Recombinant Dna Technique Included In Method Of Making A Protein Or Polypeptide Patents (Class 435/69.1)
  • Patent number: 10287592
    Abstract: The invention provides Bacillus host cell deficient in the production of a neutral protease and of a alkaline protease which host cell comprises a nucleic acid construct, wherein the nucleic acid construct comprises a polynucleotide encoding a compound of interest or encoding a compound involved in the synthesis of a compound of interest operably linked to a promoter sequence allowing for expression of the polynucleotide in the host cell, wherein the promoter comprises a bacteriophage promoter sequence, more preferably a bacteriophage SPO1 promoter sequence. Said host cell can advantageously be used in a method of production of a compound of interest.
    Type: Grant
    Filed: February 6, 2015
    Date of Patent: May 14, 2019
    Assignee: DSM IP Assets B.V.
    Inventors: Evert Tjeerd Van Rij, Martine Spaans, Hendrikus Bernardus Carolus Hillebrand
  • Patent number: 10288617
    Abstract: Newly identified proteins as markers for the detection of ovary tumors, or as therapeutic targets for treatment thereof; affinity ligands capable of selectively interacting with the newly identified markers, methods for tumor diagnosis and therapy using the same.
    Type: Grant
    Filed: October 26, 2010
    Date of Patent: May 14, 2019
    Assignee: Externautics Spa
    Inventors: Renata Grifantini, Piero Pileri, Susanna Campagnoli, Alberto Grandi, Matteo Parri, Andrea Pierleoni, Renzo Nogarotto
  • Patent number: 10280425
    Abstract: Provided are a minicircle DNA recombinant parental plasmid having a genetically engineered antibody gene expression cassette and a preparation method for the plasmid, a minicircle DNA having the genetically engineered antibody gene expression cassette, a preparation method for the DNA, and applications thereof, and, a host cell having the minicircle DNA, a preparation method for the cell, and applications thereof. Also provided are a genetically engineered antibody, a preparation method for same, and applications thereof.
    Type: Grant
    Filed: August 5, 2014
    Date of Patent: May 7, 2019
    Assignees: Shenzhen Institutes of Advanced Technology, Shenzhen Hornetcorn Biotechnology Company, Ltd.
    Inventors: Zhiying Chen, Fei Ma, Chengyi He
  • Patent number: 10280434
    Abstract: Compositions and methods for conferring pesticidal activity to bacteria, plants, plant cells, tissues and seeds are provided. Compositions comprising a coding sequence for a toxin polypeptide are provided. The coding sequences can be used in DNA constructs or expression cassettes for transformation and expression in plants and bacteria. Compositions also comprise transformed bacteria, plants, plant cells, tissues, and seeds. In particular, isolated toxin nucleic acid molecules are provided. Additionally, amino acid sequences corresponding to the polynucleotides are encompassed, and antibodies specifically binding to those amino acid sequences. In particular, the present invention provides for isolated nucleic acid molecules comprising nucleotide sequences encoding the amino acid sequence shown in SEQ ID NO:50-96, or the nucleotide sequence set forth in SEQ ID NO:1-47, as well as variants and fragments thereof.
    Type: Grant
    Filed: May 13, 2015
    Date of Patent: May 7, 2019
    Assignee: BASF Agricultural Solutions Seed US LLC
    Inventors: Kimberly S. Sampson, Daniel John Tomso, Razvan Valeriu Dumitru
  • Patent number: 10273451
    Abstract: The instant invention provides methods for immortalizing cells. The invention further provides immortalized cell lines, e.g., neuronal cell lines, and methods of using these cell lines in screening assays.
    Type: Grant
    Filed: January 16, 2015
    Date of Patent: April 30, 2019
    Assignee: The Johns Hopkins University
    Inventors: Ahmet Hoke, Weiran Chen
  • Patent number: 10273520
    Abstract: The present invention is concerned with a method of production of authentic human epidermal growth factor (EGF) and hyper-production of authentic basic fibroblast growth factor (bFGF) without any modification at either C- or N-terminal of the bFGF.
    Type: Grant
    Filed: January 18, 2017
    Date of Patent: April 30, 2019
    Inventor: Wan Keung Raymond Wong
  • Patent number: 10273491
    Abstract: Provided are a novel promoter and a method of producing a target product using the same.
    Type: Grant
    Filed: January 15, 2016
    Date of Patent: April 30, 2019
    Assignee: CJ CHEILJEDANG CORPORATION
    Inventors: Seung Bin Lee, Hyun Ae Bae, Ji Hye Lee, Young Lyeol Yang
  • Patent number: 10265437
    Abstract: This disclosure relates to methods for promoting bone formation or reducing bone destruction. This disclosure also relates to methods for promoting the recruitment of mesenchymal stem cells (MSCs) to a local site of injury or surgical intervention in bone to promote healing. In addition, this disclosure relates to methods for reducing or preventing mineral formation or bone growth, or reducing bone mass. The methods disclosed herein are useful for treating conditions such as osteopetrosis or osteoradionecrosis.
    Type: Grant
    Filed: March 13, 2015
    Date of Patent: April 23, 2019
    Assignee: The Research Foundation for the State University of New York
    Inventors: Bryan S. Margulies, Sean D. Deboyace
  • Patent number: 10253311
    Abstract: The present disclosure provides compositions, kits, genetically modified cells, non-human transgenic organisms, and methods for binding and/or cleaving a single stranded target nucleic acid. A method of cleaving includes contacting a single stranded target nucleic acid with (e.g., introducing into a cell) a subject argonaute (Ago) polypeptide and a guide RNA (e.g., having a 5?-OH). In some embodiments, a subject Ago polypeptide includes an amino acid sequence having 70% or more sequence identity with amino acids 282-430 and/or 431-639 of the Marinitoga piezophila argonaute (MpAgo) protein set forth in SEQ ID NO: 1. The present disclosure provides variant Ago polypeptides; and methods of use of same.
    Type: Grant
    Filed: April 9, 2015
    Date of Patent: April 9, 2019
    Assignee: The Regents of the University of California
    Inventors: Jennifer A. Doudna, Emine Kaya, Kilian R. Knoll
  • Patent number: 10253373
    Abstract: The present technology relates to genetic products the expression of which is associated with cancer diseases. The present technology also relates to the therapy and diagnosis of diseases in which the genetic products are expressed or aberrantly expressed, in particular cancer diseases.
    Type: Grant
    Filed: May 10, 2017
    Date of Patent: April 9, 2019
    Assignee: BIONTECH AG
    Inventors: Ugur Sahin, Özlem Türeci, Michael Koslowski
  • Patent number: 10253098
    Abstract: The present invention relates to an antibody preparation comprising modified antibodies of an animal or derivatives or fragments thereof, specific for an antigen, characterized in that the antibodies or derivatives or fragments thereof comprise an N-glycan structure free of fucose and xylose, and at least 90%, preferably at least 95%, more preferred at least 99%, most preferred at least 100% of the modified antibodies, derivatives or fragments thereof lack a C-terminal lysine residue.
    Type: Grant
    Filed: May 28, 2015
    Date of Patent: April 9, 2019
    Assignee: GREENOVATION BIOTECH GMBH
    Inventors: Manfred Schuster, Ralf Kircheis, Andreas Nechansky, Wolfgang Jost, Gilbert Gorr
  • Patent number: 10245249
    Abstract: The present disclosure provides nitroxyl donating pharmaceutical compositions comprising N-substituted hydroxylamine derivatives. The compositions are highly efficacious in treating cardiovascular diseases (e.g., heart failure), have a suitable toxicological profile, and are sufficiently stable for intravenous or oral administration.
    Type: Grant
    Filed: January 17, 2014
    Date of Patent: April 2, 2019
    Assignee: Cardioxyl Pharmaceuticals, Inc.
    Inventors: Vincent Jacob Kalish, John Reardon, Frederick Arthur Brookfield, Stephen Martin Courtney, Lisa Marie Frost, John P. Toscano
  • Patent number: 10246697
    Abstract: PmxA synthetase involved in polymyxin E synthesis, comprising four adenylation sites, characterized in that the second adenylation site has at least 90% identity with the peptide sequence SEQ ID NO 1: VTEAEKADLLGRFNDTTTEFPRGKTLIQLFEEQVERIPDAAAITLNEQE LTYRELNERVNRLARTLRSHGISKGRLVAILAERSIEMVVGMLAAHKAG AAYVPIDPEYPEERIRFLIEDSGGQVMLTQSRLRERLAGSDPVILLDDE SFYHEDGTNLNTGIEATDLACVIYTSGTTGKPKGNPVSHRNIVRVVQNT NYIDITERDHVLQLSSYSFDGATFDIFGALTNGARLVLVPYETLLEIGR LADLIQRERISVMFITTAFFNILVDVNVDCLRDVRAILFGGERVSVGHV RKALAHIGPGRLNHVYGPTESTVYTTYLPVDFVDELAVTVPIGRPISNT TVYIVDSRNKLLPIGVAGELCVGGEGLVRGYNNRPELTAEKFVDNPFVP GERMYRTGDLAKWLPDGTIEYVGRTDDQVKIRGFRIELGEIEAQLQKVE GIRKTTVFARENASGEKQLCAYYEADCELPAAELKSVLSKELPAYMIPA YLIQLERLPLTTNGKVDRRSLPAPEESLQPGGG, the underlined amino acids DGFFLGVVYK being conserved and forming a binding pocket specific for a leucine, isoleucine or valine residue.
    Type: Grant
    Filed: January 26, 2015
    Date of Patent: April 2, 2019
    Assignees: Centre National de la Recherche Scientifique (CNRS), Universite La Rochelle
    Inventors: Romain Chevrot, Fatoumata Tambadou, Thibault Caradec, Sandrine Didelot, Cyrille Barthelemy
  • Patent number: 10240128
    Abstract: The invention relates to a method for increasing the yield of replication-incompetent adenoviruses having at least a partial deletion in the E1-region, wherein the adenoviruses are generated in a production cell by: (a) expressing an adenoviral pIX polypeptide from a nucleic acid sequence encoding adenoviral pIX polypeptide under the control of at least a minimal endogenous pIX promoter and a heterologous promoter; and (b) expressing the elements necessary for the production and assembly of the adenoviruses, thereby increasing the yield of adenoviruses generated in the production cell in comparison to the yield in the absence of nucleic acid sequence encoding the adenoviral pIX polypeptide. Further, the invention relates to a method for constructing an adenovirus library, a production cell, and the use of an adenoviral pIX polypeptide for increasing the yield of replication-incompetent adenoviruses having at least a partial deletion in the E1-region.
    Type: Grant
    Filed: July 4, 2013
    Date of Patent: March 26, 2019
    Assignee: SIRION Biotech GmbH
    Inventors: Christian Thirion, Zsolt Ruzsics
  • Patent number: 10240179
    Abstract: The present invention relates to methods for the production of heat shock protein complexes for use in vaccine compositions. In particular, there is provided a method for increasing the level and immunogenicity of heat shock protein complexes produced in cells by subjecting the cells to specific stress inducing stimuli. The invention further extends to the use of heat shock protein complexes produced according to the methods of the invention in the preparation of vaccine compositions for the prevention and treatment of infectious diseases and cancerous conditions.
    Type: Grant
    Filed: March 23, 2012
    Date of Patent: March 26, 2019
    Assignee: Immunobiology Limited
    Inventors: Camilo Colaco, Ian McEntee
  • Patent number: 10238687
    Abstract: A liposomal rehydration salt formulation comprising phosphatidylcholine liposomes, salts, water, and a percentage inclusion ratio of salts (salts retained within said liposomes/total salts) of at least 40%; and a process for preparing said formulation using tangential ultrafiltration.
    Type: Grant
    Filed: October 3, 2017
    Date of Patent: March 26, 2019
    Assignee: EINSOF BIOHEALTH LIMITED
    Inventors: Alcides Nicastro, Alejandro Luis Barbarini
  • Patent number: 10233459
    Abstract: Isolated polynucleotides and polypeptides, and recombinant DNA constructs useful for conferring improved nitrogen use efficiency and/or drought stress tolerance; compositions (such as plants or seeds) comprising these recombinant DNA constructs; and methods utilizing these recombinant DNA constructs are disclosed. The recombinant DNA constructs comprise a polynucleotide operably linked to a promoter that is functional in a plant, wherein said polynucleotides encode abiotic stress tolerance polypeptides.
    Type: Grant
    Filed: July 2, 2015
    Date of Patent: March 19, 2019
    Inventors: Guihua Lu, Yang Gao, Cong Li, Junhua Liu, Guanfan Mao, Wei Wang, Xiping Wang, Changgui Wang
  • Patent number: 10233075
    Abstract: A method for forming a filter net on an MEMS sensor and an MEMS sensor are disclosed. The method comprises the following steps: disposing a dissociable adhesive tape on a base material, and forming a filter net on an adhesive surface of the dissociable adhesive tape; transferring the filter net on a film to form a self-adhesive coiled material; and transferring and adhering the filter net on the self-adhesive coiled material to collecting a hole of the MEMS sensor. The filter net formed by the method have fine and uniform meshes, and a yield is high. In addition, the method is suitable for large-scale and industrialized production.
    Type: Grant
    Filed: March 3, 2017
    Date of Patent: March 19, 2019
    Assignee: Goertek Inc.
    Inventors: Junkai Zhan, Zonglin Zhou, Guanxun Qiu, Mengjin Cai
  • Patent number: 10233225
    Abstract: Single chain insulin analogs are provided having high potency and specificity for the insulin receptor. As disclosed herein optimally sized linking moieties can be used to link human insulin A and B chains, or analogs or derivatives thereof, wherein the carboxy terminus of the B25 amino acid of the B chain is linked to the amino terminus of the A1 amino acid of the A chain via the intervening linking moiety. In on embodiment the linking moiety comprises a polyethylene glycol of 6-16 monomer units and in an alternative embodiment the linking moiety comprises a non-native amino acid sequence derived form the IGF-1 C-peptide and comprising at least 8 amino acids and no more than 12 amino acid in length. Also disclosed are prodrug and conjugate derivatives of the single chain insulin analogs.
    Type: Grant
    Filed: August 5, 2016
    Date of Patent: March 19, 2019
    Assignee: Indiana University Research and Technology Corporation
    Inventors: Richard D. DiMarchi, Yulia Azriel, Zachary Kaur, Jonathan Meyers, Todd Parody, Yan Zhao
  • Patent number: 10220088
    Abstract: Disclosed is a vaccine comprising a fiber protein, selected from fiber-2 protein of Fowl Adenovirus C (FAdV-C), fiber-2 protein of Fowl Adenovirus A (FAdV-A), fiber protein of Fowl Adenovirus B, D and E (FAdV-B, FAdV-D and FAdV-E), or an immunogenic fragment thereof for use in preventing hepatitis-hydropericardium Syndrome (HHS) or inclusion body hepatitis (IBH) or Gizzard Erosion (GE) in birds, preferably in poultry, especially in broilers.
    Type: Grant
    Filed: August 19, 2014
    Date of Patent: March 5, 2019
    Assignee: VETERINARMEDIZINISCHE UNIVERSITÄT WIEN
    Inventors: Michael Hess, Anna Schachner, Ana Marek, Barbara Jaskulska
  • Patent number: 10214570
    Abstract: The present disclosure provides a method of producing enzyme-specific inhibitors or substrate binding partners comprising: identifying active site residues of the substrate in the enzyme substrate complex or in substrate binding partner-substrate complex; randomizing the active site residues to produce a combinatorial library of substrate variants; and selecting substrate variants that inhibit enzyme activity or bind substrate as substrate-specific binding partners. The present disclosure also provides ubiquitin enzyme specific inhibitors and ubiquitin variants that bind ubiquitin interaction motifs.
    Type: Grant
    Filed: June 8, 2011
    Date of Patent: February 26, 2019
    Assignee: THE GOVERNING COUNCIL OF THE UNIVERSITY OF TORONTO
    Inventors: Sachdev Sidhu, Linda Beatty, Andreas Ernst
  • Patent number: 10208098
    Abstract: The present invention relates to the design and development of recombinant protein for the delivery of silencer RNA complex to mediate RNA interference since it represents a novel therapeutic approach to modulate several neurodegenerative disease-related genes across the blood-brain barrier (BBB). To overcome challenges due to this barrier for biologics and other biological complex, the present invention describes a method wherein peptide having sequence GGGGHLNILSTLWKYRC represented by SEQ ID NO. 9 known to target specific gangliosides was linked to a double-stranded RNA binding protein to bind and deliver silencer RNA to the brain parenchyma. The designed fusion protein comprising a double-stranded RNA-binding domain (dsRBD) of human Trans Activation response element (TAR) RNA Binding Protein (TARBP2) and a brain targeting peptide sequence that binds GM1. Conformation-specific binding of TARBP2 domain to silencer RNA results in the formation of homogenous serum-stable complex with GM1 targeting potential.
    Type: Grant
    Filed: September 15, 2016
    Date of Patent: February 19, 2019
    Assignee: Council of Scientific & Industrial Research
    Inventors: Gopal Vijaya, Ghulam H. Dar
  • Patent number: 10208131
    Abstract: The present invention intended to provide an artificial polyclonal immunoglobulin composition having a high therapeutic effect and high safety, and being capable of stable supply in a large amount. Specifically provided is an artificial polyclonal immunoglobulin composition containing, as active ingredients, 204 polypeptides represented by amino acid sequences set forth in SEQ ID NOS: 1 to 204 of the sequence listing, the polypeptides being plural kinds of single chain variable fragments (also referred to as ScFvs) each comprised of a heavy chain variable region, heavy chain constant region 1, and hinge region (VH-CH1-hinge) of an immunoglobulin, in which the heavy chain variable regions are different each other.
    Type: Grant
    Filed: December 17, 2012
    Date of Patent: February 19, 2019
    Assignee: National University Corporation Chiba University
    Inventor: Kazuo Suzuki
  • Patent number: 10208097
    Abstract: The present invention relates to a saxatilin derivative having an increased half life and a use thereof. The saxatilin derivative of the present invention has thrombolytic ability similar to that of saxatilin, which is the mother protein, a remarkably increased protein half life, and efficiently dissolves, for long period of time, blood clots already formed in blood vessels of an animal model with a FeCl3-induced carotid by using the same. Therefore, a composition containing, as an active ingredient, the saxatilin derivative of the present invention does not cause reocclusion after penetration and effectively opens to microvessels, and is thus very useful for treating angiostenosis or occlusive diseases (for example, cerebrovascular diseases, cardiovascular diseases, arteriosclerotic vascular diseases, coronary artery diseases, and peripheral vascular diseases).
    Type: Grant
    Filed: August 8, 2017
    Date of Patent: February 19, 2019
    Assignee: INDUSTRY-ACADEMIC COOPERATION FOUNDATION, YONSEI UNIVERSITY
    Inventors: Sung Yu Hong, Ji Hoe Heo, Il Kwon, Dong Ik Kim, Yang Soo Jang, Young Dae Kim
  • Patent number: 10208085
    Abstract: The present invention relates to decoy peptide or polypeptide consisting of a peptide sequence represented by the following Formula I: X1-Ala-X2—X3-Ile-Glu-X4 (I). It is noteworthy that the decoy peptide or polypeptide of the present invention significantly elevates phosphorylation levels of PLB by inhibiting PP1-mediated dephosphorylation. In addition, the decoy peptide or polypeptide provides cardio-protective effects by restoring of SERCA2a activity and inotropic effect of enhancing myocardial contractility. The present invention will contribute greatly to the prevention or treatment of diseases associated with PLB.
    Type: Grant
    Filed: July 5, 2013
    Date of Patent: February 19, 2019
    Assignee: GWANGJU INSTITUTE OF SCIENCE AND TECHNOLOGY
    Inventors: Woo Jin Park, Roger J. Hajjar, Jae Gyun Oh
  • Patent number: 10208094
    Abstract: A multimeric immunoglobulin-binding protein having improved properties as an affinity ligand for affinity chromatography, and an insoluble support immobilizing such a multimer. The immunoglobulin-binding protein is represented by the formula: (R1)n-(R2)m, or (R2)m-(R1)n. R2 is an immunoglobulin-binding domain including an amino acid residue that covalently bonds to an insoluble support upon immobilization reaction with the insoluble support, and R1 is an immunoglobulin-binding domain without containing an amino acid residue the presence of which in the sequence compared to when it is absent in the sequence reduces the immunoglobulin-binding activity of the support yielded by the immobilization reaction. The immunoglobulin-binding protein satisfies: (1) n is an integer of 5 to 9; (2) m is an integer of 1 or 2; (3) the n (R1) domains may or may not have the same sequence; and (4) the total number of domains (n+m) is 6 to 10.
    Type: Grant
    Filed: September 4, 2014
    Date of Patent: February 19, 2019
    Assignee: PROTENOVA CO., LTD.
    Inventors: Eiji Majima, Atsushi Shima
  • Patent number: 10208105
    Abstract: IVIG replacement compounds are derived from recombinant and/or biochemical creation of immunologically active biomimetic(s). These replacement compounds are then screened in vitro to assess each replacement compound's efficiency at modulating immune function. Particular replacement compounds are selected for further in vivo validation and dosage/administration optimization. Finally, the replacement compounds are used to treat a wide range of diseases, including inflammatory and autoimmune diseases.
    Type: Grant
    Filed: February 20, 2018
    Date of Patent: February 19, 2019
    Assignees: GLIKNIK INC., UNIVERSITY OF MARYLAND, BALTIMORE
    Inventors: Scott E. Strome, Dan H. Schulze, David S. Block, Henrik Olsen
  • Patent number: 10202609
    Abstract: Disclosed are a recombinant microorganism having enhanced L-amino acid producibility, wherein the recombinant microorganism is transformed to have an inactivated phage receptor thereof, and a method of producing an L-amino acid using the recombinant microorganism. The use of the recombinant microorganism may enable the production of the L-amino acid in a highly efficient manner.
    Type: Grant
    Filed: March 17, 2015
    Date of Patent: February 12, 2019
    Assignee: CJ CHEILJEDANG CORPORATION
    Inventors: Ji Sun Lee, Chang Il Seo, Ki Yong Cheong, Eun Sung Koh, Do Hyun Kwon, Kwang Ho Lee
  • Patent number: 10195287
    Abstract: A first aspect of the invention relates to a single chain insulin analog comprising: (A) the A-chain of human or animal insulin, or an analog or derivative thereof; (B) the B-chain of human or animal insulin, or an analog or derivative thereof; (C) one or more disulfide bonds between said A-chain and said B-chain; and (D) a further covalent link, L, between a functional group of an amino acid in the A-chain and a functional group of an amino acid in the B-chain, at least one of said functional groups being an amino acid side chain functional group. Further aspects of the invention relate to pharmaceutical compositions comprising said single chain insulin derivatives, and therapeutic uses thereof.
    Type: Grant
    Filed: December 4, 2014
    Date of Patent: February 5, 2019
    Assignee: CHEMICAL & BIOPHARMACEUTICALS LABORATORIES OF PATRAS S.A.
    Inventors: Kleomenis Barlos, Dimitrios Gatos, Kostas Barlos, Michail Ziovas
  • Patent number: 10190117
    Abstract: Disclosed are double-stranded antisense nucleic acid complexes that can efficiently alter the processing of RNA in a cell via an antisense effect, and methods for using the same. One method comprises contacting with the cell a double-stranded nucleic acid complex comprising: a first nucleic acid strand annealed to a second nucleic acid strand, wherein: the first nucleic acid strand comprises (i) nucleotides independently selected from natural DNA nucleotides, modified DNA nucleotides, and nucleotide analogs, (ii) no regions that have 4 or more consecutive natural DNA nucleotides, (iii) the total number of natural DNA nucleotides, modified DNA nucleotides, and nucleotide analogs in the first nucleic acid strand is from 8 to 100, and (iv) the first nucleic acid strand is capable of hybridizing to RNA inside of the cell; and the second nucleic acid strand comprises nucleotides independently selected from natural RNA nucleotides, modified RNA nucleotides, and nucleotide analogs.
    Type: Grant
    Filed: June 16, 2014
    Date of Patent: January 29, 2019
    Assignees: National University Corporation Tokyo Medical and Dental University, Osaka University
    Inventors: Takanori Yokota, Kazutaka Nishina, Kotaro Yoshioka, Satoshi Obika, Takenori Shimo
  • Patent number: 10184142
    Abstract: A biocatalytic process for producing active pharmaceutical ingredients (APIs) or intermediates thereof, wherein those APIs or their intermediates are nucleoside analogues (NAs) of formula I and wherein said NAs are active as pharmaceutically relevant antivirals and anticancer medicaments, intermediates or prodrugs thereof.
    Type: Grant
    Filed: April 29, 2014
    Date of Patent: January 22, 2019
    Assignee: Plasmia Biotech, S.L.
    Inventors: Marta Pascual Gilabert, Victor Manuel Deroncelé Thomas, Rafael Montilla Arévalo
  • Patent number: 10183060
    Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.
    Type: Grant
    Filed: September 30, 2016
    Date of Patent: January 22, 2019
    Assignee: HEAT BIOLOGICS, INC.
    Inventors: Taylor Schreiber, George Fromm, Suresh De Silva
  • Patent number: 10174304
    Abstract: Provided are: an expression vector for secreting a protein (Z) to be recovered or a fusion protein having the protein (Z) moiety therein; a method for producing a transformant using the expression vector; the transformant; and a method for producing a protein using the transformant. An expression vector comprising an expression cassette containing a structural gene sequence (y) encoding a protein (Y), a structural gene sequence (z) located downstream from the structural gene sequence (y) and encoding a protein (Z) that is a protein to be recovered, and a promoter sequence and a terminator sequence for expressing a fusion protein containing the protein (Y) moiety and the protein (Z) moiety, characterized in that the protein (Y) is a full-length protein of protein disulfide isomerase 1 (PDI1), a partial protein of PDI1, or a mutant protein of the full-length protein or the partial protein.
    Type: Grant
    Filed: July 22, 2014
    Date of Patent: January 8, 2019
    Assignee: AGC INC.
    Inventors: Tetsuya Kotani, Alimujiang Yidirei, Hideki Tohda
  • Patent number: 10174312
    Abstract: The present invention relates to a screening method for a drug target gene by using chemical-genetic profile compendium of the heterozygous deletion fission yeast strain and the comparative genetic analysis using the same. More precisely, the present inventors constructed the chemical-genetic profile compendium for drug candidates from the heterozygous deletion fission yeast strain of Schizosaccharomyces pombe (S. pombe), and then compared with the compendium with the chemical-genetic profile compendium of the budding yeast Saccharomyces cerevisiae (S. cerevisiae) in order to select efficiently drug target genes showing drug sensitivity. The screening method of the present invention can be efficiently used for the identification of a drug target gene in various eukaryotes because it facilitates the selection of a drug target gene showing sensitivity to the drug from the chemical-genetic profile compendium of the heterozygous deletion fission yeast strain.
    Type: Grant
    Filed: June 2, 2015
    Date of Patent: January 8, 2019
    Assignee: Korea Research Institute of Bioscience and Biotechnology
    Inventors: Dong-Uk Kim, Kwang-Lae Hoe
  • Patent number: 10174081
    Abstract: Materials and methods for making and using cationic anti-microbial peptides (CAMPs), and compositions containing such peptides.
    Type: Grant
    Filed: April 20, 2012
    Date of Patent: January 8, 2019
    Assignee: George Mason Research Foundation, Inc.
    Inventors: Barney Bishop, Monique van Hoek
  • Patent number: 10175183
    Abstract: An agent for searching for protein crystallization conditions, containing a water-swellable layered silicate having a fluorine atom and a hydroxyl group, wherein the fluorine atom is covalently bonded to the silicate by isomorphous substitution with the hydroxyl group. A method of searching for protein crystallization conditions, which comprises a step of mixing the agent for searching for protein crystallization conditions described above and a solution in which a protein is dissolved.
    Type: Grant
    Filed: March 29, 2012
    Date of Patent: January 8, 2019
    Assignees: KUNIMINE INDUSTRIES CO., LTD., TOKYO UNIVERSITY OF SCIENCE EDUCATIONAL FOUNDATION ADMINISTRATIVE ORGANIZATION
    Inventors: Keiichi Kurosaka, Munehiro Kubota, Kengo Sakaguchi, Keita Ino, Itsumi Udagawa, Kazuki Iwabata, Yoichi Takakusagi, Yasutaka Seki
  • Patent number: 10174101
    Abstract: The invention provides a fusion protein comprising, from N-terminus to C-terminus: a) a first portion of a Family B G-protein coupled receptor (GPCR) that comprises transmembrane helix (TM)-1, TM2 and TM3 of the GPCR; b) a stable protein domain; and c) a second portion of the GPCR comprising TM4, TM5, TM6 and TM7 of the GPCR. The invention also provides a method of crystallizing a GPCR comprising providing the fusion protein of the invention and crystallizing it to obtain crystals.
    Type: Grant
    Filed: August 9, 2012
    Date of Patent: January 8, 2019
    Assignee: Heptares Therapeutics Limited
    Inventors: Seyed Ali Jazayeri-Dezfuly, Fiona Hamilton Marshall
  • Patent number: 10174123
    Abstract: Disclosed is a method for searching, identifying, or validating a marker CACNA2D1 of tumor-initiating cells. The method comprises a step of immunizing an animal using HEP-12 cells originating from a recurrent tumor and rich in originating cells. Also disclosed is a monoclonal antibody specially recognizing CACNA2D1 or antigen-binding fragments thereof, and the use thereof for treating or preventing tumors or diseases or conditions related to CACNA2D1.
    Type: Grant
    Filed: February 22, 2012
    Date of Patent: January 8, 2019
    Assignee: Beijing Institute for Cancer Research
    Inventors: Zhiqian Zhang, Wei Zhao, Limin Wang, Haibo Han, Baocai Xing
  • Patent number: 10167490
    Abstract: The present disclosure relates to the production of ergothioneine through either in vitro enzymatic transformations or fermentations using microbials created by metabolic engineering. Also disclosed are transformed cells useful in such methods and ergothioneine produced by such methods. Transformed cells of the disclosure are capable of converting histidine and cysteine or hercynine and cysteine into ergothioneine in greater efficiency than the untransformed wild-type cells.
    Type: Grant
    Filed: December 20, 2013
    Date of Patent: January 1, 2019
    Assignee: Ergo Health LLC
    Inventors: Pinghua Liu, Heng Song, Wen Hu
  • Patent number: 10160996
    Abstract: The present invention provides a novel method that can analyze a target easily utilizing binding nucleic acid molecules and an analysis kit for use in the method. The analysis method of the present invention includes: a complex formation step of causing a binding nucleic acid molecule that binds to the target and a sample to come into contact with each other to form a complex of the binding nucleic acid molecule and the target in the sample; a nuclease treatment step of releasing a nucleic acid monomer from at least one of a complex fraction and a non-complex fraction by a nuclease treatment; an enzyme treatment step of reacting the released nucleic acid monomer with an enzyme for which the nucleic acid monomer is a substrate; a detection step of detecting the enzyme reaction; and an analysis step of analyzing the target that has formed the complex from the result of detecting the enzyme reaction.
    Type: Grant
    Filed: July 23, 2014
    Date of Patent: December 25, 2018
    Assignee: NEC Solution Innovators, Ltd.
    Inventors: Yoshihito Yoshida, Katsunori Horii, Iwao Waga
  • Patent number: 10160801
    Abstract: The present invention concerns chimeric or humanized antibodies or antigen-binding fragments thereof that comprise specific CDR sequences, disclosed herein. Preferably, the antibodies or fragments comprise specific heavy and light chain variable region sequences disclosed herein. More preferably, the antibodies or fragments also comprise specific constant region sequences, such as those associated with the nG1m1,2 or Km3 allotypes. The antibodies or fragments may bind to a human histone protein, such as H2B, H3 or H4. The antibodies or fragments are of use to treat a variety of diseases that may be associated with histones, such as autoimmune disease (e.g.
    Type: Grant
    Filed: June 27, 2018
    Date of Patent: December 25, 2018
    Assignee: Immunomedics, Inc.
    Inventors: Chien-Hsing Chang, Hans J. Hansen, David M. Goldenberg
  • Patent number: 10160789
    Abstract: Isolated polypeptides are provided that comprise a cholera toxin B subunit variant having one or more modifications to increase the expression of the polypeptide in a plant cell. Nucleic acids sequences, vectors, and plant cells for expressing the cholera toxin B subunit variant polypeptides are also provided. Further provided are methods for producing the cholera toxin B subunit variant polypeptides that include the steps of transforming a plant cell with a nucleic acid encoding the cholera toxin B subunit variant polypeptides; expressing the variant polypeptides; and purifying the polypeptides. Still further provided are methods of isolating the variant polypeptides that include the steps of obtaining a plant cell expressing the cholera toxin B subunit variant polypeptides; extracting the cholera toxin B subunit variant polypeptides from the plant cell; and purifying the cholera toxin B subunit variant polypeptides. Methods of eliciting an immune response are also provided.
    Type: Grant
    Filed: March 14, 2012
    Date of Patent: December 25, 2018
    Assignee: University of Louisville Research Foundation, Inc.
    Inventors: Nobuyuki Matoba, Krystal Hamorsky
  • Patent number: 10159730
    Abstract: Disclosed is a vaccine comprising fiber (2) protein of Fowl Adeno-virus C (FAdV-C) or an immunogenic fragment thereof for use in preventing hepatitis-hydropericardium Syndrome (HHS) in birds, preferably in poultry, especially in broilers.
    Type: Grant
    Filed: August 19, 2014
    Date of Patent: December 25, 2018
    Assignee: VETERINÄRMEDIZINISCHE UNIVERSITÄT WIEN
    Inventors: Michael Hess, Anna Schachner, Ana Marek, Barbara Jaskulska
  • Patent number: 10156559
    Abstract: Methods and systems for producing fusion proteins and peptides are disclosed. Fusion proteins and peptides created using the methods are also provided. Also provided are methods of using the fusion proteins and peptides produced according to the present disclosure.
    Type: Grant
    Filed: December 10, 2013
    Date of Patent: December 18, 2018
    Assignee: Fred Hutchinson Cancer Research Center
    Inventors: James Olson, Christopher Mehlin, Colin Correnti, Roland Strong
  • Patent number: 10154812
    Abstract: The present invention relates to a non-invasive system with diagnostic and treatment capacities that use a unified code that is intrinsic to physiological brain function. In an embodiment of the present invention, an approach to the treatment of disorders that supplements existing diagnostic and treatment methods with robust quantitative data analysis are presented. This is achieved by a unification of cognitive and neural phenomena known as the Fundamental Code Unit (FCU), representing identifiable patterns of brain activity at the submolecular, molecular, and cellular levels (intra-brain communications), as well as their manifestations in thought and language (inter-brain communications).
    Type: Grant
    Filed: July 25, 2016
    Date of Patent: December 18, 2018
    Inventor: Newton Howard
  • Patent number: 10156557
    Abstract: The invention provides calcium-binding photoproteins which can detect light emission with a higher sensitivity. The proteins of the invention comprising the amino acid sequence of SEQ ID NO: 2 can be used for the detection and measurement of calcium ions. The proteins of the invention are useful as reporter proteins, luminescent markers, etc. The polynucleotides of the invention are useful as reporter genes, etc.
    Type: Grant
    Filed: May 30, 2014
    Date of Patent: December 18, 2018
    Assignee: JNC CORPORATION
    Inventors: Satoshi Inouye, Yuiko Sahara
  • Patent number: 10155819
    Abstract: Methods are provided for the synthesis and secretion of recombinant hetero-multimeric proteins in mating competent yeast. A first expression vector is transformed into a first haploid cell; and a second expression vector is transformed into a second haploid cell. The transformed haploid cells, each individually synthesizing a non-identical polypeptide, are identified and then genetically crossed or fused. The resulting diploid strains are utilized to produce and secrete fully assembled and biologically functional hetero-multimeric protein.
    Type: Grant
    Filed: January 28, 2014
    Date of Patent: December 18, 2018
    Assignees: ALDERBIO HOLDINGS LLC, KECK GRADUATE INSTITUTE
    Inventors: James M Cregg, John Latham, Mark Litton, Randal Schatzman, Ilya Tolstrorukov
  • Patent number: 10143743
    Abstract: The present invention provides compositions and methods for the secretion and the translocation of a compound of interest by a bacterial minicell. In certain embodiments, the invention provides a bacterial minicell comprising at least one component of the type III secretion system (T3SS), which provides a safe and efficient system for secretion and translocation. In one embodiment, the invention allows for the delivery of an antigen to a cell or subject in order to induce an immune response.
    Type: Grant
    Filed: October 31, 2014
    Date of Patent: December 4, 2018
    Assignee: YALE UNIVERSITY
    Inventors: Jorge Galan, Heather Carleton
  • Patent number: 10131898
    Abstract: Amplification reaction mixtures comprising a cationic surfactant and an anionic surfactant are provided.
    Type: Grant
    Filed: July 21, 2015
    Date of Patent: November 20, 2018
    Assignee: Bio-Rad Laboratories, Inc.
    Inventor: Xiao-Song Gong
  • Patent number: 10113164
    Abstract: This disclosure relates to novel Pichia pastoris display systems, e.g., display systems featuring the Pichia pastoris strains (such as SuperMan5) with substantially homogeneous N-glycans displayed on cell surface proteins.
    Type: Grant
    Filed: December 16, 2014
    Date of Patent: October 30, 2018
    Assignee: Research Corporation Technologies, Inc.
    Inventors: Kurt R. Gehlsen, Thomas G. Chappell