published as WO2006/028508; President and Fellows of Harvard College), and PCT/US2011/065640 (published as WO2012/083249; Columbia University).

Biochips

Nanopores of the variant Pol6 nanopore sequencing complexes described herein may be inserted in a membrane, e.g. a lipid bilayer, and disposed adjacent or in proximity to a sensing electrode of a sensing circuit, such as an integrated circuit of a nanopore based sensor, e.g., a biochip. The nanopore may be inserted in a membrane and disposed of a well and/or sensing electrodes in the biochip. Multiple nanopore sensors may be provided as arrays. Biochips and methods for making biochips are described in PCT/US2014/061854 (published as WO2015/061511, Genia Technologies, Inc.), which is herein incorporated by reference in its entirety.

In one aspect, a biochip comprising a plurality of Pol6 nanopore sequencing complexes as described elsewhere herein, is provided. The biochip can comprise nanopores each having a variant Pol6 polymerase having increased processivity relative to the parental Pol6. The variant Pol6 comprises a modification at one or more amino acid residues corresponding to amino acid residues V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585 of the Pol6 of SEQ ID NO:2. In some embodiments, the modification is a substitution to amino acid K, R, and/or H. In some embodiments, the substitution is a substitution to K. In some embodiments, the variant Pol6 comprises the substitution E585K. In other embodiments, the variant Pol6 comprises the substitution of two amino acids E585K+L731K. In yet other embodiments, the variant Pol6 comprises the substitution of two amino acids E585K+L731K. The amino acid substitutions can be made in a parental Pol6 polymerase that comprises a His6 tag (SEQ ID NO: 9) and a SpyCatcher peptide as given in the polymerase of SEQ ID NO:4.

The resulting variant Pol6 polymerases have increased processivity relative to their parental Pol6 polymerase. In some embodiments, the variant Pol6 polymerases have increased processivity at a high salt concentration. In some embodiments, the increased processivity is retained at a high salt concentration of 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800 mM or grater. In some embodiments, the increase in processivity is displayed at a high salt concentration of greater than 100 mM. The increase in processivity comprises a decrease in the rate of template dissociation that is at least 2-fold less that of the parent Pol6. Modifications of the parent Pol6 can produce variant Pol6 polymerases having a rate of dissociation from the template that is at least 3-fold less that of the parent Pol6, at least 4-fold less that of the parent Pol6, at least 5-fold less that of the parent Pol6, at least 6-fold less that of the parent Pol6, at least 7-fold less that of the parent Pol6, at least 8-fold less that of the parent Pol6, at least 9-fold less that of the parent Pol6, at least 10-fold less that of the parent Pol6.

For embodiments that include an array of nanopores in a membrane, e.g., lipid bilayer, the density of sequencing nanopore complexes can be high. High density arrays are characterized as having a membrane surface that has a density of Pol6 nanopore sequencing complexes greater or equal to about to about 500 nanopore sequencing complexes per 1 mm2. In some embodiments, the surface has a density of discrete nanopore sequencing complexes of about 100, about 200, about 300, about 400, about 500, about 600, about 700, about 800, about 900, about 1000, about 2000, about 3000, about 4000, about 5000, about 6000, about 7000, about 8000, about 9000, about 10000, about 20000, about 40000, about 60000, about 80000, about 100000, or about 500000 nanopore sequencing complexes per 1 mm2. In some embodiments, the surface has a density of discrete nanopore sequencing complexes of at least about 200, at least about 300, at least about 400, at least about 500, at least about 600, at least about 700, at least about 800, at least about 900, at least about 1000, at least about 2000, at least about 3000, at least about 4000, at least about 5000, at least about 6000, at least about 7000, at least about 8000, at least about 9000, at least about 10000, at least about 20000, at least about 40000, at least about 60000, at least about 80000, at least about 100000, or at least about 500000 nanopore sequencing complexes per 1 mm2.

The methods of the invention involve the measuring of a current passing through the pore during interaction with the nucleotide. In some embodiments, sequencing a nucleic acid molecule can require applying a direct current (e.g., so that the direction at which the molecule moves through the nanopore is not reversed). However, operating a nanopore sensor for long periods of time using a direct current can change the composition of the electrode, unbalance the ion concentrations across the nanopore and have other undesirable effects. Applying an alternating current (AC) waveform can avoid these undesirable effects and have certain advantages as described below. The nucleic acid sequencing methods described herein that utilized tagged nucleotides are fully compatible with AC applied voltages and can therefore be used to achieve said advantages.

Suitable conditions for measuring ionic currents through transmembrane protein pores are known in the art and examples are provided herein in the Experimental section. The method is carried out with a voltage applied across the membrane and pore. The voltage used is typically from −400 mV to +400 mV. The voltage used is preferably in a range having a lower limit selected from −400 mV, −300 mV, −200 mV, −150 mV, −100 mV, −50 mV, −20 mV and 0 mV and an upper limit independently selected from +10 mV, +20 mV, +50 mV, +100 mV, +150 mV, +200 mV, +300 mV and +400 mV. The voltage used is more preferably in the range 100 mV to 240 mV and most preferably in the range of 160 mV to 240 mV. It is possible to increase discrimination between different nucleotides by a pore of the invention by using an increased applied potential. Sequencing nucleic acids using AC waveforms and tagged nucleotides is described in U.S. Patent Publication 2014/0134616 entitled “Nucleic Acid Sequencing Using Tags”, filed on Nov. 6, 2013, which is herein incorporated by reference in its entirety. In addition to the tagged nucleotides described in U.S. 2014/0134616, sequencing can be performed using nucleotide analogs that lack a sugar or acyclic moiety e.g. (S)-Glycerol nucleoside triphosphates (gNTPs) of the four common nucleobases: adenine, cytosine, guanine, and thymidine (Horhota et al. Organic Letters, 8:5345-5347 [2006]).

Methods for Sequencing Polynucleotides

The molecules being characterized using the variant Pol6 polymerases of the Pol6 nanopore sequencing complexes described herein can be of various types, including charged or polar molecules such as charged or polar polymeric molecules. Specific examples include ribonucleic acid (RNA) and deoxyribonucleic acid (DNA) molecules. The DNA can be a single-strand DNA (ssDNA) or a double-strand DNA (dsDNA) molecule. Ribonucleic acid can be reversed transcribed then sequenced.

In one aspect, provided are methods for sequencing nucleic acids using the variant Pol6 polymerases described herein. In some embodiments, the methods comprise providing a variant Pol6 polymerase having a decreased rate of template dissociation, and attaching an isolated variant Pol6 polymerase-template complex to a nanopore inserted in a lipid membrane of a biochip to form a nanopore sequencing complex. In other embodiments, the sequencing methods comprise providing a variant Pol6 polymerase having a decreased rate of template dissociation, attaching the Pol6-template complex to a nanopore to provide a nanopore sequencing complex, and inserting the nanopore sequencing complex into a lipid membrane of a biochip.

The nanopore sequencing complexes comprising variant Pol6 polymerase can be used for determining the sequence of nucleic acids according to other nanopore sequencing platforms known in the art that utilize enzymes in the sequencing of polynucleotides. For example, nanopore sequencing complexes comprising the variant Pol6 polymerases described herein can be prepared according to the method described for sequencing nucleic acids according to the helicase and exonuclease-based methods of Oxford Nanopore (Oxford, UK), Illumina (San Diego, Calif.), and the nanopore sequencing-by-expansion of Stratos Genomics (Seattle, Wash.).

In some embodiments, sequencing of nucleic acids comprises preparing nanopore sequencing complexes comprising variant Pol6 polymerase enzyme described herein, and determining polynucleotide sequences using tagged nucleotides as is described in PCT/US2013/068967 (entitled “Nucleic Acid Sequencing Using Tags” filed on Nov. 7, 2013, which is herein incorporated by reference in its entirety). For example, a nanopore sequencing complex that is situated in a membrane (e.g., a lipid bilayer) adjacent to or in sensing proximity to one or more sensing electrodes, can detect the incorporation of a tagged nucleotide by a polymerase as the nucleotide base is incorporated into a strand that is complementary to that of the polynucleotide associated with the polymerase, and the tag of the nucleotide is detected by the nanopore. The variant Pol6-DNA complex can be associated with the nanopore as provided herein.

Tags of the tagged nucleotides can include chemical groups or molecules that are capable of being detected by a nanopore. Examples of tags used to provide tagged nucleotides are described at least at paragraphs [0414] to [0452] of PCT/US2013/068967. Nucleotides may be incorporated from a mixture of different nucleotides, e.g., a mixture of tagged dNTPs where N is adenosine (A), cytidine (C), thymidine (T), guanosine (G) or uracil (U). Alternatively, nucleotides can be incorporated from alternating solutions of individual tagged dNTPs, i.e., tagged dATP followed by tagged dCTP, followed by tagged dGTP, etc. Determination of a polynucleotide sequence can occur as the nanopore detects the tags as they flow through or are adjacent to the nanopore, as the tags reside in the nanopore and/or as the tags are presented to the nanopore. The tag of each tagged nucleotide can be coupled to the nucleotide base at any position including, but not limited to a phosphate (e.g., gamma phosphate), sugar or nitrogenous base moiety of the nucleotide. In some cases, tags are detected while tags are associated with a polymerase during the incorporation of nucleotide tags. The tag may continue to be detected until the tag translocates through the nanopore after nucleotide incorporation and subsequent cleavage and/or release of the tag. In some cases, nucleotide incorporation events release tags from the tagged nucleotides, and the tags pass through a nanopore and are detected. The tag can be released by the polymerase, or cleaved/released in any suitable manner including without limitation cleavage by an enzyme located near the polymerase. In this way, the incorporated base may be identified (i.e., A, C, G, T or U) because a unique tag is released from each type of nucleotide (i.e., adenine, cytosine, guanine, thymine or uracil). In some situations, nucleotide incorporation events do not release tags. In such a case, a tag coupled to an incorporated nucleotide is detected with the aid of a nanopore. In some examples, the tag can move through or in proximity to the nanopore and be detected with the aid of the nanopore.

In some cases, tagged nucleotides that are not incorporated pass through the nanopore. The method can distinguish between tags associated with un-incorporated nucleotides and tags associated with incorporated nucleotides based on the length of time the tagged nucleotide is detected by the nanopore. In one embodiment, an un-incorporated nucleotide is detected by the nanopore for less than about 1 millisecond and an incorporated nucleotide is detected by the nanopore for at least about 1 millisecond.

Thus, in one aspect, the disclosure provides for a method for sequencing a polynucleotide from a sample, e.g. a biological sample, with the aid of a variant Pol6 polymerase nanopore sequencing complex. The sample polynucleotide is combined with the variant Pol6 polymerase, to provide the variant Pol6 enzyme-polymer complex portion of the nanopore sequencing complex. In one embodiment, the sample polynucleotide is a sample ssDNA strand, which is combined with a DNA polymerase to provide a DNA polymerase-DNA complex. The variant Pol6 DNA polymerase-sample ssDNA strand is subsequently attached to a nanopore that has been inserted into a membrane e.g. a lipid bilayer, to provide the nanopore sequencing complex. The nanopore portion of the sequencing complex is positioned in the membrane adjacent to or in proximity of a sensing electrode, as described elsewhere herein. The resulting nanopore sequencing complex is capable of determining the sequence of nucleotide bases of the sample DNA as described elsewhere herein. In other embodiments, the nanopore sequencing complex determines the sequence of double stranded DNA. In other embodiments, the nanopore sequencing complex determines the sequence of single stranded DNA. In yet other embodiments, nanopore sequencing complex determines the sequence of RNA by sequencing the reverse transcribed product. In one embodiment, the method provides for sequencing a nucleic acid sample with the aid of a biochip comprising a plurality of Pol6 nanopore sequencing complexes.

In some embodiments, a method for nanopore sequencing a nucleic acid sample is provided. The method comprises using nanopore sequencing complexes comprising the variant Pol6 polymerases provided herein. In one embodiment, the method comprises providing tagged nucleotides to a Pol6 nanopore sequencing complex, and under high salt conditions, carrying out a polymerization reaction to incorporate the nucleotides in a template-dependent manner, and detecting the tag of each of the incorporated nucleotides to determine the sequence of the template DNA.

In one embodiment, tagged nucleotides are provided to a Pol6 nanopore sequencing complex comprising a variant Pol6 polymerase provided herein, and under conditions of high salt, carrying out a polymerization reaction with the aid of the variant Pol6 enzyme of said nanopore sequencing complex, to incorporate tagged nucleotides into a growing strand complementary to a single stranded nucleic acid molecule from the nucleic acid sample; and detecting, with the aid of nanopore, a tag associated with said individual tagged nucleotide during incorporation of the individual tagged nucleotide, wherein the tag is detected with the aid of said nanopore while the nucleotide is associated with the variant Pol6 polymerase.

Other embodiments of the sequencing method that comprise the use of tagged nucleotides with the present nanopore sequencing complexes for sequencing polynucleotides are provided in WO2014/074727, which is incorporated herein by reference in its entirety.

Sequencing nucleic acids using AC waveforms and tagged nucleotides is described in U.S. Patent Publication 2014/0134616 entitled “Nucleic Acid Sequencing Using Tags”, filed on Nov. 6, 2013, which is herein incorporated by reference in its entirety. In addition to the tagged nucleotides described in U.S. 2014/0134616, sequencing can be performed using nucleotide analogs that lack a sugar or acyclic moiety, e.g., (S)-Glycerol nucleoside triphosphates (gNTPs) of the five common nucleobases: adenine, cytosine, guanine, uracil, and thymidine (Horhota et al. Organic Letters, 8:5345-5347 [2006]).

Reagents and Kits

Sequencing reagents for DNA sequencing or amplification e.g. nanopore sequencing are also provided, the reagent(s) comprising a variant Pol6 polymerase having at least 70% identity to full-length parent polypeptide of SEQ ID NO:2 that comprises one or more amino acid substitutions of amino acid residues corresponding to amino acids V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585 of SEQ ID NO:2. In some embodiments, the amino acids substitution(s) is to K, R, and/or H. In some embodiments, the sequencing reagent comprises the variant Pol6 polymerase of SEQ ID NO:6, SEQ ID NO:7 or SEQ ID NO:8. In some embodiments, the sequencing reagent comprises a polynucleotide encoding any one of the variant salt tolerant Pol6 polymerases provided herein.

In another aspect, provided is a kit comprising a sequencing reagent for DNA sequencing provided herein. In some embodiments, the kit further comprises a buffer and/or nucleotides.

In the experimental disclosure which follows, the following abbreviations apply: eq (equivalents); M (Molar); μM (micromolar); N (Normal); mol (moles); mmol (millimoles); μmol (micromoles); nmol (nanomoles); g (grams); mg (milligrams); kg (kilograms); μg (micrograms); L (liters); ml (milliliters); μl (microliters); cm (centimeters); mm (millimeters); μm (micrometers); nm (nanometers); ° C. (degrees Centigrade); h (hours); min (minutes); sec (seconds); msec (milliseconds).

EXAMPLES

The following examples are offered to illustrate, but not to limit the claimed invention. It is understood that the examples and embodiments described herein are for illustrative purposes only and that various modifications or changes in light thereof will be suggested to persons skilled in the art and are to be included within the spirit and purview of this application and scope of the appended claims. All publications, patents, and patent applications cited herein are hereby incorporated by reference in their entirety for all purposes.

EXAMPLE 1 Directed Mutagenesis

Site directed mutagenesis was performed to mutate one or more amino acids of the putative DNA binding site of parental variant Pol6-44-X1 polymerase (SEQ ID NO:4). Pol6-44-X1 was derived from wild-type Pol6 to comprise the following substitutions: (Pol6-S366A T529M A547F D44A).

DNA of SEQ ID NO:4 encoding the variant polymerase pol6-44-X1 (SEQ ID NO:5) was purchased from a commercial source (DNA 2.0, Menlo Park, Calif.). The sequence was verified by sequencing.

The Pol6-44-X1 was expressed as a fusion protein having an N-terminal His-tag (underlined sequence in SEQ ID NO:4) and SpyCatcher domain (bolded italic sequence in SEQ ID NO:4).

The Pol6-44-X1 polymerase variant (SEQ ID NO:4) was derived from wild-type pol6 (SEQ ID NO:2), and the numbering of the amino acid mutations described for Pol6-D44A-X1 refer to the amino acid positions of SEQ ID NO:2. Rational positions to impact Pol6 processivity were identified based on analysis of Phi 29 crystal structure in its apo form, DNA bound form and DNA-nucleotide form (Berman et al. 2007).

For the primary screen, each of the rational positions were mutated to Lys (K) using the New England Biolabs Q5 mutagenesis protocol (Ipswich, Mass.). The following amino acids were mutated to Lys: V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585.

Combinations of substitutions to Lys (K) at two or more of amino acids V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, Y338, T339, G340, G341, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A436, Y441, G559, T560, Q662, N563, E566, E565, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, Y596, E587, G588, E590, F591, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, A694, L708, G709, Q717, R718, V721, I734, I737, M738, F739, D693, L731, F732, T733, T287, G288, M289, R290, T291, A292, S293, S294, I295, Y342, V436, S437, G438, Q439, E440, and E585, were also generated.

The primers for each mutagenesis reaction was designed using the NEB base changer protocol and ordered in 96-well plate format from IDT.

The forward and reverse primers were 5′ phosphorylated in high throughput (HTP) format using the T4 polynucleotide kinase (PNK) purchased from NEB. A typical 25-μl reaction contained 15 μl of primer at 10 μM, 5 μl of 5X reaction buffer (from NEB), 1.25 μl PNK enzyme, 3.75 μl water. The reaction was performed at 37° C. for 30 min and the enzyme heat inactivated at 65° C. for 20 min.

PCR mutagenesis was performed using Q5 DNA polymerase from NEB. A typical 25 μl reaction contained 5 μl of Q5 buffer, 5 μl of GC enhancer, 0.5 μl of 10 mM dNTPs, 1.25 μl of 10 μM phosphorylated mutagenesis primers forward and reverse, 0.25 μl Q5 polymerase and 1 μl of 5 ng/ml wild type Pol6 template, i.e., His-Pol6, and 10.75 μl H20.

Once PCR was completed, 0.5 μl of Dpn1 was added to 25 μl PCR mix and incubated at 37° C. for 1 hr.

2.5 μl of Blunt/TA ligase master mix were added to 2.5 μl of Dpn1 treated PCR product, and the reaction mixture was incubated at room temperature for 1 hr.

1 μl of ligation mix was added to 20 ul of 96-well BL21DE3 cells (EMD Millipore) and incubated on ice for 5 min.

The cells were heat shocked at 42° C. for exactly 30 sec using the PCR thermocycler and placed on ice for 2 min.

80 μl of SOC were added to the cells, which were then incubated at 37° C. for 1 hr without shaking.

100 μl of SOC or ultra pure water were added to the cells, which were then plated on 48-well LB-agar plates comprising 50-100 μg/ml kanamycin. Cells were grown overnight at 37° C.

EXAMPLE 2 Expression and Purification

Variants of the parental polymerase Pol6-44-X1 (SEQ ID NO:4) were expressed and purified using a high throughput method as follows.

DNA encoding variants in expression plasmid pD441 vector was transformed into competent E. coli, and glycerol stocks of the transformed cells were made. Starting from a tiny pick of the glycerol stock, grow 1 ml starter culture in LB with 0.2% Glucose and 100 μg/ml Kanamycin for approximately 8 hrs. Transfer 25 μl of log phase starter culture into 1 ml of expression media (Terrific Broth (TB) autoinduction media supplemented with 0.2% glucose, 50 mM Potassium Phosphate, 5 mM MgCl2 and 100 μg/ml Kanamycin) in 96-deep well plates. The plates were incubated with shaking at 250-300 rpm for 36-40 hrs at 28° C.

Cells were then harvested via centrifugation at 3200×g for 30 minutes at 4° C. The media was decanted off and the cell pellet resuspended in 200 μl pre-chilled lysis buffer (20 mM Potassium Phosphate pH 7.5, 100 mM NaCl, 0.5% Tween20, 5 mM TCEP, 10 mM Imidazole, 1 mM PMSF, 1×Bug Buster, 100 μg/ml Lysozyme and protease inhibitors) and incubate at room temperature for 20 min with mild agitation. Then add 20 μl from a 10× stock to a final concentration of 100 μg/ml DNase, 5 mM MgCl2, 100 μg/ml RNase I and incubate in on ice for 5-10 min to produce a lysate. Supplement the lysate with 200 μl of 1M Potassium Phosphate, pH 7.5 (Final concentration will be about 0.5M Potassium phosphate in 400 μl lysate) and filter through Pall filter plates (Part# 5053, 3 micron filters) via centrifugation at approximately 1500 rpm at 4 C for 10 minutes. The clarified lysates were then applied to equilibrated 96-well His-Pur Cobalt plates (Pierce Part# 90095) and bind for 15-30 min.

The flow through (FT) was collected by centrifugation at 500×G for 3 min. The FT was then washed 3 times with 400 ul of wash buffer 1 (0.5M Potassium Phosphate pH 7.5, 1M NaCl 5 mM TCEP, 20 mM Imidazole+0.5% Tween20). The FT was then washed twice in 400 ul wash buffer 2 (50 mM Tris pH 7.4, 200 mM KCl, 5 mM TCEP, 0.5% Tween20, 20 mM Imidazole).

The Pol6 was eluted using 200 μl elution buffer (50mM Tris pH 7.4, 200 mM KCl, 5 mM TCEP, 0.5% Tween20, 300 mM Imidazole, 25% Glycerol) and collected after 1-2 min incubation. Reapply eluate to the same His-Pur plate2-3 times to get concentrated Pol6 in elute. The purified polymerase is >95% pure as evaluated by SDS-PAGE. The protein concentration is ˜3 uM (0.35 mg/ml) with a 260/280 ratio of 0.6 as evaluated by Nanodrop.

Polymerase processivity was verified by fluorescence displacement assay (see Example 3) as a function of the rate of dissociation from the polynucleotide template.

EXAMPLE 3 Static Processivity Assay

The effect of mutations of amino acids of the DNA-binding site of variant polymerase Pol6-44-X1 i.e. Pol6-44-D44A, on the processivity of the variant polymerase was analyzed using a statitc processivity assay whereby the dissociation of DNA template from the variant polymerases was determined in the absence of polynucleotide synthesis.

The assay is a FRET assay whereby fluorescence emitted by a fluorogenic DNA template substrate is measured in the presence of non-fluorogenic competing DNA template. Referring to FIG. 2, the FRET assay uses a fuorogenic DNA template comprising Cy5 fluorophore-labelled DNA template (5′-/Cy5/AGA GTG ATA GTA TGA TTA TGT AGA TGT AGG ATT TGA TAT GTG AGT AGC CGA ATG AAA CCT T/iSpC3/TT GGT TTC ATT CGG-3′) (SEQ ID NOS12 and 16)), and having bound to it a complementary oligonucleotide comprising a quencher 3BHQ-2 (5′-TTT TCA TAA TCA TAC TAT CAC TCT/3 BHQ_2/-3′ (SEQ ID NO:13)). A DNA polymerase is incubated with the template-oligonucleotide to form a polymerase-template-oligonucleotide complex. The rate of dissociation of the variant polymerase form the template-oligonucleotide complex is measured over as the variant polymerase is displaced over time by a competing non-fluorogenic DNA template JAM1G. The amount of undisplaced polymerase-template-oligonucleotide complex is then determined by extending the hairpin template, and measuring the level of fluorescence as the oligonucleotide is displaced.

An assay buffer comprising 208.3 mM HEPES pH7.5, 75 mMKglu, 3.0 mM EDTA, 0.4% Triton X-100, 41.7 mM TCEP, 208.3 u/ml BSA, and 750 nM hairpin Cy5-labeled DNA template, was used to prepare a working stock of Reagent A.

Three to five microliters of polymerase variant were mixed with twenty-one microliters of Reagent A (Reagent A:Pol variant=3:5), and incubated for 30 minutes at room temperature to allow for the formation of polymerase-DNA template/oligonucleotide complexes.

Following the incubation, 8 ul of the solution comprising the polymerase-DNA template/oliogonucleotide complexes were added to each of the wells of a 96-well costar half-area plate.

Seventeen microliters of a stock solution of “Salt & Chase” reagent comprising competing DNA template (488 mM KGlu, and 2.7 mM chaser DNA template JamG1) were added to each of the wells containing the polymerase-DNA/oligonucleotide template mix. The mixture was placed in a plate reader BMG polarstar (BMG Labtech, Cary, N.C.).

Twenty microliters of Reagent B (25 mM HepES pH7.5, 500 mM K-glu, 0.05% Triton-X 100, 5 mM TCEP, 25 ug/ul BSA, 20 uM dN6P, and 5 mM MgCl2) were added to the complexes in the wells to initiate the extension of the DNA template, and the resulting fluorescence was measured at time=0, 30 minutes, 60 minutes, 90 minutes, 120 minutes and 180 minutes.

Baseline fluorescence value was subtracted from all values, and the percent amplitude calculated, where the maximum amplitude at Time T=0 is 100%; amplitude at Time T=30 mins Amplitude=(Amp @ T=30/Amp @ T=0)%. The rate of dissociation was then calculated as the slope of the curve. The results are provided in Table 1 below.

TABLE 1 Template dissociation rate Fold Mutants (min−1, 500 mM K-glu) difference (A) Pol6-44 D44A (SEQ ID NO: −0.00456 1.0 4) (B) Pol 6-44 D44A E585K (SEQ −0.00201 2.3 ID NO: 6 (C) Pol-6-44-D44A_E585K + −0.00077 5.9 L731K (SEQ ID NO: 7) (D) Pol-6-44-D44A_E585K + −0.00084 5.4 M738K (SEQ ID NO: 8)

The dissociation curves for parental Pol6-44-X1 polymerase, and variants thereof: Pol6-44-X1-E585K, Pol6-44-X1-E585K-L731K, and Pol6-44-X1-E585K-M738K, are shown in FIG. 3A, 3B, 3C and 3D, respectively.

The data show that variant polymerase Pol6 comprising mutations that substitute one or more amino acids of the DNA binding site with a positively charged amino acid e.g. lysine (K), display a decrease in the rate of dissociation from the DNA template, and therefore increased processivity. Accordingly, these variant polymerases are also expected to have increased sequencing life time, and to increase the length of the reads during sequencing events.

EXAMPLE 4 Attachment to Nanopore

This example provides methods of attaching a variant polymerase to a nanopore, e.g., α-hemolysin, OmpG.

The pol6 variant SpyCatcher HisTag (SEQ ID NO:4) was expressed according to Example 2 and purified using a cobalt affinity column. The SpyCatcher polymerase and a SpyTag-nanopore protein are incubated overnight at 4° C. in 3 mM SrCl2to form the polymerase-nanopore complex. The polymerase-template complex is formed, purified, and attached to a nanopore to form nanopore sequencing complexes. Methods for preparing and purifying polymerase-template complexes are described in U.S. Provisional application “Purification of Polymerase Complexes” 62/260,194 filed on Nov. 25, 2015, which is herein incorporated by reference in its entirety. Nanopore sequencing complexes can be formed by sequential binding of variant polymerase to nanopore to form an enzyme—nanopore complex, followed by association of template to form the nanopore sequencing complex. Alternatively, nanopore sequencing complexes can be formed by first associating the template with the variant polymerase to form a template-enzyme complex, and subsequently attaching the template-enzyme complex to the nanopore. Methods for forming nanopore sequencing complexes are described in U.S. Provisonal Application 62/281,719 filed on Jan. 21, 2016, which is herein incorporated by reference in its entirety.

A polymerase can be coupled to the nanopore by any suitable means. See, for example, PCT/US2013/068967 (published as WO2014/074727; Genia Technologies, Inc.), PCT/US2005/009702 (published as WO2006/028508; President and Fellows of Harvard College), and PCT/US2011/065640 (published as WO2012/083249; Columbia University).

A variant pol6 DNA polymerase, is coupled to a protein nanopore (e.g. alpha-hemolysin, OmpG), through a linker molecule. Specifically, the SpyTag and SpyCatcher system that spontaneously forms covalent isopeptide linkages under physiological conditions is used. See, for example, Li et al, J Mol Biol. 2014 Jan. 23; 426(2):309-17.

EXAMPLE 5 Nanopore Sequencing

The ability of a nanopore-bound variant Pol6 polymerase to bind tagged nucleotides and thereby allow for the detection of blocked channel currents at the nanopore to which the polymerase is attached, was determined. Increased processivity of the variant Pol6 polymerases was compared to that of the parent Pol6 lacking the modifications of the variant enzyme.

The variant Pol6 polymerase is contacted with DNA template to form variant Pol6-DNA complex, which is subsequently attached to a nanopore embedded in a lipid bilayer over a well on a semiconductor sensor chip, also called a biochip. The lipid bilayer is formed and the nanopore with attached variant Pol6 polymerase-DNA complex i.e. the variant Pol6 nanopore sequencing complex, is inserted as described in PCT/US2014/061853 (entitled “Methods for Forming Lipid Bilayers on Biochips” and filed 22 Oct. 2014).

Alternatively, the nanopore is embedded into the lipid bilayer, and the variant Pol6-DNA complex is attached in situ.

A mixture of tagged nucleotides, where the tag is a polymer of 30 thymine nucleotides (T30) consisting of 3 uM T-T30, 3 uM C-T30, 3 uM G-T30, and 3 uM A-T30, in static conditions (500 mM KGlu, 3 mM CaCl2, 20 mM HEPES, pH8.0), is flowed over the nanopores at a rate of 0.834 ul/second.

An alternating current of 210 mV peak to peak is applied at 25 Hz, and capture of nucleotide tags is assessed as nucleotide bases are incorporated into the copied DNA strand by the nanopore-bound polymerase.

Processivity of the variant Pol6 is compared to that of the unmodified parental Pol6 to determine an increase in read-length, and/or speed of polynucleotide synthesis, and/or a decrease in sequencing error.

SEQUENCE LISTING FREE TEXT SEQ ID NO: 1 - Wild-type Pol6 (DNA polymerase [Clostridium phage phiCPV4]; GenBank: AFH27113.1) 001 mdkhtqyvke hsfnydeykk anfdkiecli fdtesctnye ndntgarvyg wglgvtrnhn 061 miygqnlnqf wevcqnifnd wyhdnkhtik itktkkgfpk rkyikfpiav hnlgwdvefl 121 kyslvengfn ydkgllktvf skgapyqtvt dveepktfhi vqnnnivygc nvymdkffev 181 enkdgsttei glcldffdsy kiitcaesqf hnyvhdvdpm fykmgeeydy dtwrspthkq 241 ttlelryqyn diymlrevie qfyidglcgg elpltgmrta ssiafnvlkk mtfgeektee 301 gyinyfeldk ktkfeflrkr iemesytggy thanhkavgk tinkigcsld inssypsqma 361 ykvfpygkpv rktwgrkpkt eknevyliev gfdfvepkhe eyaldifkig avnskalspi 421 tgavsgqeyf ctnikdgkai pvykelkdtk lttnynvvlt sveyefwikh fnfgvfkkde 481 ydcfevdnle ftglkigsil yykaekgkfk pyvdhftkmk venkklgnkp ltnqakliln 541 gaygkfgtkq nkeekdlimd knglltftgs vteyegkefy rpyasfvtay grlqlwnaii 601 yavgvenfly cdtdsiycnr evnsliedmn aigetidkti lgkwdvehvf dkfkvlgqkk 661 ymyhdckedk tdlkccglps darkiiigqg fdefylgknv egkkqrkkvi ggcllldtlf 721 tikkimf* SEQ ID NO: 2 - Pol6 (with His tag) MHHHHHHHHS GGSDKHTQYV KEHSFNYDEY KKANFDKIEC LIFDTESCTN 50 YENDNTGARV YGWGLGVTRN HNMIYGQNLN QFWEVCQNIF NDWYHDNKHT 100 IKITKTKKGF PKRKYIKFPI AVHNLGWDVE FLKYSLVENG FNYDKGLLKT 150 VFSKGAPYQT VTDVEEPKTF HIVQNNNIVY GCNVYMDKFF EVENKDGSTT 200 EIGLCLDFFD SYKIITCAES QFHNYVHDVD PMFYKMGEEY DYDTWRSPTH 250 KQTTLELRYQ YNDIYMLREV IEQFYIDGLC GGELPLTGMR TASSIAFNVL 300 KKMTFGEEKT EEGYINYFEL DKKTKFEFLR KRIEMESYTG GYTHANHKAV 350 GKTINKIGCS LDINSSYPSQ MAYKVFPYGK PVRKTWGRKP KTEKNEVYLI 400 EVGFDFVEPK HEEYALDIFK IGAVNSKALS PITGAVSGQE YFCTNIKDGK 450 AIPVYKELKD TKLTTNYNVV LTSVEYEFWI KHFNFGVFKK DEYDCFEVDN 500 LEFTGLKIGS ILYYKAEKGK FKPYVDHFTK MKVENKKLGN KPLTNQAKLI 550 LNGAYGKFGT KQNKEEKDLI MDKNGLLTFT GSVTEYEGKE FYRPYASFVT 600 AYGRLQLWNA IIYAVGVENF LYCDTDSIYC NREVNSLIED MNAIGETIDK 650 TILGKWDVEH VFDKFKVLGQ KKYMYHDCKE DKTDLKCCGL PSDARKIIIG 700 QGFDEFYLGK NVEGKKQRKK VIGGCLLLDT LFTIKKIMF* 739 SEQ ID NO: 3 - Pol6 with His-tag (DNA sequence) ATGCATCACCATCATCATCACCACCACAGC GGCGGTTCCG ACAAACACAC 50 GCAGTACGTC AAAGAGCATA GCTTCAATTA TGACGAGTAT AAGAAAGCGA 100 ATTTCGACAA GATCGAGTGC CTGATCTTTG ACACCGAGAG CTGCACGAAT 150 TATGAGAACG ATAATACCGG TGCACGTGTT TACGGTTGGG GTCTTGGCGT 200 CACCCGCAAC CACAATATGA TCTACGGCCA AAATCTGAAT CAGTTTTGGG 250 AAGTATGCCA GAACATTTTC AATGATTGGT ATCACGACAA CAAACATACC 300 ATTAAGATTA CCAAGACCAA GAAAGGCTTC CCGAAACGTA AGTACATTAA 350 GTTTCCGATT GCAGTTCACA ATTTGGGCTG GGATGTTGAA TTCCTGAAGT 400 ATAGCCTGGT GGAGAATGGT TTCAATTACG ACAAGGGTCT GCTGAAAACT 450 GTTTTTAGCA AGGGTGCGCC GTACCAAACC GTGACCGATG TTGAGGAACC 500 GAAAACGTTC CATATCGTCC AGAATAACAA CATCGTTTAT GGTTGTAACG 550 TGTATATGGA CAAATTCTTT GAGGTCGAGA ACAAAGACGG CTCTACCACC 600 GAGATTGGCC TGTGCTTGGA TTTCTTCGAT AGCTATAAGA TCATCACGTG 650 TGCTGAGAGC CAGTTCCACA ATTACGTTCA TGATGTGGAT CCAATGTTCT 700 ACAAAATGGG TGAAGAGTAT GATTACGATA CTTGGCGTAG CCCGACGCAC 750 AAGCAGACCA CCCTGGAGCT GCGCTACCAA TACAATGATA TCTATATGCT 800 GCGTGAAGTC ATCGAACAGT TTTACATTGA CGGTTTATGT GGCGGCGAGC 850 TGCCGCTGAC CGGCATGCGC ACCGCTTCCA GCATTGCGTT CAACGTGCTG 900 AAAAAGATGA CCTTTGGTGA GGAAAAGACG GAAGAGGGCT ACATCAACTA 950 TTTTGAATTG GACAAGAAAA CCAAATTCGA GTTTCTGCGT AAGCGCATTG 1000 AAATGGAATC GTACACCGGT GGCTATACGC ACGCAAATCA CAAAGCCGTT 1050 GGTAAGACTA TTAACAAGAT CGGTTGCTCT TTGGACATTA ACAGCTCATA 1100 CCCTTCGCAG ATGGCGTACA AGGTCTTTCC GTATGGCAAA CCGGTTCGTA 1150 AGACCTGGGG TCGTAAACCA AAGACCGAGA AGAACGAAGT TTATCTGATT 1200 GAAGTTGGCT TTGACTTCGT GGAGCCGAAA CACGAAGAAT ACGCGCTGGA 1250 TATCTTTAAG ATTGGTGCGG TGAACTCTAA AGCGCTGAGC CCGATCACCG 1300 GCGCTGTCAG CGGTCAAGAG TATTTCTGTA CGAACATTAA AGACGGCAAA 1350 GCAATCCCGG TTTACAAAGA ACTGAAGGAC ACCAAATTGA CCACTAACTA 1400 CAATGTCGTG CTGACCAGCG TGGAGTACGA GTTCTGGATC AAACACTTCA 1450 ATTTTGGTGT GTTTAAGAAA GACGAGTACG ACTGTTTCGA AGTTGACAAT 1500 CTGGAGTTTA CGGGTCTGAA GATTGGTTCC ATTCTGTACT ACAAGGCAGA 1550 GAAAGGCAAG TTTAAACCTT ACGTGGATCA CTTCACGAAA ATGAAAGTGG 1600 AGAACAAGAA ACTGGGTAAT AAGCCGCTGA CGAATCAGGC AAAGCTGATT 1650 CTGAACGGTG CGTACGGCAA ATTCGGCACC AAACAAAACA AAGAAGAGAA 1700 AGATTTGATC ATGGATAAGA ACGGTTTGCT GACCTTCACG GGTAGCGTCA 1750 CGGAATACGA GGGTAAAGAA TTCTATCGTC CGTATGCGAG CTTCGTTACT 1800 GCCTATGGTC GCCTGCAACT GTGGAACGCG ATTATCTACG CGGTTGGTGT 1850 GGAGAATTTT CTGTACTGCG ACACCGACAG CATCTATTGT AACCGTGAAG 1900 TTAACAGCCT CATTGAGGAT ATGAACGCCA TTGGTGAAAC CATCGATAAA 1950 ACGATTCTGG GTAAATGGGA CGTGGAGCAT GTCTTTGATA AGTTTAAGGT 2000 CCTGGGCCAG AAGAAGTACA TGTATCATGA TTGCAAAGAA GATAAAACGG 2050 ACCTGAAGTG TTGCGGTCTG CCGAGCGATG CCCGTAAGAT TATCATTGGT 2100 CAAGGTTTCG ACGAGTTTTA TCTGGGCAAA AATGTCGAAG GTAAGAAGCA 2150 ACGCAAAAAA GTGATCGGCG GTTGCCTGCT GCTGGACACC CTGTTTACGA 2200 TCAAGAAAAT CATGTTCTAA 2220 SEQ ID NO: 4 - Pol6-44-X1 with His-tag/SpyCatcher MHHHHHHHH       50         100        GGSDKHTQYV 150 KEHSFNYDEY KKANFDKIEC LIFATESCTN YENDNTGARV YGWGLGVTRN 200 HNMIYGQNLN QFWEVCQNIF NDWYHDNKHT IKITKTKKGF PKRKYIKFPI 250 AVHNLGWDVE FLKYSLVENG FNYDKGLLKT VFSKGAPYQT VTDVEEPKTF 300 HIVQNNNIVY GCNVYMDKFF EVENKDGSTT EIGLCLDFFD SYKIITCAES 350 QFHNYVHDVD PMFYKMGEEY DYDTWRSPTH KQTTLELRYQ YNDIYMLREV 400 IEQFYIDGLC GGELPLTGMR TASSIAFNVL KKMTFGEEKT EEGYINYFEL 450 DKKTKFEFLR KRIEMESYTG GYTHANHKAV GKTINKIGCS LDINSAYPSQ 500 MAYKVFPYGK PVRKTWGRKP KTEKNEVYLI EVGFDFVEPK HEEYALDIFK 550 IGAVNSKALS PITGAVSGQE YFCTNIKDGK AIPVYKELKD TKLTTNYNVV 600 LTSVEYEFWI KHFNFGVFKK DEYDCFEVDN LEFTGLKIGS ILYYKAEKGK 650 FKPYVDHFMK MKVENKKLGN KPLTNQFKLI LNGAYGKFGT KQNKEEKDLI 700 MDKNGLLTFT GSVT YEGKE FYRPYASFVT AYGRLQLWNA IIYAVGVENF 750 LYCDTDSIYC NREVNSLIED MNAIGETIDK TILGKWDVEH VFDKFKVLGQ 800 KKYMYHDCKE DKTDLKCCGL PSDARKIIIG QGFDEFYLGK NVEGKKQRKK 850 VIGGCLLLDT  FTIKKI E* 869 SEQ ID NO: 5 - Pol6-44-X1 with His-tag/SpyCatcher (DNA sequence) ATGCATCACC ATCATCATCA CCACCAC 50    CTGAGCGGTC 100     150 200 250 300 350 400  GGCGGTTCCG ACAAACACAC GCAGTACGTC 450 AAAGAGCATA GCTTCAATTA TGACGAGTAT AAGAAAGCGA ATTTCGACAA 500 GATCGAGTGC CTGATCTTTG CGACCGAGAG CTGCACGAAT TATGAGAACG 550 ATAATACCGG TGCACGTGTT TACGGTTGGG GTCTTGGCGT CACCCGCAAC 600 CACAATATGA TCTACGGCCA AAATCTGAAT CAGTTTTGGG AAGTATGCCA 650 GAACATTTTC AATGATTGGT ATCACGACAA CAAACATACC ATTAAGATTA 700 CCAAGACCAA GAAAGGCTTC CCGAAACGTA AGTACATTAA GTTTCCGATT 750 GCAGTTCACA ATTTGGGCTG GGATGTTGAA TTCCTGAAGT ATAGCCTGGT 800 GGAGAATGGT TTCAATTACG ACAAGGGTCT GCTGAAAACT GTTTTTAGCA 850 AGGGTGCGCC GTACCAAACC GTGACCGATG TTGAGGAACC GAAAACGTTC 900 CATATCGTCC AGAATAACAA CATCGTTTAT GGTTGTAACG TGTATATGGA 950 CAAATTCTTT GAGGTCGAGA ACAAAGACGG CTCTACCACC GAGATTGGCC 1000 TGTGCTTGGA TTTCTTCGAT AGCTATAAGA TCATCACGTG TGCTGAGAGC 1050 CAGTTCCACA ATTACGTTCA TGATGTGGAT CCAATGTTCT ACAAAATGGG 1100 TGAAGAGTAT GATTACGATA CTTGGCGTAG CCCGACGCAC AAGCAGACCA 1150 CCCTGGAGCT GCGCTACCAA TACAATGATA TCTATATGCT GCGTGAAGTC 1200 ATCGAACAGT TTTACATTGA CGGTTTATGT GGCGGCGAGC TGCCGCTGAC 1250 CGGCATGCGC ACCGCTTCCA GCATTGCGTT CAACGTGCTG AAAAAGATGA 1300 CCTTTGGTGA GGAAAAGACG GAAGAGGGCT ACATCAACTA TTTTGAATTG 1350 GACAAGAAAA CCAAATTCGA GTTTCTGCGT AAGCGCATTG AAATGGAATC 1400 GTACACCGGT GGCTATACGC ACGCAAATCA CAAAGCCGTT GGTAAGACTA 1450 TTAACAAGAT CGGTTGCTCT TTGGACATTA ACAGCGCGTA CCCTTCGCAG 1500 ATGGCGTACA AGGTCTTTCC GTATGGCAAA CCGGTTCGTA AGACCTGGGG 1550 TCGTAAACCA AAGACCGAGA AGAACGAAGT TTATCTGATT GAAGTTGGCT 1600 TTGACTTCGT GGAGCCGAAA CACGAAGAAT ACGCGCTGGA TATCTTTAAG 1650 ATTGGTGCGG TGAACTCTAA AGCGCTGAGC CCGATCACCG GCGCTGTCAG 1700 CGGTCAAGAG TATTTCTGTA CGAACATTAA AGACGGCAAA GCAATCCCGG 1750 TTTACAAAGA ACTGAAGGAC ACCAAATTGA CCACTAACTA CAATGTCGTG 1800 CTGACCAGCG TGGAGTACGA GTTCTGGATC AAACACTTCA ATTTTGGTGT 1850 GTTTAAGAAA GACGAGTACG ACTGTTTCGA AGTTGACAAT CTGGAGTTTA 1900 CGGGTCTGAA GATTGGTTCC ATTCTGTACT ACAAGGCAGA GAAAGGCAAG 1950 TTTAAACCTT ACGTGGATCA CTTCATGAAA ATGAAAGTGG AGAACAAGAA 2000 ACTGGGTAAT AAGCCGCTGA CGAATCAGTT TAAGCTGATT CTGAACGGTG 2050 CGTACGGCAA ATTCGGCACC AAACAAAACA AAGAAGAGAA AGATTTGATC 2100 ATGGATAAGA ACGGTTTGCT GACCTTCACG GGTAGCGTCA CGGAATACGA 2150 GGGTAAAGAA TTCTATCGTC CGTATGCGAG CTTCGTTACT GCCTATGGTC 2200 GCCTGCAACT GTGGAACGCG ATTATCTACG CGGTTGGTGT GGAGAATTTT 2250 CTGTACTGCG ACACCGACAG CATCTATTGT AACCGTGAAG TTAACAGCCT 2300 CATTGAGGAT ATGAACGCCA TTGGTGAAAC CATCGATAAA ACGATTCTGG 2350 GTAAATGGGA CGTGGAGCAT GTCTTTGATA AGTTTAAGGT CCTGGGCCAG 2400 AAGAAGTACA TGTATCATGA TTGCAAAGAA GATAAAACGG ACCTGAAGTG 2450 TTGCGGTCTG CCGAGCGATG CCCGTAAGAT TATCATTGGT CAAGGTTTCG 2500 ACGAGTTTTA TCTGGGCAAA AATGTCGAAG GTAAGAAGCA ACGCAAAAAA 2550 GTGATCGGCG GTTGCCTGCT GCTGGACACC CTGTTTACGA TCAAGAAAAT 2600 CATGTTCTAA 2610 SEQ ID NO: 6 - Pol6-44-X1 with His-tag/SpyCatcher + E585K of SEQ ID NO: 2, which corresponds to E715K of SEQ ID NO: 6 MHHHHHHHH 50 100    GGSDKHTQYV 150 KEHSFNYDEY KKANFDKIEC LIFATESCTN YENDNTGARV YGWGLGVTRN 200 HNMIYGQNLN QFWEVCQNIF NDWYHDNKHT IKITKTKKGF PKRKYIKFPI 250 AVHNLGWDVE FLKYSLVENG FNYDKGLLKT VFSKGAPYQT VTDVEEPKTF 300 HIVQNNNIVY GCNVYMDKFF EVENKDGSTT EIGLCLDFFD SYKIITCAES 350 QFHNYVHDVD PMFYKMGEEY DYDTWRSPTH KQTTLELRYQ YNDIYMLREV 400 IEQFYIDGLC GGELPLTGMR TASSIAFNVL KKMTFGEEKT EEGYINYFEL 450 DKKTKFEFLR KRIEMESYTG GYTHANHKAV GKTINKIGCS LDINSAYPSQ 500 MAYKVFPYGK PVRKTWGRKP KTEKNEVYLI EVGFDFVEPK HEEYALDIFK 550 IGAVNSKALS PITGAVSGQE YFCTNIKDGK AIPVYKELKD TKLTTNYNVV 600 LTSVEYEFWI KHFNFGVFKK DEYDCFEVDN LEFTGLKIGS ILYYKAEKGK 650 FKPYVDHFMK MKVENKKLGN KPLTNQFKLI LNGAYGKFGT KQNKEEKDLI 700 MDKNGLLTFT GSVT YEGKE FYRPYASFVT AYGRLQLWNA IIYAVGVENF 750 LYCDTDSIYC NREVNSLIED MNAIGETIDK TILGKWDVEH VFDKFKVLGQ 800 KKYMYHDCKE DKTDLKCCGL PSDARKIIIG QGFDEFYLGK NVEGKKQRKK 850 VIGGCLLLDT LFTIKKIMF* 869 SEQ ID NO: 7 - Pol6-44-X1 with His-tag/SpyCatcher + E585K + L731K of SEQ ID NO: 2, which correspond to E715K + L861K of SEQ ID NO: 6 MHHHHHHHHS GDYDIPTTEN LYFQGAMVDT LSGLSSEQGQ SGDMTIEEDS 50 ATHIKFSKRD EDGKELAGAT MELRDSSGKT ISTWISDGQV KDFYLYPGKY 100 TFVETAAPDG YEVATAITFT VNEQGQVTVN GKATKGDAHI GGSDKHTQYV 150 KEHSFNYDEY KKANFDKIEC LIFATESCTN YENDNTGARV YGWGLGVTRN 200 HNMIYGQNLN QFWEVCQNIF NDWYHDNKHT IKITKTKKGF PKRKYIKFPI 250 AVHNLGWDVE FLKYSLVENG FNYDKGLLKT VFSKGAPYQT VTDVEEPKTF 300 HIVQNNNIVY GCNVYMDKFF EVENKDGSTT EIGLCLDFFD SYKIITCAES 350 QFHNYVHDVD PMFYKMGEEY DYDTWRSPTH KQTTLELRYQ YNDIYMLREV 400 IEQFYIDGLC GGELPLTGMR TASSIAFNVL KKMTFGEEKT EEGYINYFEL 450 DKKTKFEFLR KRIEMESYTG GYTHANHKAV GKTINKIGCS LDINSAYPSQ 500 MAYKVFPYGK PVRKTWGRKP KTEKNEVYLI EVGFDFVEPK HEEYALDIFK 550 IGAVNSKALS PITGAVSGQE YFCTNIKDGK AIPVYKELKD TKLTTNYNVV 600 LTSVEYEFWI KHFNFGVFKK DEYDCFEVDN LEFTGLKIGS ILYYKAEKGK 650 FKPYVDHFMK MKVENKKLGN KPLTNQFKLI LNGAYGKFGT KQNKEEKDLI 700 MDKNGLLTFT GSVT YEGKE FYRPYASFVT AYGRLQLWNA IIYAVGVENF 750 LYCDTDSIYC NREVNSLIED MNAIGETIDK TILGKWDVEH VFDKFKVLGQ 800 KKYMYHDCKE DKTDLKCCGL PSDARKIIIG QGFDEFYLGK NVEGKKQRKK 850 VIGGCLLLDT  FTIKKIMF* 869 SEQ ID NO: 8 - Pol6-44-X1 with His-tag/SpyCatcher + E585K + M738K of SEQ ID NO: 2, which correspond to E715K + M868K of SEQ ID NO:6 MHHHHHHHH 50 100    GGSDKHTQYV 150 KEHSFNYDEY KKANFDKIEC LIFATESCTN YENDNTGARV YGWGLGVTRN 200 HNMIYGQNLN QFWEVCQNIF NDWYHDNKHT IKITKTKKGF PKRKYIKFPI 250 AVHNLGWDVE FLKYSLVENG FNYDKGLLKT VFSKGAPYQT VTDVEEPKTF 300 HIVQNNNIVY GCNVYMDKFF EVENKDGSTT EIGLCLDFFD SYKIITCAES 350 QFHNYVHDVD PMFYKMGEEY DYDTWRSPTH KQTTLELRYQ YNDIYMLREV 400 IEQFYIDGLC GGELPLTGMR TASSIAFNVL KKMTFGEEKT EEGYINYFEL 450 DKKTKFEFLR KRIEMESYTG GYTHANHKAV GKTINKIGCS LDINSAYPSQ 500 MAYKVFPYGK PVRKTWGRKP KTEKNEVYLI EVGFDFVEPK HEEYALDIFK 550 IGAVNSKALS PITGAVSGQE YFCTNIKDGK AIPVYKELKD TKLTTNYNVV 600 LTSVEYEFWI KHFNFGVFKK DEYDCFEVDN LEFTGLKIGS ILYYKAEKGK 650 FKPYVDHFMK MKVENKKLGN KPLTNQFKLI LNGAYGKFGT KQNKEEKDLI 700 MDKNGLLTFT GSVT YEGKE FYRPYASFVT AYGRLQLWNA IIYAVGVENF 750 LYCDTDSIYC NREVNSLIED MNAIGETIDK TILGKWDVEH VFDKFKVLGQ 800 KKYMYHDCKE DKTDLKCCGL PSDARKIIIG QGFDEFYLGK NVEGKKQRKK 850 VIGGCLLLDT LFTIKKI F* 869 SEQ ID NO: 9 - His 6 tag HHHHHH SEQ ID NO: 10 - SpyCatcher SGDYDIPTTENLYFQGAMVDTLSGLSSEQGQSGDMTIEEDSATHIKFSKRDEDGKELAGATME LRDSSGKTISTWISDGQVKDFYLYPGKYTFVETAAPDGYEVATAITFTVNEQGQVTVNGKATK GDAHI SEQ ID NO: 11 - SpyTag AHIVMVDAYKPTK SEQ ID NOS: 12 and 16 - Cy5-labelled fluorogenic DNA template cy5/AGA GTG ATA GTA TGA TTA TGT AGA TGT AGG ATT TGA TAT GTG AGT AGC CGA ATG AAA CCT T/iSpC3/TT GGT TTC ATT CGG SEQ ID NO: 13 - Black Hole Quencher ® dye-labelled quencher oligonucleotide TTT TCA TAA TCA TAC TAT CAC TCT /3BHQ_2

Claims

1. A variant polypeptide capable of catalyzing polymerization of deoxynucleotides, said polypeptide comprising an amino acid sequence having at least 70% identity with SEQ ID NO: 2, wherein the amino acid sequence comprises a substitution corresponding to a position of SEQ ID NO: 2 selected from the group consisting of V173, N175, N176, N177, I178, V179, Y180, S211, Y212, I214, T287, G288, M289, R290, T291, A292, S293, S294, 1295, Y338, T339, G340, G341, Y342, T343, H344, A345, D417, I418, F419, K420, I421, G422, G434, A435, V436, S437, G438, Q439, E440, Y441, G559, T560, N563, E565, E566, D568, L569, I570, M571, D572, N574, G575, L576, L577, T578, F579, T580, G581, S582, V583, T584, E587, G588, E590, F591, Y596, Q662, V667, L668, G669, Q670, L685, C687, C688, G689, L690, P691, S692, D693, A694, L708, G709, Q717, R718, V721, L731, F732, T733, I734, I737, M738, and F739.

2. The polypeptide of claim 1, wherein said substitution is a substitution to an amino acid selected from the group consisting of K, R, H, Y, F, W, and T.

3. The polypeptide of claim 1, wherein said substitution is selected from the group consisting of V173K, N175K, N176K, N177K, I178K, V179K, Y180K, S211K, Y212K, I214K, T287K, G288K, M289K, R290K, T291 K, A292K, S293K, S294K, I295K, Y338K, T339K, G340K, G341K, Y342K, T343K, H344K, A345K, D417K, I418K, F419K, K420K, I421K, G422K, G434K, A435K, V436K, S437K, G438K, Q439K, E440K, Y441 K, G559K, T560K, N563K, E566K, E565K, D568K, L569K, I570K, M571 K, D572K, N574K, G575K, L576K, L577K, T578K, F579K, T580K, G581 K, S582K, V583K, T584K, E587K, G588K, E590K, F591 K, Y596K, Q662K, V667K, L668K, G669K, Q670K, L685K, C687K, C688K, G689K, L690K, P691 K, S692K, D693K, A694K, L708K, G709K, Q717K, R718K, V721K, L731K, F732K, T733K, I734K, I737K, M738K, and F739K.

4. The polypeptide of claim 1, wherein said polypeptide comprises at least two substitutions selected from the group consisting of V173K, N175K, N176K, N177K, I178K, V179K, Y180K, S211K, Y212K, I214K, T287K, G288K, M289K, R290K, T291 K, A292K, S293K, S294K, I295K, Y338K, T339K, G340K, G341K, Y342K, T343K, H344K, A345K, D417K, I418K, F419K, K420K, I421 K, G422K, G434K, A435K, V436K, S437K, G438K, Q439K, E440K, Y441 K, G559K, T560K, N563K, E566K, E565K, D568K, L569K, I570K, M571 K, D572K, N574K, G575K, L576K, L577K, T578K, F579K, T580K, G581 K, S582K, V583K, T584K, E587K, G588K, E590K, F591 K, Y596K, Q662K, V667K, L668K, G669K, Q670K, L685K, C687K, C688K, G689K, L690K, P691 K, S692K, D693K, A694K, L708K, G709K, Q717K, R718K, V721 K, L731K, F732K, T733K, I734K, I737K, M738K, and F739K.

5. The polypeptide of claim 1, wherein said substitution is L731 K/R/H.

6. The polypeptide of claim 1, wherein said substitution is M738K/R/H.

7. The polypeptide of claim 1, wherein said amino acid sequence further comprises a D44A substitution relative to SEQ ID NO: 2.

8. The polypeptide of claim 1, wherein said amino acid sequence further comprises a S366A substitution relative to SEQ ID NO: 2.

9. The polypeptide of claim 1, wherein said amino acid sequence further comprises a T529M substitution relative to SEQ ID NO: 2.

10. The polypeptide of claim 1, wherein said amino acid sequence further comprises a A547F substitution relative to SEQ ID NO: 2.

11. The polypeptide of claim 1, wherein said polypeptide has a reduced rate of dissociation in the presence of 500 mM potassium glutamate relative to a polypeptide consisting of SEQ ID NO: 4.

12. The polypeptide of claim 1, further comprising an affinity tag.

13. The polypeptide of claim 1, further comprising a member of an attachment selected from the group consisting of (a) a SpyCatcher/SpyTag peptide system, (b) a native chemical ligation system, (c) a sortase system, (d) a transglutaminase system, (e) a formylglycine linkage system, and (g) a zinc finger system.

14. A composition comprising the polypeptide of claim 1 attached to a biological nanopore.

15. The composition of claim 14, wherein the attachment between the polypeptide and the biological nanopore results from an attachment system selected from the group consisting of: (a) a SpyCatcher/SpyTag peptide system, (b) a native chemical ligation system, (c) a sortase system, (d) a transglutaminase systems, (e) a formylglycine linkage system, (f) a system comprising reaction between 6-hydrazino-nicotinic acid and 4-formylbenzoate, and (g) a zinc finger system.

16. The composition of claim 14, further comprising a polynucleotide complexed with the polypeptide.

17. The composition of claim 14, wherein said composition is a part of a nanopore sequencing complex on a biochip, the nanopore sequencing complex comprising:

the nanopore of the composition inserted in a membrane adjacent to an electrode of a sensing circuit of the biochip, and
a polynucleotide complexed with the polypeptide.

18. The composition of claim 17, wherein the biochip comprises at least 500 nanopore sequencing complexes per 1 mm2.

19. A method for nanopore sequencing a polynucleotide, said method comprising:

(a) providing a biochip comprising a plurality of nanopore sequencing complexes, each nanopore sequencing complex comprising: (a1) a sensing circuit comprising an electrode, (a2) a nanopore adjacent to the electrode, (a3) the polypeptide of claim 1 attached to the nanopore, and (a4) the polynucleotide complexed with the polypeptide;
(b) contacting the nanopore sequencing complexes with a set of tagged nucleotides, wherein the tagged nucleotides of the set contain a tag coupled to a nucleotide, which tag is detectable with the aid of said nanopore;
(c) carrying out a polymerization reaction catalyzed by the polypeptide of the nanopore sequencing complex, thereby incorporating individual tagged nucleotides of the set into a growing strand complementary to a single stranded portion of the polynucleotide; and
(d) detecting, with the aid of said nanopore, the tag associated with the individual tagged nucleotide during incorporation of the individual tagged nucleotide into the growing strand, wherein said tag is detected with the aid of the nanopore while the nucleotide is associated with the polypeptide.

20. The method of claim 19, wherein the nanopore is a biological nanopore inserted into a membrane.

Patent History
Publication number: 20200190572
Type: Application
Filed: Feb 26, 2020
Publication Date: Jun 18, 2020
Inventors: Aruna Ayer (Santa Clara, CA), Preethi Sarvabhowman (Santa Clara, CA), Dhruti Vasudev Dalal (Sunnyvale, CA)
Application Number: 16/802,421
Classifications
International Classification: C12Q 1/6869 (20060101); C12N 9/12 (20060101);