Immunoglobulin Or Antibody Is Chimeric, Mutated, Or A Recombined Hybrid (e.g., Bifunctional, Bispecific, Rodent-human Chimeric, Single Chain, Rfv, Immunoglobuin Fusion Protein, Etc.) Patents (Class 435/328)
  • Patent number: 11980640
    Abstract: An embodiment of the invention provides bicistronic chimeric antigen receptor (CAR) amino acid constructs. Nucleic acids, recombinant expression vectors, host cells, populations of cells, and pharmaceutical compositions relating to the CAR constructs are disclosed. Methods of detecting the presence of cancer in a mammal and methods of treating or preventing cancer in a mammal are also disclosed. Methods of making the CAR constructs are disclosed.
    Type: Grant
    Filed: May 15, 2018
    Date of Patent: May 14, 2024
    Assignee: The United States of America, as represented by the Secretary, Department of Health and Human Services
    Inventors: Haiying Qin, Crystal L Mackall, Terry J. Fry
  • Patent number: 11970525
    Abstract: The present invention relates to compositions and methods for treating diseases, disorders or conditions associated with the expression of the Glycosyl-phosphatidylinositol (GPI)-linked GDNF family ?-receptor 4 (GFR?4).
    Type: Grant
    Filed: October 23, 2020
    Date of Patent: April 30, 2024
    Assignees: The Trustees of the University of Pennsylvania, Novartis AG, The Scripps Research Institute
    Inventors: Donald L. Siegel, Michael C. Milone, Vijay Bhoj, Christoph Rader
  • Patent number: 11932872
    Abstract: The present invention discloses a novel switchable dual chimeric antigen receptor-T (sdCAR-T) cell and a construction method and use thereof, which fall within the field of cellular immunotherapy for tumors. The dual chimeric antigen receptor consists of a first chimeric antigen receptor for MSLN and a second chimeric antigen receptor for FITC. A dual-targeted functional T cells regulated by specific exogenous bifunctional molecules is constructed, and the exogenous molecules are used to preliminarily discuss the in vivo and in vitro activity of the dual chimeric antigen receptor-T cell. By means of in vitro and in vivo tests, it is confirmed that the activation mode of the constructed CAR-T cell is controlled by the combination of endogenous tumor antigens and exogenous bifunctional molecules, and this combined regulation mode can significantly improve the safe application of CAR-T cell immunotherapy.
    Type: Grant
    Filed: September 7, 2018
    Date of Patent: March 19, 2024
    Assignee: NANJING ANJI BIOLOGICAL TECHNOLOGY CO., LTD
    Inventors: Hanmei Xu, Erhao Zhang
  • Patent number: 11918604
    Abstract: The current invention provides monocytic cells transfected with chimeric antigen receptor (CAR) to selectively home to tumors and upon homing differentiate into dendritic cells capable of activating immunity which is inhibitory to said tumor. In one embodiment of the invention, monocytic cells are transfected with a construct encoding an antigen binding domain, a transcellular or structural domain, and an intracellular signaling domain. In one specific aspect of the invention, the antigen binding domain interacts with sufficient affinity to a tumor antigen, capable of triggering said intracellular domain to induce an activation signal to induce monocyte differentiation into DC.
    Type: Grant
    Filed: April 7, 2022
    Date of Patent: March 5, 2024
    Assignee: MYELOID THERAPEUTICS, INC.
    Inventors: Samuel C. Wagner, Thomas E. Ichim, Julia S. Szymanski, Santosh Kesari, Amit N. Patel, Boris Minev
  • Patent number: 11897967
    Abstract: The present application discloses humanized antibodies and antibody like proteins and fragments thereof.
    Type: Grant
    Filed: August 4, 2022
    Date of Patent: February 13, 2024
    Assignee: MINERVA BIOTECHNOLOGIES CORPORATION
    Inventors: Cynthia Bamdad, Benoit Smagghe
  • Patent number: 11872194
    Abstract: Disclosed are methods and compositions related to immunoconjugates. Particularly disclosed are immunoconjugates that comprise the Fc portion of IgG3 as well as Factor VII light chain or Factor VII. Also disclosed is an immunoconjugate protein, wherein said immunoconjugate protein comprises a hybrid Fc region of an IgG1 and an IgG3 immunoglobulin conjugated to Factor VII. These immunoconjugates can target Tissue Factor (TF) expressing cells.
    Type: Grant
    Filed: March 14, 2018
    Date of Patent: January 16, 2024
    Assignee: Ohio State Innovation Foundation
    Inventor: Zhiwei Hu
  • Patent number: 11850262
    Abstract: The present disclosure relates to methods of treating a patient with a cancer by administering to the patient a composition comprising CAR T cells and a small molecule linked to a targeting moiety by a linker. The disclosure also relates to compositions for use in such methods.
    Type: Grant
    Filed: February 28, 2018
    Date of Patent: December 26, 2023
    Assignees: Purdue Research Foundation, Endocyte, Inc.
    Inventors: Philip Stewart Low, Haiyan Chu, Yong Gu Lee, Yingjuan J. Lu, Christopher Paul Leamon, Leroy W. Wheeler, II
  • Patent number: 11851659
    Abstract: The present disclosure is directed to genome editing systems, reagents and methods for immunooncology.
    Type: Grant
    Filed: March 21, 2018
    Date of Patent: December 26, 2023
    Assignees: Novartis AG, Intellia Therapeutics, Inc.
    Inventors: Jennifer Brogdon, Ming-Wei Chen, Hyungwook Lim, Yi Yang, Morag Stewart, Sarah Hesse
  • Patent number: 11840575
    Abstract: The present invention provides an engineered immune cell targeting BCMA and use thereof. In particular, the present invention provides a CAR specifically targeting BCMA, the CAR comprising an antigen-binding domain which is an S-derived scFv, an antibody heavy chain variable region as shown in SEQ ID NO: 9 and an antibody light chain variable region as shown in SEQ ID NO: 10. The present invention also provides a CAR-T cell comprising the CAR, a double CAR- and CAR-T cell comprising the S-derived scFv, and related use thereof. Compared to CAR-T cells constructed using other scFvs, the constructed CAR-T cell of the present invention has a better killing effect and tumor elimination capability.
    Type: Grant
    Filed: May 6, 2020
    Date of Patent: December 12, 2023
    Assignee: GRACELL BIOTECHNOLOGIES (SHANGHAI) CO., LTD.
    Inventors: Hua Zhang, Huan Shi, Lianjun Shen, Wei Cao, Liping Liu
  • Patent number: 11795230
    Abstract: The present disclosure provides an antibody, or an antigen binding fragment or variant thereof, which binds to CD27 and exhibits at least one of the following properties: specifically binds to CD27 with a KD of 10?8 M or less; activates and/or increases CD27 mediated NF-?B activity; stimulates CD4+ and/or CD8+ T cell proliferation; binds to human CD27 expressed on a cell surface; stimulates secretion of IFN-? by CD4+ and/or CD8+ T cells. The present disclosure also provides a method for preparing and using said antibody.
    Type: Grant
    Filed: April 13, 2018
    Date of Patent: October 24, 2023
    Assignee: DINGFU BIOTARGET CO., LTD.
    Inventors: Ting Xu, Yan Luan, Jianjian Peng, Kai Fu
  • Patent number: 11780922
    Abstract: Provided are bispecific proteins that comprise a binding domain binding cell surface protein and a vascular endothelial growth factor (VEGF) inhibiting domain. Provided also is an antibody-drug conjugate that comprises a therapeutic agent and an antibody or an antigen-binding fragment binding PD-L1 and/or a VEGF inhibiting domain, wherein the therapeutic agent is covalently conjugated to the antibody or the antigen-binding fragment by a linker.
    Type: Grant
    Filed: June 9, 2020
    Date of Patent: October 10, 2023
    Assignee: AP Biosciences, Inc.
    Inventors: Jeng-Horng Her, Jhong-Jhe You, Ching-Hsuan Hsu, Po-Lin Huang
  • Patent number: 11773396
    Abstract: The invention provides an isolated and purified nucleic acid sequence encoding a chimeric antigen receptor (CAR) directed against B-cell Maturation Antigen (BCMA). The invention also provides host cells, such as T-cells or natural killer (NK) cells, expressing the CAR and methods for destroying multiple myeloma cells.
    Type: Grant
    Filed: October 6, 2022
    Date of Patent: October 3, 2023
    Assignee: The U.S.A., as represented by the Secretary, Department of Health and Human Services
    Inventor: James N. Kochenderfer
  • Patent number: 11639377
    Abstract: The disclosure discloses a preparation of type I collagen-like fibers and a method for regulating and controlling the periodic length of fiber stripes thereof, belonging to the technical field of genetic engineering. The disclosure produces a three-segment chimeric collagen P-CL-P pattern by inserting a continuous Gly-Xaa-Yaa triplet collagen sequence in the middle based on the N- and C-terminal (GPP)n sequences. The self-assembly is driven by the interaction between the N- and C-terminal (GPP)n triple helixes to form banded fibers with periodic bright and dark stripes. According to the method of the disclosure, a fiber from a clean source, which can self-assemble to form periodic bright and dark stripes can be prepared, the structure of which is similar to type I collagen, the preparation process is simple, the collagen fiber with low cost can be produced on a large scale, and the method has broad application prospects in the field of biological materials.
    Type: Grant
    Filed: October 28, 2020
    Date of Patent: May 2, 2023
    Assignees: JIANGNAN UNIVERSITY, RUTGERS UNIVERSITY
    Inventors: Fei Xu, Jinyuan Hu, Vikas Nanda, David I. Shreiber, Meng Zhang, Sonal Gahlawat
  • Patent number: 11607451
    Abstract: The invention herein described, provides, among other things, self-buffering protein formulations. Particularly, the invention provides self-buffering pharmaceutical protein formulations that are suitable for veterinary and human medical use. The self-buffering protein formulations are substantially free of other buffering agents, stably maintain pH for the extended time periods involved in the distribution and storage of pharmaceutical proteins for veterinary and human medical use. The invention further provides methods for designing, making, and using the formulation. In addition to other advantages, the formulations avoid the disadvantages associated with the buffering agents conventionally used in current formulations of proteins for pharmaceutical use.
    Type: Grant
    Filed: March 12, 2013
    Date of Patent: March 21, 2023
    Assignee: Amgen Inc.
    Inventors: Yatin R. Gokarn, Eva Kras, Richard Louis Remmele, Jr., David Brems, Susan Irene Hershenson
  • Patent number: 11590168
    Abstract: Provided by the present invention is a chimeric antigen receptor comprising a co-stimulatory receptor, the chimeric antigen receptor having a structure of scFv(X)-(Y)CD3zeta-2A-(Z); X comprises a tumortargeting antibody or a ligand or receptor capable of specifically binding to a tumor; Y is an intracellular region of the co-stimulatory receptor, and Z is a co-stimulatory receptor that is selected from among ICOS, CD28, CD27, HVEM, LIGHT, CD40L, 4-1BB, OX40, DR3, GITR, CD30, TIMI, SLAM, CD2, CD226. Further provided by the present invention are CAR-T cells that are constructed by means of a recombinant expression vector of the described chimeric antigen receptor, a preparation method therefor and an application thereof. The CAR-T cells described in the present invention significantly improve the tumor-killing abilities and amplification abilities thereof.
    Type: Grant
    Filed: December 18, 2020
    Date of Patent: February 28, 2023
    Assignee: Shanghai Longyao Biotechnology Inc., Ltd.
    Inventors: Xuanming Yang, Yangxin Fu, Xin Wang, Shengqin Ye, Fanlin Li, Huihui Zhang
  • Patent number: 11573226
    Abstract: The presently disclosed subject matter relates to compositions, systems and methods of screening one or more species of polypeptide in a complex mixture of polypeptides, e.g., multi-subunit proteins. For example, the subject matter relates to ligands used in connection with affinity capillary electrophoresis, as well as methods and systems for detecting polypeptides in a mixture of multimers that include multispecific antibodies, e.g., bispecific antibodies.
    Type: Grant
    Filed: September 11, 2019
    Date of Patent: February 7, 2023
    Assignee: Genentech, Inc.
    Inventors: Kelsey Catherine Dent, David John Fischer, David A. Michels
  • Patent number: 11548949
    Abstract: Provided are compositions for increasing the half-life of a polypeptide or polypeptides in a canine and methods of their use. The compositions involve variant canine IgG Fc regions.
    Type: Grant
    Filed: April 28, 2020
    Date of Patent: January 10, 2023
    Assignee: Invetx, Inc.
    Inventors: William Brondyk, Brett Chevalier, Juergen Horn, Madhusudan Natarajan
  • Patent number: 11547742
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: September 20, 2021
    Date of Patent: January 10, 2023
    Assignee: Heat Biologics, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 11459543
    Abstract: The invention provides a recombinant chimeric antigen receptor (CAR) gene, a vector containing the same, a CAR-T cell and a use thereof. The recombinant CAR gene comprises a nucleic acid sequence encoding an antigen-binding portion of a CD30 antibody, a transmembrane portion and a CD137 cytoplasmic functional region and a CD3zeta cytoplasmic functional region linked in any order; also provides a method of treating Hodgkin's lymphoma or anaplastic large cell lymphoma or other CD30-positive tumors using the CAR-T cells of the invention.
    Type: Grant
    Filed: November 16, 2018
    Date of Patent: October 4, 2022
    Assignee: YIMING (BEIJING) CELL BIOTECH LTD.
    Inventor: Xiulian Sun
  • Patent number: 11421038
    Abstract: The present application describes an antibody-coding, non-modified or modified RNA and the use thereof for expression of this antibody, for the preparation of a pharmaceutical composition, in particular a passive vaccine, for treatment of tumours and cancer diseases, cardiovascular diseases, infectious diseases, auto-immune diseases, virus diseases and monogenetic diseases, e.g. also in gene therapy. The present invention furthermore describes an in vitro transcription method, in vitro methods for expression of this antibody using the RNA according to the invention and an in vivo method.
    Type: Grant
    Filed: January 8, 2008
    Date of Patent: August 23, 2022
    Assignee: CureVac AG
    Inventors: Ingmar Hoerr, Jochen Probst, Steve Pascolo
  • Patent number: 11293923
    Abstract: The invention includes a bioelectronic interface comprising a self-assembling unit, wherein the self-assembling unit comprises a variant GPCR fusion protein bound to an S-layer fusion protein. The invention also encompasses a biosensor or device comprising the bioelectronic interface and methods of screening for a ligand of a GPCR.
    Type: Grant
    Filed: August 31, 2018
    Date of Patent: April 5, 2022
    Assignee: Massachusetts Institute of Technology
    Inventors: Shuguang Zhang, Rui Qing, Andreas Breitwieser, Uwe Sleytr
  • Patent number: 11137393
    Abstract: The present invention refers to a method for determining the ability of an immunoglobulin to bind to a post-translationally modified target in an intracellular environment, which folds and it is post-translationally modified as a native protein intracellularly. The present invention also refers to antibodies obtained by the above method and uses thereof.
    Type: Grant
    Filed: November 2, 2016
    Date of Patent: October 5, 2021
    Assignee: SCUOLA NORMALE SUPERIORE
    Inventors: Antonino Cattaneo, Michele Chirichella
  • Patent number: 11028143
    Abstract: The invention provides T cells comprising nucleic acid sequence encoding a chimeric antigen receptor and a nucleic acid sequence encoding an enhancer of T cell priming, compositions including the T cells, and methods of using the T cells to treat diseases associated with the expression of disease-associated antigens.
    Type: Grant
    Filed: January 21, 2015
    Date of Patent: June 8, 2021
    Assignees: Novartis AG, The Trustees of the University of Pennsylvania
    Inventors: Yangbing Zhao, Devon J. Shedlock, Carl H. June, Xiaojun Liu
  • Patent number: 11001624
    Abstract: The present invention relates to monomeric fusion proteins comprising the extracellular part of the thymic stromal lymphopoietin receptor (TSLPR) and the extracellular part of the interleukin-7 receptor alpha (IL-7Ralpha) as inhibitors of thymic stromal lymphopoietin (TSLP) activity. The invention relates further to the use of said inhibitors as a medicament in the treatment of—but not limited to—inflammatory diseases, cancer and fibrosis.
    Type: Grant
    Filed: April 4, 2017
    Date of Patent: May 11, 2021
    Assignees: VIB VZW, UniversiteitGent
    Inventors: Savvas Savvides, Rudi Beyaert, Kenneth Verstraete, Harald Braun, Frank Peelman
  • Patent number: 10851166
    Abstract: The invention provides compositions and methods for treating diseases associated with expression of CD33. The invention also relates to chimeric antigen receptor (CAR) specific to CD33, vectors encoding the same, and recombinant T cells comprising the CD33 CAR. The invention also includes methods of administering a genetically modified T cell expressing a CAR that comprises a CD33 binding domain.
    Type: Grant
    Filed: August 29, 2017
    Date of Patent: December 1, 2020
    Assignees: Novartis AG, The Trustees of the University of Pennsylvania
    Inventors: Hilmar Erhard Ebersbach, Thomas Huber, Julia Jascur, Celeste Richardson, Reshma Singh, Huijuan Song, Qilong Wu, Jiquan Zhang
  • Patent number: 10711054
    Abstract: The present invention relates to a binding molecule comprising at least three binding specificities, wherein (a) the first specificity is for a Hepatitis B virus (HBV) surface antigen selected from HBV small surface antigen, HBV medium surface antigen and HBV large surface antigen; (b) (i) the second and third specificity are for CD3 and CD28, respectively; or (ii) the second and third specificity are selected from specificities for CD16, CD56, NKp30, NKp46, 4-1BB and NKG2D; and (c) each binding specificity is provided by one or more binding sites, each binding site being independently provided by (i) a set of six complementarity determining regions (CDRs), wherein said set of six CDRs consists of a first set of three CDRs and a second set of three CDRs, wherein said first and said second set is each comprised in an immunoglobulin domain; or (ii) a set of three CDRs, wherein said set of three CDRs is comprised in an immunoglobulin domain.
    Type: Grant
    Filed: March 16, 2016
    Date of Patent: July 14, 2020
    Assignees: Helmholtz Zentrum München—Deutsches Forschungszentrum fur Gesundheit und umwelt (GmbH), DEUTSCHES KREBSFORSCHUNGSZENTRUM, TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Ulrike Protzer, Felix Bohne, Oliver Quitt, Frank Momburg, Gerhard Moldenhauer
  • Patent number: 10624973
    Abstract: The invention provides compositions and methods useful for the depletion of cells, such as CD45+, CD135+, CD34+, CD90+, and/or CD110+ cells, and for the treatment of various hematopoietic diseases, metabolic disorders, cancers, and autoimmune diseases, among others. Described herein are antibodies, antigen-binding fragments, ligands, and conjugates thereof that can be applied to effect the treatment of these conditions, for instance, by depleting a population of CD45+, CD135+, CD34+, CD90+, or CD110+ cells in a patient, such as a human. The compositions and methods described herein can be used to treat a disorder directly, for instance, by depleting a population of CD45+, CD135+, CD34+, CD90+, or CD110+ cancer cells or autoimmune cells.
    Type: Grant
    Filed: February 28, 2019
    Date of Patent: April 21, 2020
    Assignee: Magenta Therapeutics, Inc.
    Inventors: Andrew Nixon, Dwight Morrow, Adam Hartigan
  • Patent number: 10543253
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: November 28, 2018
    Date of Patent: January 28, 2020
    Assignee: Heat Biologics, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10525102
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: June 29, 2018
    Date of Patent: January 7, 2020
    Assignee: Heat Biologics, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10513548
    Abstract: The present invention relates, in part, to, chimeric proteins which include the extracellular domain of colony stimulating factor 1 receptor (CSF1R) and their use in the treatment of diseases, such as immunotherapies for cancer and/or an inflammatory disease.
    Type: Grant
    Filed: December 18, 2018
    Date of Patent: December 24, 2019
    Assignee: Shattuck Labs, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10421810
    Abstract: Chimeric antigen receptors containing tumor necrosis factor receptor superfamily member transmembrane domains are disclosed. Nucleic acids, recombinant expression vectors, host cells, antigen binding fragments, and pharmaceutical compositions, relating to the chimeric antigen receptors are also disclosed. Methods of treating or preventing cancer in a subject, and methods of making chimeric antigen receptor T cells are also disclosed.
    Type: Grant
    Filed: October 7, 2016
    Date of Patent: September 24, 2019
    Assignee: LENTIGEN TECHNOLOGY, INC.
    Inventors: Rimas Orentas, Dina Schneider, Boro Dropulic
  • Patent number: 10253086
    Abstract: The invention provides compositions and methods for treating diseases associated with expression of CD19, e.g., by administering a recombinant T cell comprising the CD19 CAR as described herein, in combination with one or more B-cell inhibitors, e.g., inhibitors of one or more of CD10, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, or CD79a. The disclosure additionally features novel antigen binding domains and CAR molecules directed to CD20 and CD22, and uses, e.g., as monotherapies or in combination therapies. The invention also provides kits and compositions described herein.
    Type: Grant
    Filed: April 8, 2016
    Date of Patent: April 9, 2019
    Assignees: Novartis AG, The Trustees of the University of Pennsylvania
    Inventors: Hans Bitter, Jennifer Mary Bordeaux, Barbara Brannetti, Jennifer Brogdon, Naveen Kumar Dakappagari, Saar Gill, Steven Highfill, Lu Huang, Carl H. June, Ju Young Kim, Ming Lei, Na Li, Andreas Loew, Elena Orlando, Marco Ruella, Thai Tran, Jimin Zhang, Li Zhou
  • Patent number: 10188701
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: December 22, 2017
    Date of Patent: January 29, 2019
    Assignee: HEAT BIOLOGICS, INC.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 9987373
    Abstract: Glycoproteins comprising a glycan of the formula (102) are disclosed; wherein b is 0 or 1; the GlcNAc residue optionally fucosylated; and Su(A)x is a sugar derivative comprising x functional groups A, wherein x is 1, 2, 3 or 4 and A is independently selected from the group consisting of an azido group, a keto group, an alkynyl group, a thiol group, a halogen, a sulfonyloxy group, a halogenated acetamido group, a mercaptoacetamido group and a sulfonylated hydroxyacetamido group. Protein-conjugates having glycoproteins according to the invention conjugated to a molecule of interest (e.g., an active substance) are also disclosed. Examples include modified antibodies, antibody-conjugates, and antibody-drug conjugates (ADCs). Processes for the preparation of the modified glycoproteins according to the invention and methods for the preparation of a protein-conjugate according to the invention are mentioned.
    Type: Grant
    Filed: October 14, 2014
    Date of Patent: June 5, 2018
    Assignee: Synaffix B.V.
    Inventors: Floris Louis Van Delft, Remon Van Geel, Maria Antonia Wijdeven
  • Patent number: 9932372
    Abstract: Porcine circovirus (PCV2) vaccine compositions comprising a peptide antigen derived from a PCV2 capsid protein are described. In various embodiments, the peptide antigen contains amino acids of the capsid protein from about amino acid 47 to about amino acid 202. In some embodiments, the peptide antigen is optionally linked to an artificial T helper epitope and/or mixed with T helper epitopes derived from the ORF1 and ORF3 proteins of PCV2. Methods of using PCV2 vaccine compositions are also described. In various embodiments, a vaccine composition is used in animals for the prevention of PCV2 infection. In other embodiments, a PCV2 vaccine composition is used as an antigen for diagnosing PCV2 infection.
    Type: Grant
    Filed: July 8, 2010
    Date of Patent: April 3, 2018
    Assignee: UNITED BIOMEDICAL, INC.
    Inventors: Chang Yi Wang, Wen-Jiun Peng
  • Patent number: 9868774
    Abstract: The disclosure provides a chimeric antigen receptor (CAR) comprising a) an antigen binding domain of HA22, a transmembrane domain, and an intracellular T cell signaling domain; or b) an antigen binding domain of BL22, a transmembrane domain, and an intracellular T cell signaling domain comprising CD28 and/or CD137. Nucleic acids, recombinant expression vectors, host cells, populations of cells, antibodies, or antigen binding portions thereof, and pharmaceutical compositions relating to the CARs are disclosed. Methods of detecting the presence of cancer in a mammal and methods of treating or preventing cancer in a mammal are also disclosed.
    Type: Grant
    Filed: October 19, 2012
    Date of Patent: January 16, 2018
    Assignee: The United States of America, as represented by the Secretary, Department of Health and Human Services
    Inventors: Rimas J. Orentas, Crystal L. Mackall, Ira H. Pastan
  • Patent number: 9534246
    Abstract: The invention provides methods for the rapid identification and selection of cell lines suitable for biopharmaceuticals production, which do no utilize animal derived components.
    Type: Grant
    Filed: June 29, 2011
    Date of Patent: January 3, 2017
    Assignee: Glaxo Group Limited
    Inventors: Ekaterini Kotsopoulou, Richard Priest, Mark Uden
  • Patent number: 9518123
    Abstract: The present invention provides compositions and methods for treating cancer in a human. The invention includes relates to administering a genetically modified T cell to express a CAR wherein the CAR comprises an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain.
    Type: Grant
    Filed: January 15, 2016
    Date of Patent: December 13, 2016
    Assignee: The Trustees of the University of Pennsylvania
    Inventors: Carl H. June, Bruce L. Levine, David L. Porter, Michael D. Kalos, Michael C. Milone
  • Patent number: 9409989
    Abstract: The invention relates to a method of preparing heteromultimeric polypeptides such as bispecific antibodies, bispecific immunoadhesins and antibody-immunoadhesin chimeras. The invention also relates to the heteromultimers prepared using the method. Generally, the method provides a multispecific antibody having a common light chain associated with each heteromeric polypeptide having an antibody binding domain. Additionally the method further involves introducing into the multispecific antibody a specific and complementary interaction at the interface of a first polypeptide and the interface of a second polypeptide, so as to promote heteromultimer formation and hinder homomultimer formation; and/or a free thiol-containing residue at the interface of a first polypeptide and a corresponding free thiol-containing residue in the interface of a second polypeptide, such that a non-naturally occurring disulfide bond is formed between the first and second polypeptide.
    Type: Grant
    Filed: December 27, 2013
    Date of Patent: August 9, 2016
    Assignee: Genetech, Inc.
    Inventors: W. Robert Arathoon, Paul J. Carter, Anne M. Merchant, Leonard G. Presta
  • Patent number: 9376492
    Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.
    Type: Grant
    Filed: September 22, 2010
    Date of Patent: June 28, 2016
    Assignee: Asclepiumm Limited
    Inventor: Min-Che Chen
  • Patent number: 9365641
    Abstract: The present invention provides compositions and methods for treating cancer in a human. The invention relates to targeting the stromal cell population in a tumor microenvironment. For example, in one embodiment, the invention provides a composition that is targeted to fibroblast activation protein (FAP). The invention includes a chimeric antigen receptor (CAR) which comprises an anti-FAP domain, a transmembrane domain, and a CD3zeta signaling domain.
    Type: Grant
    Filed: September 30, 2013
    Date of Patent: June 14, 2016
    Assignees: The Trustees of the University of Pennsylvania, The Wistar Institute of Anatomy and Biology
    Inventors: Carl H. June, Ellen Pure, Liang-Chuan Wang, Steven Albelda, John Scholler
  • Patent number: 9156916
    Abstract: Provided herein are methods for modulating one or more of a T-helper cell or monocyte lineage cell-mediated immune response in a subject, the method comprises administering to the subject an effective amount of a compound which binds to surface membrane immunoglobulin D (smIgD). Also provided are methods of diagnosis of one or more of a T-helper cell or monocyte lineage cell-mediated immune disease, and compositions and kits for use in such methods.
    Type: Grant
    Filed: April 27, 2007
    Date of Patent: October 13, 2015
    Assignees: The University of Sydney, Northern Sydney and Central Coast Area Health Service
    Inventors: Tue G. Nguyen, Jonathan M. Morris, Eileen D. M. Gallery, Sharon McCracken
  • Patent number: 9139654
    Abstract: The present invention relates to the field glycosylation engineering of proteins. More particular, the present invention is directed to the glycosylation engineering of proteins to provide proteins with improved therapeutic properties, e.g., antibodies, antibody fragments, or a fusion protein that includes a region equivalent to the Fc region of an immunoglobulin, with enhanced Fc-mediated cellular cytotoxicity.
    Type: Grant
    Filed: December 23, 2010
    Date of Patent: September 22, 2015
    Assignee: Roche GlyeArt AG
    Inventors: Pablo Umaña, Joël Jean-Mairet, James E. Bailey, M. Sean Bailey
  • Publication number: 20150147302
    Abstract: A T cell receptor molecule (TCR) containing an alpha chain portion and a beta chain portion wherein the alpha chain portion contains three complementarity determining regions (CDRs): CDR1?: SSYSPS CDR2?: YTSAATL CDR3?: VVSPF-SGGGADGLT or comprising or consisting of SPPSGGGADGLT and the beta chain portion contains three complementarity determining regions (CDRs): CDR1?: DFQATT CDR2?: SNEGSKA CDR3?: comprising SARDGGEG or comprising or consisting of RDGGEGSETQY, or wherein up to three amino acid residues in one or more CDRs are replaced by another amino acid residue. The invention also includes polynucleotides encoding the TCR molecules, and host cells containing the said polynucleotides. Patient derived T cells may have the polynucleotides encoding the TCR molecules introduced therein, and the engineered T cells may be introduced into the patient in order to combat a WT1-expressing malignancy.
    Type: Application
    Filed: August 26, 2014
    Publication date: May 28, 2015
    Inventors: Hans Josef Stauss, Liquan Gao, Shao-An Xue
  • Publication number: 20150139982
    Abstract: Antibodies and antigen binding fragments that specifically binds to Siglec-15 are described herein. These antibodies or antigen binding fragments may have the ability of inhibiting differentiation of osteoclasts and/or the ability of inhibiting the bone resorption activity of osteoclasts. Compositions and cells expressing anti-Siglec-15 antibodies or antigen binding fragments are also disclosed herewith. Anti-Siglec-15 antibodies may also be useful for the treatment of bone loss, or bone diseases. Methods for the detection or diagnosis of bone loss or bone-related diseases are also described.
    Type: Application
    Filed: July 17, 2013
    Publication date: May 21, 2015
    Applicant: ALETHIA BIOTHERAPEUTICS INC.
    Inventors: Matthew Stuible, Gilles Bernard Tremblay, Traian Sulea, Anna N. Moraitis, Mario Filion
  • Publication number: 20150141622
    Abstract: The present invention provide purified Flt4 receptor tyrosine kinase polypeptides and fragments thereof, polynucleotides encoding such polypeptides, antibodies that specifically bind such polypeptides, and uses therefor.
    Type: Application
    Filed: November 17, 2014
    Publication date: May 21, 2015
    Inventors: KARI ALITALO, TAIJA MAKINEN
  • Publication number: 20150139985
    Abstract: The present invention relates to immunoglobulins that bind IgE and Fc?RIIb with high affinity, said compositions being capable of inhibiting cells that express membrane-anchored IgE. Such compositions are useful for treating IgE-mediated disorders, including allergies and asthma.
    Type: Application
    Filed: October 8, 2014
    Publication date: May 21, 2015
    Inventors: JOHN DESJARLAIS, SEUNG Y. CHU, HOLLY M. HORTON, MATTHEW J. BERNETT
  • Publication number: 20150139988
    Abstract: Provided are glycoengineered populations of Fc domain-containing binding proteins with a reduced anti-drug immune response (ADA). Also provided are methods of treating disease using such compositions, and methods and host for making such compositions.
    Type: Application
    Filed: November 14, 2014
    Publication date: May 21, 2015
    Applicant: ABBVIE, INC.
    Inventors: Boris Labkovsky, Tariq Ghayur, Georgeen Gaza-Bulseco, Pratibha Mishra, Subramanya Hedge, Sudha Krishnan
  • Publication number: 20150140609
    Abstract: Monoclonal antibodies that specifically bind to M.96. Also included are methods of using these antibodies to treat mammals having or at risk of having 006-mediated diseases, or to diagnose % Q mediated diseases.
    Type: Application
    Filed: July 28, 2014
    Publication date: May 21, 2015
    Inventors: Shelia M. Violette, Paul H. Weinreb, Kenneth J. Simon, Dean Sheppard, Diane R. Leone
  • Publication number: 20150140591
    Abstract: The invention concerns the field of cell culture technology. It concerns RNA having a specific sequence, expression vectors encoding said RNA, production host cell lines comprising said RNA, and methods of producing recombinant biopharmaceutical products using engineered host cell with altered levels of said RNAs, such as small non-coding RNAs, preferably microRNAs (miRNAs). The invention also relates to engineered host cells with altered levels in one or more of said RNAs. Those cell lines have improved secretion and/or growth characteristics in comparison to control cell lines.
    Type: Application
    Filed: June 4, 2013
    Publication date: May 21, 2015
    Inventors: Lore Florin, Hitto Kaufman, Angelika Hausser, Monilola Olayioye, Michaela Strotbek