Abstract: The present disclosure provides compositions, kits, genetically modified cells, non-human transgenic organisms, and methods for binding and/or cleaving a single stranded target nucleic acid. A method of cleaving includes contacting a single stranded target nucleic acid with (e.g., introducing into a cell) a subject argonaute (Ago) polypeptide and a guide RNA (e.g., having a 5?-OH). In some embodiments, a subject Ago polypeptide includes an amino acid sequence having 70% or more sequence identity with amino acids 282-430 and/or 431-639 of the Marinitoga piezophila argonaute (MpAgo) protein set forth in SEQ ID NO: 1. The present disclosure provides variant Ago polypeptides; and methods of use of same.

Abstract: The present invention relates to an antibody preparation comprising modified antibodies of an animal or derivatives or fragments thereof, specific for an antigen, characterized in that the antibodies or derivatives or fragments thereof comprise an N-glycan structure free of fucose and xylose, and at least 90%, preferably at least 95%, more preferred at least 99%, most preferred at least 100% of the modified antibodies, derivatives or fragments thereof lack a C-terminal lysine residue.

Abstract: The present technology relates to genetic products the expression of which is associated with cancer diseases. The present technology also relates to the therapy and diagnosis of diseases in which the genetic products are expressed or aberrantly expressed, in particular cancer diseases.

Abstract: PmxA synthetase involved in polymyxin E synthesis, comprising four adenylation sites, characterized in that the second adenylation site has at least 90% identity with the peptide sequence SEQ ID NO 1: VTEAEKADLLGRFNDTTTEFPRGKTLIQLFEEQVERIPDAAAITLNEQE LTYRELNERVNRLARTLRSHGISKGRLVAILAERSIEMVVGMLAAHKAG AAYVPIDPEYPEERIRFLIEDSGGQVMLTQSRLRERLAGSDPVILLDDE SFYHEDGTNLNTGIEATDLACVIYTSGTTGKPKGNPVSHRNIVRVVQNT NYIDITERDHVLQLSSYSFDGATFDIFGALTNGARLVLVPYETLLEIGR LADLIQRERISVMFITTAFFNILVDVNVDCLRDVRAILFGGERVSVGHV RKALAHIGPGRLNHVYGPTESTVYTTYLPVDFVDELAVTVPIGRPISNT TVYIVDSRNKLLPIGVAGELCVGGEGLVRGYNNRPELTAEKFVDNPFVP GERMYRTGDLAKWLPDGTIEYVGRTDDQVKIRGFRIELGEIEAQLQKVE GIRKTTVFARENASGEKQLCAYYEADCELPAAELKSVLSKELPAYMIPA YLIQLERLPLTTNGKVDRRSLPAPEESLQPGGG, the underlined amino acids DGFFLGVVYK being conserved and forming a binding pocket specific for a leucine, isoleucine or valine residue.

Abstract: The present disclosure provides nitroxyl donating pharmaceutical compositions comprising N-substituted hydroxylamine derivatives. The compositions are highly efficacious in treating cardiovascular diseases (e.g., heart failure), have a suitable toxicological profile, and are sufficiently stable for intravenous or oral administration.

Abstract: The invention relates to a method for increasing the yield of replication-incompetent adenoviruses having at least a partial deletion in the E1-region, wherein the adenoviruses are generated in a production cell by: (a) expressing an adenoviral pIX polypeptide from a nucleic acid sequence encoding adenoviral pIX polypeptide under the control of at least a minimal endogenous pIX promoter and a heterologous promoter; and (b) expressing the elements necessary for the production and assembly of the adenoviruses, thereby increasing the yield of adenoviruses generated in the production cell in comparison to the yield in the absence of nucleic acid sequence encoding the adenoviral pIX polypeptide. Further, the invention relates to a method for constructing an adenovirus library, a production cell, and the use of an adenoviral pIX polypeptide for increasing the yield of replication-incompetent adenoviruses having at least a partial deletion in the E1-region.

Abstract: The present invention relates to methods for the production of heat shock protein complexes for use in vaccine compositions. In particular, there is provided a method for increasing the level and immunogenicity of heat shock protein complexes produced in cells by subjecting the cells to specific stress inducing stimuli. The invention further extends to the use of heat shock protein complexes produced according to the methods of the invention in the preparation of vaccine compositions for the prevention and treatment of infectious diseases and cancerous conditions.

Abstract: A liposomal rehydration salt formulation comprising phosphatidylcholine liposomes, salts, water, and a percentage inclusion ratio of salts (salts retained within said liposomes/total salts) of at least 40%; and a process for preparing said formulation using tangential ultrafiltration.

Abstract: Single chain insulin analogs are provided having high potency and specificity for the insulin receptor. As disclosed herein optimally sized linking moieties can be used to link human insulin A and B chains, or analogs or derivatives thereof, wherein the carboxy terminus of the B25 amino acid of the B chain is linked to the amino terminus of the A1 amino acid of the A chain via the intervening linking moiety. In on embodiment the linking moiety comprises a polyethylene glycol of 6-16 monomer units and in an alternative embodiment the linking moiety comprises a non-native amino acid sequence derived form the IGF-1 C-peptide and comprising at least 8 amino acids and no more than 12 amino acid in length. Also disclosed are prodrug and conjugate derivatives of the single chain insulin analogs.

Abstract: Isolated polynucleotides and polypeptides, and recombinant DNA constructs useful for conferring improved nitrogen use efficiency and/or drought stress tolerance; compositions (such as plants or seeds) comprising these recombinant DNA constructs; and methods utilizing these recombinant DNA constructs are disclosed. The recombinant DNA constructs comprise a polynucleotide operably linked to a promoter that is functional in a plant, wherein said polynucleotides encode abiotic stress tolerance polypeptides.

Abstract: A method for forming a filter net on an MEMS sensor and an MEMS sensor are disclosed. The method comprises the following steps: disposing a dissociable adhesive tape on a base material, and forming a filter net on an adhesive surface of the dissociable adhesive tape; transferring the filter net on a film to form a self-adhesive coiled material; and transferring and adhering the filter net on the self-adhesive coiled material to collecting a hole of the MEMS sensor. The filter net formed by the method have fine and uniform meshes, and a yield is high. In addition, the method is suitable for large-scale and industrialized production.

Abstract: Disclosed is a vaccine comprising a fiber protein, selected from fiber-2 protein of Fowl Adenovirus C (FAdV-C), fiber-2 protein of Fowl Adenovirus A (FAdV-A), fiber protein of Fowl Adenovirus B, D and E (FAdV-B, FAdV-D and FAdV-E), or an immunogenic fragment thereof for use in preventing hepatitis-hydropericardium Syndrome (HHS) or inclusion body hepatitis (IBH) or Gizzard Erosion (GE) in birds, preferably in poultry, especially in broilers.

Abstract: The present disclosure provides a method of producing enzyme-specific inhibitors or substrate binding partners comprising: identifying active site residues of the substrate in the enzyme substrate complex or in substrate binding partner-substrate complex; randomizing the active site residues to produce a combinatorial library of substrate variants; and selecting substrate variants that inhibit enzyme activity or bind substrate as substrate-specific binding partners. The present disclosure also provides ubiquitin enzyme specific inhibitors and ubiquitin variants that bind ubiquitin interaction motifs.

Abstract: A multimeric immunoglobulin-binding protein having improved properties as an affinity ligand for affinity chromatography, and an insoluble support immobilizing such a multimer. The immunoglobulin-binding protein is represented by the formula: (R1)n-(R2)m, or (R2)m-(R1)n. R2 is an immunoglobulin-binding domain including an amino acid residue that covalently bonds to an insoluble support upon immobilization reaction with the insoluble support, and R1 is an immunoglobulin-binding domain without containing an amino acid residue the presence of which in the sequence compared to when it is absent in the sequence reduces the immunoglobulin-binding activity of the support yielded by the immobilization reaction. The immunoglobulin-binding protein satisfies: (1) n is an integer of 5 to 9; (2) m is an integer of 1 or 2; (3) the n (R1) domains may or may not have the same sequence; and (4) the total number of domains (n+m) is 6 to 10.

Abstract: IVIG replacement compounds are derived from recombinant and/or biochemical creation of immunologically active biomimetic(s). These replacement compounds are then screened in vitro to assess each replacement compound's efficiency at modulating immune function. Particular replacement compounds are selected for further in vivo validation and dosage/administration optimization. Finally, the replacement compounds are used to treat a wide range of diseases, including inflammatory and autoimmune diseases.

Abstract: The present invention intended to provide an artificial polyclonal immunoglobulin composition having a high therapeutic effect and high safety, and being capable of stable supply in a large amount. Specifically provided is an artificial polyclonal immunoglobulin composition containing, as active ingredients, 204 polypeptides represented by amino acid sequences set forth in SEQ ID NOS: 1 to 204 of the sequence listing, the polypeptides being plural kinds of single chain variable fragments (also referred to as ScFvs) each comprised of a heavy chain variable region, heavy chain constant region 1, and hinge region (VH-CH1-hinge) of an immunoglobulin, in which the heavy chain variable regions are different each other.

Abstract: The present invention relates to decoy peptide or polypeptide consisting of a peptide sequence represented by the following Formula I: X1-Ala-X2—X3-Ile-Glu-X4 (I). It is noteworthy that the decoy peptide or polypeptide of the present invention significantly elevates phosphorylation levels of PLB by inhibiting PP1-mediated dephosphorylation. In addition, the decoy peptide or polypeptide provides cardio-protective effects by restoring of SERCA2a activity and inotropic effect of enhancing myocardial contractility. The present invention will contribute greatly to the prevention or treatment of diseases associated with PLB.

Abstract: The present invention relates to the design and development of recombinant protein for the delivery of silencer RNA complex to mediate RNA interference since it represents a novel therapeutic approach to modulate several neurodegenerative disease-related genes across the blood-brain barrier (BBB). To overcome challenges due to this barrier for biologics and other biological complex, the present invention describes a method wherein peptide having sequence GGGGHLNILSTLWKYRC represented by SEQ ID NO. 9 known to target specific gangliosides was linked to a double-stranded RNA binding protein to bind and deliver silencer RNA to the brain parenchyma. The designed fusion protein comprising a double-stranded RNA-binding domain (dsRBD) of human Trans Activation response element (TAR) RNA Binding Protein (TARBP2) and a brain targeting peptide sequence that binds GM1. Conformation-specific binding of TARBP2 domain to silencer RNA results in the formation of homogenous serum-stable complex with GM1 targeting potential.

Abstract: The present invention relates to a saxatilin derivative having an increased half life and a use thereof. The saxatilin derivative of the present invention has thrombolytic ability similar to that of saxatilin, which is the mother protein, a remarkably increased protein half life, and efficiently dissolves, for long period of time, blood clots already formed in blood vessels of an animal model with a FeCl3-induced carotid by using the same. Therefore, a composition containing, as an active ingredient, the saxatilin derivative of the present invention does not cause reocclusion after penetration and effectively opens to microvessels, and is thus very useful for treating angiostenosis or occlusive diseases (for example, cerebrovascular diseases, cardiovascular diseases, arteriosclerotic vascular diseases, coronary artery diseases, and peripheral vascular diseases).

Abstract: Disclosed are a recombinant microorganism having enhanced L-amino acid producibility, wherein the recombinant microorganism is transformed to have an inactivated phage receptor thereof, and a method of producing an L-amino acid using the recombinant microorganism. The use of the recombinant microorganism may enable the production of the L-amino acid in a highly efficient manner.

Abstract: A first aspect of the invention relates to a single chain insulin analog comprising: (A) the A-chain of human or animal insulin, or an analog or derivative thereof; (B) the B-chain of human or animal insulin, or an analog or derivative thereof; (C) one or more disulfide bonds between said A-chain and said B-chain; and (D) a further covalent link, L, between a functional group of an amino acid in the A-chain and a functional group of an amino acid in the B-chain, at least one of said functional groups being an amino acid side chain functional group. Further aspects of the invention relate to pharmaceutical compositions comprising said single chain insulin derivatives, and therapeutic uses thereof.

Abstract: Disclosed are double-stranded antisense nucleic acid complexes that can efficiently alter the processing of RNA in a cell via an antisense effect, and methods for using the same. One method comprises contacting with the cell a double-stranded nucleic acid complex comprising: a first nucleic acid strand annealed to a second nucleic acid strand, wherein: the first nucleic acid strand comprises (i) nucleotides independently selected from natural DNA nucleotides, modified DNA nucleotides, and nucleotide analogs, (ii) no regions that have 4 or more consecutive natural DNA nucleotides, (iii) the total number of natural DNA nucleotides, modified DNA nucleotides, and nucleotide analogs in the first nucleic acid strand is from 8 to 100, and (iv) the first nucleic acid strand is capable of hybridizing to RNA inside of the cell; and the second nucleic acid strand comprises nucleotides independently selected from natural RNA nucleotides, modified RNA nucleotides, and nucleotide analogs.

Abstract: The present invention relates to, inter alia, compositions and methods, including chimeric proteins that find use in the treatment of disease, such as immunotherapies for cancer and autoimmunity. In part, the invention provides, in various embodiments, fusions of extracellular domains of transmembrane proteins that can have stimulatory or inhibitory effects.

Abstract: A biocatalytic process for producing active pharmaceutical ingredients (APIs) or intermediates thereof, wherein those APIs or their intermediates are nucleoside analogues (NAs) of formula I and wherein said NAs are active as pharmaceutically relevant antivirals and anticancer medicaments, intermediates or prodrugs thereof.

Abstract: An agent for searching for protein crystallization conditions, containing a water-swellable layered silicate having a fluorine atom and a hydroxyl group, wherein the fluorine atom is covalently bonded to the silicate by isomorphous substitution with the hydroxyl group. A method of searching for protein crystallization conditions, which comprises a step of mixing the agent for searching for protein crystallization conditions described above and a solution in which a protein is dissolved.

Abstract: Materials and methods for making and using cationic anti-microbial peptides (CAMPs), and compositions containing such peptides.

Abstract: Disclosed is a method for searching, identifying, or validating a marker CACNA2D1 of tumor-initiating cells. The method comprises a step of immunizing an animal using HEP-12 cells originating from a recurrent tumor and rich in originating cells. Also disclosed is a monoclonal antibody specially recognizing CACNA2D1 or antigen-binding fragments thereof, and the use thereof for treating or preventing tumors or diseases or conditions related to CACNA2D1.

Abstract: The invention provides a fusion protein comprising, from N-terminus to C-terminus: a) a first portion of a Family B G-protein coupled receptor (GPCR) that comprises transmembrane helix (TM)-1, TM2 and TM3 of the GPCR; b) a stable protein domain; and c) a second portion of the GPCR comprising TM4, TM5, TM6 and TM7 of the GPCR. The invention also provides a method of crystallizing a GPCR comprising providing the fusion protein of the invention and crystallizing it to obtain crystals.

Abstract: Provided are: an expression vector for secreting a protein (Z) to be recovered or a fusion protein having the protein (Z) moiety therein; a method for producing a transformant using the expression vector; the transformant; and a method for producing a protein using the transformant. An expression vector comprising an expression cassette containing a structural gene sequence (y) encoding a protein (Y), a structural gene sequence (z) located downstream from the structural gene sequence (y) and encoding a protein (Z) that is a protein to be recovered, and a promoter sequence and a terminator sequence for expressing a fusion protein containing the protein (Y) moiety and the protein (Z) moiety, characterized in that the protein (Y) is a full-length protein of protein disulfide isomerase 1 (PDI1), a partial protein of PDI1, or a mutant protein of the full-length protein or the partial protein.

Abstract: The present invention relates to a screening method for a drug target gene by using chemical-genetic profile compendium of the heterozygous deletion fission yeast strain and the comparative genetic analysis using the same. More precisely, the present inventors constructed the chemical-genetic profile compendium for drug candidates from the heterozygous deletion fission yeast strain of Schizosaccharomyces pombe (S. pombe), and then compared with the compendium with the chemical-genetic profile compendium of the budding yeast Saccharomyces cerevisiae (S. cerevisiae) in order to select efficiently drug target genes showing drug sensitivity. The screening method of the present invention can be efficiently used for the identification of a drug target gene in various eukaryotes because it facilitates the selection of a drug target gene showing sensitivity to the drug from the chemical-genetic profile compendium of the heterozygous deletion fission yeast strain.

Abstract: The present disclosure relates to the production of ergothioneine through either in vitro enzymatic transformations or fermentations using microbials created by metabolic engineering. Also disclosed are transformed cells useful in such methods and ergothioneine produced by such methods. Transformed cells of the disclosure are capable of converting histidine and cysteine or hercynine and cysteine into ergothioneine in greater efficiency than the untransformed wild-type cells.

Abstract: Isolated polypeptides are provided that comprise a cholera toxin B subunit variant having one or more modifications to increase the expression of the polypeptide in a plant cell. Nucleic acids sequences, vectors, and plant cells for expressing the cholera toxin B subunit variant polypeptides are also provided. Further provided are methods for producing the cholera toxin B subunit variant polypeptides that include the steps of transforming a plant cell with a nucleic acid encoding the cholera toxin B subunit variant polypeptides; expressing the variant polypeptides; and purifying the polypeptides. Still further provided are methods of isolating the variant polypeptides that include the steps of obtaining a plant cell expressing the cholera toxin B subunit variant polypeptides; extracting the cholera toxin B subunit variant polypeptides from the plant cell; and purifying the cholera toxin B subunit variant polypeptides. Methods of eliciting an immune response are also provided.

Abstract: The present invention concerns chimeric or humanized antibodies or antigen-binding fragments thereof that comprise specific CDR sequences, disclosed herein. Preferably, the antibodies or fragments comprise specific heavy and light chain variable region sequences disclosed herein. More preferably, the antibodies or fragments also comprise specific constant region sequences, such as those associated with the nG1m1,2 or Km3 allotypes. The antibodies or fragments may bind to a human histone protein, such as H2B, H3 or H4. The antibodies or fragments are of use to treat a variety of diseases that may be associated with histones, such as autoimmune disease (e.g.

Abstract: Disclosed is a vaccine comprising fiber (2) protein of Fowl Adeno-virus C (FAdV-C) or an immunogenic fragment thereof for use in preventing hepatitis-hydropericardium Syndrome (HHS) in birds, preferably in poultry, especially in broilers.

Abstract: The present invention provides a novel method that can analyze a target easily utilizing binding nucleic acid molecules and an analysis kit for use in the method. The analysis method of the present invention includes: a complex formation step of causing a binding nucleic acid molecule that binds to the target and a sample to come into contact with each other to form a complex of the binding nucleic acid molecule and the target in the sample; a nuclease treatment step of releasing a nucleic acid monomer from at least one of a complex fraction and a non-complex fraction by a nuclease treatment; an enzyme treatment step of reacting the released nucleic acid monomer with an enzyme for which the nucleic acid monomer is a substrate; a detection step of detecting the enzyme reaction; and an analysis step of analyzing the target that has formed the complex from the result of detecting the enzyme reaction.

Abstract: Methods are provided for the synthesis and secretion of recombinant hetero-multimeric proteins in mating competent yeast. A first expression vector is transformed into a first haploid cell; and a second expression vector is transformed into a second haploid cell. The transformed haploid cells, each individually synthesizing a non-identical polypeptide, are identified and then genetically crossed or fused. The resulting diploid strains are utilized to produce and secrete fully assembled and biologically functional hetero-multimeric protein.

Abstract: Methods and systems for producing fusion proteins and peptides are disclosed. Fusion proteins and peptides created using the methods are also provided. Also provided are methods of using the fusion proteins and peptides produced according to the present disclosure.

Abstract: The invention provides calcium-binding photoproteins which can detect light emission with a higher sensitivity. The proteins of the invention comprising the amino acid sequence of SEQ ID NO: 2 can be used for the detection and measurement of calcium ions. The proteins of the invention are useful as reporter proteins, luminescent markers, etc. The polynucleotides of the invention are useful as reporter genes, etc.

Abstract: The present invention relates to a non-invasive system with diagnostic and treatment capacities that use a unified code that is intrinsic to physiological brain function. In an embodiment of the present invention, an approach to the treatment of disorders that supplements existing diagnostic and treatment methods with robust quantitative data analysis are presented. This is achieved by a unification of cognitive and neural phenomena known as the Fundamental Code Unit (FCU), representing identifiable patterns of brain activity at the submolecular, molecular, and cellular levels (intra-brain communications), as well as their manifestations in thought and language (inter-brain communications).

Abstract: The present invention provides compositions and methods for the secretion and the translocation of a compound of interest by a bacterial minicell. In certain embodiments, the invention provides a bacterial minicell comprising at least one component of the type III secretion system (T3SS), which provides a safe and efficient system for secretion and translocation. In one embodiment, the invention allows for the delivery of an antigen to a cell or subject in order to induce an immune response.

Abstract: Amplification reaction mixtures comprising a cationic surfactant and an anionic surfactant are provided.

Abstract: This disclosure relates to novel Pichia pastoris display systems, e.g., display systems featuring the Pichia pastoris strains (such as SuperMan5) with substantially homogeneous N-glycans displayed on cell surface proteins.

Abstract: The present invention comprises a composition with means to inhibit the function of the inflammatory cytokine IL-1 and methods for using this composition to treat inflammatory disease of ocular and adnexal tissues by topical administration. The present invention also discloses devices for delivering this composition to target tissues.

Abstract: The present invention relates to the protein THSD7A (Thrombospondin, Type I, Domain Containing 7A) as a biomarker autoantigen in membranous nephropathy, particularly idiopathic membranous nephropathy. The invention provides diagnostic, prognostic and monitoring methods for membranous nephropathy in a patient based on the detection of autoantibodies recognizing the THSD7A protein (anti-THSD7A autoantibodies) and associated kits. The invention also provides diagnostic methods and kits based on the detection of the THSD7A level. The invention further provides therapeutic methods for membranous nephropathy.

Abstract: The present disclosure relates generally to anti-C10orf54 antibodies, including antibody-drug conjugates comprising the antibodies, and methods of their use.

Abstract: The present invention provides CRZ1 mutant fungal host cells, such as Pichia pastoris. The mutant fungal host cells exhibit temperature-resistance, enhanced fermentation robustness and increased expression of heterologous polypeptides such as immunoglobulins. Methods for producing heterologous polypeptides, such as immunoglobulins, using such mutant fungal host cells are within the scope of the present invention.

Abstract: The present invention includes compositions, methods and kits for the real-time detection of transcription and translation in live cells, tissues and organisms. The present invention further provides method for the rapid sequencing of nucleic acids without using conventional sequencing techniques or reactions.

Abstract: As microbial drug-resistance increases, there is a critical need for new classes of compounds to combat infectious diseases. The Ixodes scapularis tick antifreeze glycoprotein, IAFGP, functions as an anti-infective agent against diverse bacteria including methicillin-resistant Staphylococcus aureus. Recombinant IAFGP and a peptide, PI, described herein and derived from this protein, bind to microbes and alter biofilm formation. Transgenic iafgp-expressing flies and mice challenged with bacteria, as well as wild-type animals administered IAFGP or PI, were resistant to infection, septic shock, or biofilm development on implanted biomaterials. Antifreeze protein controls bacterial infection and present new therapeutic strategies to counter pathogens.

Abstract: The invention relates to the field of pharmaceutical compositions. More particularly it is directed to substance delivery system (or implant), such as scaffolds and membranes, comprising an anabolic drug, such as a Fibroblast Growth Factor 18 (FGF-18) compound, to methods of producing such delivery system, as well as use thereof. The implants according to the invention are for use for the treatment of cartilage disorders, such as osteoarthritis, cartilage injury or osteochondral defects.

Abstract: The invention describes factor VIII molecules with reduced capacity to elicit activation of NKT cells for use in the treatment of congenital and/or acquired haemophilia A and in bleeding disorders. Said factor VIII molecule is obtainable by: a. identification of at least one NKT cell epitope wherein said epitope comprises hydrophobic aminoacid residues in position P1 and/or P7 b. modification of said epitope(s) by eliminating at least one hydrophobic aminoacid residue in position P1 and/or P7, substituting at least one hydrophobic aminoacid residue in position P1 and/or P7 with a non-hydrophobic residue, or adding a non-hydrophobic residue in position P1 and/or P7.