Immunoglobulin Or Antibody Is Chimeric, Mutated, Or A Recombined Hybrid (e.g., Bifunctional, Bispecific, Rodent-human Chimeric, Single Chain, Rfv, Immunoglobuin Fusion Protein, Etc.) Patents (Class 435/328)
  • Patent number: 10711054
    Abstract: The present invention relates to a binding molecule comprising at least three binding specificities, wherein (a) the first specificity is for a Hepatitis B virus (HBV) surface antigen selected from HBV small surface antigen, HBV medium surface antigen and HBV large surface antigen; (b) (i) the second and third specificity are for CD3 and CD28, respectively; or (ii) the second and third specificity are selected from specificities for CD16, CD56, NKp30, NKp46, 4-1BB and NKG2D; and (c) each binding specificity is provided by one or more binding sites, each binding site being independently provided by (i) a set of six complementarity determining regions (CDRs), wherein said set of six CDRs consists of a first set of three CDRs and a second set of three CDRs, wherein said first and said second set is each comprised in an immunoglobulin domain; or (ii) a set of three CDRs, wherein said set of three CDRs is comprised in an immunoglobulin domain.
    Type: Grant
    Filed: March 16, 2016
    Date of Patent: July 14, 2020
    Assignees: Helmholtz Zentrum München—Deutsches Forschungszentrum fur Gesundheit und umwelt (GmbH), DEUTSCHES KREBSFORSCHUNGSZENTRUM, TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Ulrike Protzer, Felix Bohne, Oliver Quitt, Frank Momburg, Gerhard Moldenhauer
  • Patent number: 10624973
    Abstract: The invention provides compositions and methods useful for the depletion of cells, such as CD45+, CD135+, CD34+, CD90+, and/or CD110+ cells, and for the treatment of various hematopoietic diseases, metabolic disorders, cancers, and autoimmune diseases, among others. Described herein are antibodies, antigen-binding fragments, ligands, and conjugates thereof that can be applied to effect the treatment of these conditions, for instance, by depleting a population of CD45+, CD135+, CD34+, CD90+, or CD110+ cells in a patient, such as a human. The compositions and methods described herein can be used to treat a disorder directly, for instance, by depleting a population of CD45+, CD135+, CD34+, CD90+, or CD110+ cancer cells or autoimmune cells.
    Type: Grant
    Filed: February 28, 2019
    Date of Patent: April 21, 2020
    Assignee: Magenta Therapeutics, Inc.
    Inventors: Andrew Nixon, Dwight Morrow, Adam Hartigan
  • Patent number: 10543253
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: November 28, 2018
    Date of Patent: January 28, 2020
    Assignee: Heat Biologics, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10525102
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: June 29, 2018
    Date of Patent: January 7, 2020
    Assignee: Heat Biologics, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10513548
    Abstract: The present invention relates, in part, to, chimeric proteins which include the extracellular domain of colony stimulating factor 1 receptor (CSF1R) and their use in the treatment of diseases, such as immunotherapies for cancer and/or an inflammatory disease.
    Type: Grant
    Filed: December 18, 2018
    Date of Patent: December 24, 2019
    Assignee: Shattuck Labs, Inc.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10421810
    Abstract: Chimeric antigen receptors containing tumor necrosis factor receptor superfamily member transmembrane domains are disclosed. Nucleic acids, recombinant expression vectors, host cells, antigen binding fragments, and pharmaceutical compositions, relating to the chimeric antigen receptors are also disclosed. Methods of treating or preventing cancer in a subject, and methods of making chimeric antigen receptor T cells are also disclosed.
    Type: Grant
    Filed: October 7, 2016
    Date of Patent: September 24, 2019
    Assignee: LENTIGEN TECHNOLOGY, INC.
    Inventors: Rimas Orentas, Dina Schneider, Boro Dropulic
  • Patent number: 10253086
    Abstract: The invention provides compositions and methods for treating diseases associated with expression of CD19, e.g., by administering a recombinant T cell comprising the CD19 CAR as described herein, in combination with one or more B-cell inhibitors, e.g., inhibitors of one or more of CD10, CD20, CD22, CD34, CD123, FLT-3, ROR1, CD79b, CD179b, or CD79a. The disclosure additionally features novel antigen binding domains and CAR molecules directed to CD20 and CD22, and uses, e.g., as monotherapies or in combination therapies. The invention also provides kits and compositions described herein.
    Type: Grant
    Filed: April 8, 2016
    Date of Patent: April 9, 2019
    Assignees: Novartis AG, The Trustees of the University of Pennsylvania
    Inventors: Hans Bitter, Jennifer Mary Bordeaux, Barbara Brannetti, Jennifer Brogdon, Naveen Kumar Dakappagari, Saar Gill, Steven Highfill, Lu Huang, Carl H. June, Ju Young Kim, Ming Lei, Na Li, Andreas Loew, Elena Orlando, Marco Ruella, Thai Tran, Jimin Zhang, Li Zhou
  • Patent number: 10188701
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: December 22, 2017
    Date of Patent: January 29, 2019
    Assignee: HEAT BIOLOGICS, INC.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 9987373
    Abstract: Glycoproteins comprising a glycan of the formula (102) are disclosed; wherein b is 0 or 1; the GlcNAc residue optionally fucosylated; and Su(A)x is a sugar derivative comprising x functional groups A, wherein x is 1, 2, 3 or 4 and A is independently selected from the group consisting of an azido group, a keto group, an alkynyl group, a thiol group, a halogen, a sulfonyloxy group, a halogenated acetamido group, a mercaptoacetamido group and a sulfonylated hydroxyacetamido group. Protein-conjugates having glycoproteins according to the invention conjugated to a molecule of interest (e.g., an active substance) are also disclosed. Examples include modified antibodies, antibody-conjugates, and antibody-drug conjugates (ADCs). Processes for the preparation of the modified glycoproteins according to the invention and methods for the preparation of a protein-conjugate according to the invention are mentioned.
    Type: Grant
    Filed: October 14, 2014
    Date of Patent: June 5, 2018
    Assignee: Synaffix B.V.
    Inventors: Floris Louis Van Delft, Remon Van Geel, Maria Antonia Wijdeven
  • Patent number: 9932372
    Abstract: Porcine circovirus (PCV2) vaccine compositions comprising a peptide antigen derived from a PCV2 capsid protein are described. In various embodiments, the peptide antigen contains amino acids of the capsid protein from about amino acid 47 to about amino acid 202. In some embodiments, the peptide antigen is optionally linked to an artificial T helper epitope and/or mixed with T helper epitopes derived from the ORF1 and ORF3 proteins of PCV2. Methods of using PCV2 vaccine compositions are also described. In various embodiments, a vaccine composition is used in animals for the prevention of PCV2 infection. In other embodiments, a PCV2 vaccine composition is used as an antigen for diagnosing PCV2 infection.
    Type: Grant
    Filed: July 8, 2010
    Date of Patent: April 3, 2018
    Assignee: UNITED BIOMEDICAL, INC.
    Inventors: Chang Yi Wang, Wen-Jiun Peng
  • Patent number: 9868774
    Abstract: The disclosure provides a chimeric antigen receptor (CAR) comprising a) an antigen binding domain of HA22, a transmembrane domain, and an intracellular T cell signaling domain; or b) an antigen binding domain of BL22, a transmembrane domain, and an intracellular T cell signaling domain comprising CD28 and/or CD137. Nucleic acids, recombinant expression vectors, host cells, populations of cells, antibodies, or antigen binding portions thereof, and pharmaceutical compositions relating to the CARs are disclosed. Methods of detecting the presence of cancer in a mammal and methods of treating or preventing cancer in a mammal are also disclosed.
    Type: Grant
    Filed: October 19, 2012
    Date of Patent: January 16, 2018
    Assignee: The United States of America, as represented by the Secretary, Department of Health and Human Services
    Inventors: Rimas J. Orentas, Crystal L. Mackall, Ira H. Pastan
  • Patent number: 9534246
    Abstract: The invention provides methods for the rapid identification and selection of cell lines suitable for biopharmaceuticals production, which do no utilize animal derived components.
    Type: Grant
    Filed: June 29, 2011
    Date of Patent: January 3, 2017
    Assignee: Glaxo Group Limited
    Inventors: Ekaterini Kotsopoulou, Richard Priest, Mark Uden
  • Patent number: 9518123
    Abstract: The present invention provides compositions and methods for treating cancer in a human. The invention includes relates to administering a genetically modified T cell to express a CAR wherein the CAR comprises an antigen binding domain, a transmembrane domain, a costimulatory signaling region, and a CD3 zeta signaling domain.
    Type: Grant
    Filed: January 15, 2016
    Date of Patent: December 13, 2016
    Assignee: The Trustees of the University of Pennsylvania
    Inventors: Carl H. June, Bruce L. Levine, David L. Porter, Michael D. Kalos, Michael C. Milone
  • Patent number: 9409989
    Abstract: The invention relates to a method of preparing heteromultimeric polypeptides such as bispecific antibodies, bispecific immunoadhesins and antibody-immunoadhesin chimeras. The invention also relates to the heteromultimers prepared using the method. Generally, the method provides a multispecific antibody having a common light chain associated with each heteromeric polypeptide having an antibody binding domain. Additionally the method further involves introducing into the multispecific antibody a specific and complementary interaction at the interface of a first polypeptide and the interface of a second polypeptide, so as to promote heteromultimer formation and hinder homomultimer formation; and/or a free thiol-containing residue at the interface of a first polypeptide and a corresponding free thiol-containing residue in the interface of a second polypeptide, such that a non-naturally occurring disulfide bond is formed between the first and second polypeptide.
    Type: Grant
    Filed: December 27, 2013
    Date of Patent: August 9, 2016
    Assignee: Genetech, Inc.
    Inventors: W. Robert Arathoon, Paul J. Carter, Anne M. Merchant, Leonard G. Presta
  • Patent number: 9376492
    Abstract: The present invention relates to agents for use in treating cancer. The agent to be used is an antagonist of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO:1), or a fragment or variant thereof, of the EC2 domain of Dsg2. Also included in the invention are specific polypeptides and pharmaceutical preparations. Also included in the invention is a method of screening for antagonists of Dsg2, wherein the antagonist modulates the function of the amino acid sequence: TQDVFVGSVEELSAAHTLVMKINATDADEPNTLNSKISYR (SEQ ID NO: 1), or a fragment or variant thereof, of the EC2 domain of Dsg2.
    Type: Grant
    Filed: September 22, 2010
    Date of Patent: June 28, 2016
    Assignee: Asclepiumm Limited
    Inventor: Min-Che Chen
  • Patent number: 9365641
    Abstract: The present invention provides compositions and methods for treating cancer in a human. The invention relates to targeting the stromal cell population in a tumor microenvironment. For example, in one embodiment, the invention provides a composition that is targeted to fibroblast activation protein (FAP). The invention includes a chimeric antigen receptor (CAR) which comprises an anti-FAP domain, a transmembrane domain, and a CD3zeta signaling domain.
    Type: Grant
    Filed: September 30, 2013
    Date of Patent: June 14, 2016
    Assignees: The Trustees of the University of Pennsylvania, The Wistar Institute of Anatomy and Biology
    Inventors: Carl H. June, Ellen Pure, Liang-Chuan Wang, Steven Albelda, John Scholler
  • Patent number: 9156916
    Abstract: Provided herein are methods for modulating one or more of a T-helper cell or monocyte lineage cell-mediated immune response in a subject, the method comprises administering to the subject an effective amount of a compound which binds to surface membrane immunoglobulin D (smIgD). Also provided are methods of diagnosis of one or more of a T-helper cell or monocyte lineage cell-mediated immune disease, and compositions and kits for use in such methods.
    Type: Grant
    Filed: April 27, 2007
    Date of Patent: October 13, 2015
    Assignees: The University of Sydney, Northern Sydney and Central Coast Area Health Service
    Inventors: Tue G. Nguyen, Jonathan M. Morris, Eileen D. M. Gallery, Sharon McCracken
  • Patent number: 9139654
    Abstract: The present invention relates to the field glycosylation engineering of proteins. More particular, the present invention is directed to the glycosylation engineering of proteins to provide proteins with improved therapeutic properties, e.g., antibodies, antibody fragments, or a fusion protein that includes a region equivalent to the Fc region of an immunoglobulin, with enhanced Fc-mediated cellular cytotoxicity.
    Type: Grant
    Filed: December 23, 2010
    Date of Patent: September 22, 2015
    Assignee: Roche GlyeArt AG
    Inventors: Pablo Umaña, Joël Jean-Mairet, James E. Bailey, M. Sean Bailey
  • Publication number: 20150147302
    Abstract: A T cell receptor molecule (TCR) containing an alpha chain portion and a beta chain portion wherein the alpha chain portion contains three complementarity determining regions (CDRs): CDR1?: SSYSPS CDR2?: YTSAATL CDR3?: VVSPF-SGGGADGLT or comprising or consisting of SPPSGGGADGLT and the beta chain portion contains three complementarity determining regions (CDRs): CDR1?: DFQATT CDR2?: SNEGSKA CDR3?: comprising SARDGGEG or comprising or consisting of RDGGEGSETQY, or wherein up to three amino acid residues in one or more CDRs are replaced by another amino acid residue. The invention also includes polynucleotides encoding the TCR molecules, and host cells containing the said polynucleotides. Patient derived T cells may have the polynucleotides encoding the TCR molecules introduced therein, and the engineered T cells may be introduced into the patient in order to combat a WT1-expressing malignancy.
    Type: Application
    Filed: August 26, 2014
    Publication date: May 28, 2015
    Inventors: Hans Josef Stauss, Liquan Gao, Shao-An Xue
  • Publication number: 20150139985
    Abstract: The present invention relates to immunoglobulins that bind IgE and Fc?RIIb with high affinity, said compositions being capable of inhibiting cells that express membrane-anchored IgE. Such compositions are useful for treating IgE-mediated disorders, including allergies and asthma.
    Type: Application
    Filed: October 8, 2014
    Publication date: May 21, 2015
    Inventors: JOHN DESJARLAIS, SEUNG Y. CHU, HOLLY M. HORTON, MATTHEW J. BERNETT
  • Publication number: 20150139988
    Abstract: Provided are glycoengineered populations of Fc domain-containing binding proteins with a reduced anti-drug immune response (ADA). Also provided are methods of treating disease using such compositions, and methods and host for making such compositions.
    Type: Application
    Filed: November 14, 2014
    Publication date: May 21, 2015
    Applicant: ABBVIE, INC.
    Inventors: Boris Labkovsky, Tariq Ghayur, Georgeen Gaza-Bulseco, Pratibha Mishra, Subramanya Hedge, Sudha Krishnan
  • Publication number: 20150139982
    Abstract: Antibodies and antigen binding fragments that specifically binds to Siglec-15 are described herein. These antibodies or antigen binding fragments may have the ability of inhibiting differentiation of osteoclasts and/or the ability of inhibiting the bone resorption activity of osteoclasts. Compositions and cells expressing anti-Siglec-15 antibodies or antigen binding fragments are also disclosed herewith. Anti-Siglec-15 antibodies may also be useful for the treatment of bone loss, or bone diseases. Methods for the detection or diagnosis of bone loss or bone-related diseases are also described.
    Type: Application
    Filed: July 17, 2013
    Publication date: May 21, 2015
    Applicant: ALETHIA BIOTHERAPEUTICS INC.
    Inventors: Matthew Stuible, Gilles Bernard Tremblay, Traian Sulea, Anna N. Moraitis, Mario Filion
  • Publication number: 20150141622
    Abstract: The present invention provide purified Flt4 receptor tyrosine kinase polypeptides and fragments thereof, polynucleotides encoding such polypeptides, antibodies that specifically bind such polypeptides, and uses therefor.
    Type: Application
    Filed: November 17, 2014
    Publication date: May 21, 2015
    Inventors: KARI ALITALO, TAIJA MAKINEN
  • Publication number: 20150140609
    Abstract: Monoclonal antibodies that specifically bind to M.96. Also included are methods of using these antibodies to treat mammals having or at risk of having 006-mediated diseases, or to diagnose % Q mediated diseases.
    Type: Application
    Filed: July 28, 2014
    Publication date: May 21, 2015
    Inventors: Shelia M. Violette, Paul H. Weinreb, Kenneth J. Simon, Dean Sheppard, Diane R. Leone
  • Publication number: 20150140591
    Abstract: The invention concerns the field of cell culture technology. It concerns RNA having a specific sequence, expression vectors encoding said RNA, production host cell lines comprising said RNA, and methods of producing recombinant biopharmaceutical products using engineered host cell with altered levels of said RNAs, such as small non-coding RNAs, preferably microRNAs (miRNAs). The invention also relates to engineered host cells with altered levels in one or more of said RNAs. Those cell lines have improved secretion and/or growth characteristics in comparison to control cell lines.
    Type: Application
    Filed: June 4, 2013
    Publication date: May 21, 2015
    Inventors: Lore Florin, Hitto Kaufman, Angelika Hausser, Monilola Olayioye, Michaela Strotbek
  • Patent number: 9035128
    Abstract: Genetically modified mice are provided that express human ? variable (hV?) sequences, including mice that express hV? sequences from an endogenous mouse ? light chain locus, mice that express hV? sequences from an endogenous mouse ? light chain locus, and mice that express hV? sequences from a transgene or an episome wherein the hV? sequence is linked to a mouse constant sequence. Mice are provided that are a source of somatically mutated human ? variable sequences useful for making antigen-binding proteins. Compositions and methods for making antigen-binding proteins that comprise human ? variable sequences, including human antibodies, are provided.
    Type: Grant
    Filed: June 22, 2011
    Date of Patent: May 19, 2015
    Assignee: Regeneron Pharmaceuticals, Inc.
    Inventors: Lynn MacDonald, Sean Stevens, Cagan Gurer, Andrew J. Murphy, Karolina A. Hosiawa
  • Publication number: 20150132314
    Abstract: This invention provides fully human monoclonal antibodies that recognize IL-17F and/or the heterodimeric IL-17A/IL-17F complex, but do not recognize IL-17A. The invention further provides methods of using such monoclonal antibodies as a therapeutic, diagnostic, and prophylactic.
    Type: Application
    Filed: October 6, 2014
    Publication date: May 14, 2015
    Inventors: Krzysztof MASTERNAK, Francois ROSSEAU
  • Publication number: 20150133638
    Abstract: The invention provides engineered heteromultimeric protein complexes constructed using one, two, or three tethers and methods for making, using, and purifying such complexes, such as antibodies with different binding properties.
    Type: Application
    Filed: August 8, 2014
    Publication date: May 14, 2015
    Applicant: GENENTECH, INC.
    Inventors: BERND WRANIK, DAN L. EATON, ERIN H. CHRISTENSEN, JIANSHENG WU
  • Publication number: 20150133641
    Abstract: The invention relates, in one aspect, generally to novel concept of guided selection of antibody variable domains, combination and expression entirely in vivo. An application is to produce multivalent polypeptides. The present invention relates to multivalent (eg, multispecific) antibodies, antibody chains and polypeptides, as well as heavy chain-only antibodies (H2 antibodies) that are devoid of light chains. The invention further relates to the selection, maturation and production of these in vivo in non-human vertebrates and non-human vertebrate cells. To this end the invention also relates to such non-human vertebrates and cells. The invention also relates to the provision of means to produce and select heavy chain-only antibodies and heavy chains comprising variable domains that have undergone affinity maturation.
    Type: Application
    Filed: November 17, 2014
    Publication date: May 14, 2015
    Inventors: Volker Germaschewski, E-Chiang Lee, Hanif Ali, Jasper Clube
  • Publication number: 20150132307
    Abstract: The present invention relates to Bispecific antibodies against human TWEAK and human IL17 (bispecific TWEAK-IL17 antibodies), methods for their production, pharmaceutical compositions containing said antibodies, and uses thereof
    Type: Application
    Filed: October 3, 2014
    Publication date: May 14, 2015
    Applicant: Hoffmann-La Roche Inc
    Inventors: JOHANNES AUER, Martin Bader, Jens Fischer, Hubert Kettenberger, Maximiliane Hilger, Stefan Lorenz, Joerg Moelleken
  • Patent number: 9028812
    Abstract: The invention is directed to modified T cells, methods of making and using isolated, modified T cells, and methods of using these isolated, modified T cells to address diseases and disorders. In one embodiment, this invention broadly relates to TCR-deficient T cells, isolated populations thereof, and compositions comprising the same. In another embodiment of the invention, these TCR-deficient T cells are designed to express a functional non-TCR receptor. The invention also pertains to methods of making said TCR-deficient T cells, and methods of reducing or ameliorating, or preventing or treating, diseases and disorders using said TCR-deficient T cells, populations thereof, or compositions comprising the same.
    Type: Grant
    Filed: October 29, 2010
    Date of Patent: May 12, 2015
    Assignee: The Trustees of Dartmouth College
    Inventor: Charles L. Sentman
  • Publication number: 20150125444
    Abstract: Provided are polypeptides comprising a variant IgG Fc domain, wherein the polypeptides exhibit reduced or ablated effector functions (e.g., ADCC and/or CDC) and increased stability and plasma half-life compared to a parent polypeptide. Also provided are compositions, methods of treatment, and methods to diminish Fc-induced effector function in a parent polypeptide.
    Type: Application
    Filed: April 17, 2013
    Publication date: May 7, 2015
    Inventors: Ping Tsui, Martin Borrok II, William Dall'Acqua
  • Publication number: 20150125460
    Abstract: This invention provides antibodies that recognize the B Cell Maturation Antigen (BCMA) and that bind naïve B cells, plasma cells, and/or memory B cells. The invention further provides methods for depleting naïve B cells, plasma cells, and memory B cells, and for treating B cell-related disorders, including lymphomas and autoimmune diseases.
    Type: Application
    Filed: January 14, 2015
    Publication date: May 7, 2015
    Applicant: BIOGEN IDEC MA INC.
    Inventors: Susan L. Kalled, Yen-Ming Hsu
  • Publication number: 20150125449
    Abstract: Provided herein are monovalent antibody constructs. In specific embodiments is a monovalent antibody construct comprising: an antigen-binding polypeptide construct which monovalently binds an antigen; and a dimeric Fc polypeptide construct comprising a CH3 domain, said construct comprising two monomeric Fc polypeptides, wherein one said monomeric Fc polypeptide is fused to at least one polypeptide from the antigen-binding polypeptide construct. These therapeutically novel molecules encompass monovalent constructs that display an increase in binding density and Bmax (maximum binding at a target to antibody ratio of 1:1) to a target cell displaying said antigen as compared to a corresponding monospecific bivalent antibody construct with two antigen binding regions. Provided herein are methods for creation of monovalent antibody constructs that shows superior effector efficacy as compared to the corresponding bivalent antibody construct at equimolar concentrations.
    Type: Application
    Filed: May 8, 2013
    Publication date: May 7, 2015
    Inventors: Gordon Yiu Kon Ng, Surjit Bhimarao Dixit, Thomas Spreter Von Kreudenstein
  • Publication number: 20150125397
    Abstract: Engineered multivalent and multispecific binding proteins that bind immune cell receptors and/or autoantigens are provided, along with methods of making and uses in the prevention, diagnosis, prognosis and/or treatment of disease.
    Type: Application
    Filed: October 6, 2014
    Publication date: May 7, 2015
    Inventors: Chee-Ho Choi, Tariq Ghayur, Ann Marshak-Rothstein, Krishna Moody
  • Publication number: 20150125385
    Abstract: The invention relates to variants of an antibody or antigen-binding fragment that binds specifically to an endosialin tumor endothelial marker 1 (TEM1), and prophylactic, diagnostic, and therapeutic methods using the same.
    Type: Application
    Filed: March 15, 2013
    Publication date: May 7, 2015
    Inventors: George Coukos, Chunsheng Li
  • Patent number: 9023996
    Abstract: The present invention relates to anti-FLT3 antibodies with a modified Fc region comprising the amino acid substitutions 239D and 332E to enhance antibody-dependent cell cytotoxicity (ADCC) of these antibodies. The invention further relates to pharmaceutical compositions containing these antibodies, nucleic acids encoding these antibodies as well as methods of using such antibodies.
    Type: Grant
    Filed: December 23, 2010
    Date of Patent: May 5, 2015
    Assignee: Synimmune GmbH
    Inventors: Ludger Grosse-Hovest, Hans-Joerg Buehring, Martin Hofmann, Steffen Aulwurm, Grundram Jung
  • Publication number: 20150118693
    Abstract: The invention provides a method of high-throughput sorting of high expression protein-producing cell, which utilizes linking a protein and a transmembrane domain with a self-processing cleavage site and regulating the secretion of the protein or expression of protein on the cell membrane by adding self-processing cleavage enzyme inhibitor. Then, the high expression cell line can be high-throughput sorted by a detection technique. The invention also provides a recombinant nucleotide sequence and a vector used in the method and a cell sorted by the method.
    Type: Application
    Filed: April 28, 2014
    Publication date: April 30, 2015
    Applicant: Taipei Medical University
    Inventors: KUO-HSIANG CHUANG, TIAN-LU CHENG, I-SHIUAN CHIANG, YUAN-CHIN HSIEH
  • Publication number: 20150118711
    Abstract: Humanized antibodies specific to human interleukin 20 (IL-20) and uses thereof in treating diseases associated with the IL-20 signaling pathway, e.g., osteoporosis, inflammatory disease (e.g., rheumatoid arthritis), cancer, stroke, and renal failure.
    Type: Application
    Filed: October 29, 2013
    Publication date: April 30, 2015
    Applicant: NATIONAL CHENG KUNG UNIVERSITY
    Inventors: MING-SHI CHANG, NAOYA TSURUSHITA, SHANKAR KUMAR
  • Publication number: 20150118228
    Abstract: A chimeric ErbB ligand binding molecule is disclosed along with its pharmaceutically acceptable salt forms. The molecule is a protein that as part of its sequence includes the sequence of SEQ ID NOS: 1, 2, or 3. The molecule can be fused to an IgGFc and especially IgGFc containing cysteine to serine changes in the hinge region. For example, the fusion can be to IgG 1Fc DNA sequences that encode the binding molecules are also contemplated as well as vectors containing such DNA sequences and hosts that contain such vectors. Pharmaceutical compositions are contemplated that contain the binding molecule along with a pharmaceutically acceptable excipient.
    Type: Application
    Filed: April 25, 2013
    Publication date: April 30, 2015
    Inventor: Jason E. Hill
  • Publication number: 20150118153
    Abstract: The present invention provides affinity matured humanized monoclonal antibodies, bi-specific antibodies, antibody conjugates, and fusion proteins that bind to the chemokine receptor CCR4. This antibody is derived from mAb 1567 and recognizes the same epitope. Binding of the antibodies disclosed herein to CCR4 inhibits ligand-mediated activities and is used to treat symptoms of cancer. Moreover, the antibody is used in combination with vaccines to suppress the activity of regulatory T cells.
    Type: Application
    Filed: May 6, 2013
    Publication date: April 30, 2015
    Inventors: Wayne A. Marasco, Jianhua Sui, Quan Zhu, De-Kuan Chang
  • Publication number: 20150110788
    Abstract: The present invention provides a bispecific antibody having a binding domain that binds to FGF2, a pharmaceutical composition comprising same, and methods of treatment comprising administering such a pharmaceutical composition to a patient.
    Type: Application
    Filed: March 6, 2013
    Publication date: April 23, 2015
    Applicant: GALAXY BIOTECH, LLC
    Inventors: Kyung Jin Kim, Hangil Park
  • Publication number: 20150104865
    Abstract: The present invention provides an engineered multidomain protein including at least two nonidentical engineered domains, each of which contains a protein-protein interaction interface containing amino acid sequence segments derived from two or more existing homologous parent domains, thereby conferring on the engineered domains assembly specificities distinct from assembly specificities of the parent domains. In particular, the engineered domains form heterodimers with one another preferentially over forming homodimers. Methods of designing and using the engineered proteins are also included.
    Type: Application
    Filed: October 3, 2014
    Publication date: April 16, 2015
    Inventors: Jonathan H. Davis, James S. Huston
  • Publication number: 20150104452
    Abstract: The present invention relates to engineered multivalent and multispecific binding proteins, methods of making, and specifically to their uses in the prevention, diagnosis, and/or treatment of disease.
    Type: Application
    Filed: June 10, 2014
    Publication date: April 16, 2015
    Inventors: Tariq Ghayur, Edward B. Reilly, Andrew Phillips, Randy L. Bell, Yingchun Li, Hua Ying, Susan E. Morgan-Lappe, Gillian A. Kingsbury, Jieyi Wang, Suzanne M. Norvell, Junjian Liu
  • Publication number: 20150104468
    Abstract: The present disclosure provides methods of site-specific labeling of antibodies, using proteins having 4?-phosphopantetheinyl transferase activity that catalyze post-translational modification of peptide sequences (“peptide tags”) incorporated into one or more specific sites of an antibody of interest. Enzymatic labeling enables quantitative and irreversible covalent modification of a specific serine residue within the peptide tags incorporated into the antibody, and thus creates desirable antibody conjugates.
    Type: Application
    Filed: May 31, 2013
    Publication date: April 16, 2015
    Applicant: IRM LLC
    Inventors: Bernhard Hubert Geierstanger, Jan Grunewald, Badry Bursulaya
  • Patent number: 9005963
    Abstract: The present invention relates to amino acid sequences that are directed against (as defined herein) human cellular receptors for viruses and/or bacteria such as e.g. NANOBODIES specifically recognizing hCD4, hCXCR4, hCCR5, hTLR4, human alphaV integrin, human beta3 integrin, human beta1 integrin, human alpha2 integrin, hCD81, hSR-BI, hClaudin-1, hClaudin-6 and hClaudin-9, as well as to compounds or constructs, and in particular proteins and polypeptides, that comprise or essentially consist of one or more such amino acid sequences. The amino acid sequences may be used to prevent human cell entry of HIV, HCV, adenoviruses, hantavirus, herpesvirus, echo-virus 1 and others.
    Type: Grant
    Filed: October 14, 2009
    Date of Patent: April 14, 2015
    Assignee: Ablynx N.V.
    Inventors: Christophe Blanchetot, Martine Smit, Regorius Leurs, Sven Jähnichen, Dominique Schols, Michael John Scott Saunders, Johannes Joseph Wilhelmus De Haard, Peter Vanlandschoot, Peter Verheesen
  • Patent number: 9005921
    Abstract: The invention provides humanized mouse anti-human IL-31 antibodies and antibody fragments that are capable of binding IL-31 and thereby neutralizing, inhibiting, limiting, or reducing the proinflammatory or pro-pruritic effects of IL-31.
    Type: Grant
    Filed: February 7, 2014
    Date of Patent: April 14, 2015
    Assignees: ZymoGenetics, Inc., Merck Serono S/A
    Inventors: Kent Bondensgaard, Roland Beckmann
  • Publication number: 20150099861
    Abstract: The present invention relates to humanized monoclonal antibodies comprising the CDRs of murine antibody BMA031, which bind to the apTCR.CD3 complex and possess improved biological properties.
    Type: Application
    Filed: September 12, 2012
    Publication date: April 9, 2015
    Applicant: GENZYME CORPORATION
    Inventors: Daniel Snell, Andreas Menrad, Gina Lacorcia, Srinivas Shankara, Huawei Qiu, Clark Pan, Benjamin Kebble
  • Publication number: 20150098944
    Abstract: Disclosed is a recombinant fusion protein containing an amino-acid sequence which comprises: (a) the Fc section or part of an Fc section of an immunoglobulin as component (A) or a functional variant of component (A); (b) the extracellular part of a TNF ligand or a partial sequence of the extracellular part of a TNF ligand as component (B) or a functional variant of component (B); and optionally (c) a transition area between component (A) and component (B), containing a linker.
    Type: Application
    Filed: October 23, 2014
    Publication date: April 9, 2015
    Inventors: Olivier Gaide, Pascal Schneider, Jurg Tschopp
  • Publication number: 20150099297
    Abstract: A chimeric protein is made from the combination of (i) a pathogen recognition module derived from a scavenger receptor and (ii) an anchor domain from a different scavenger receptor. The chimeric protein binds to specific pathogens and is useful in various treatments.
    Type: Application
    Filed: March 12, 2013
    Publication date: April 9, 2015
    Inventors: Karl Tryggvason, Timo Pikkarainen, Juha Ojala, Jonas Axelsson