Abstract: This application provides a metallopeptide catalyst comprising dirhodium bound to one or more carboxylate residues of a peptide, protein or peptidomimetic. These stable metallopeptides can achieve structure-selective protein modification though molecular recognition.

Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide has one or more sequences having at least 60% homology with any of SEQ ID 1-6, or has two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ ID 1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ ID 2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ ID 3 DLIFLARSALILRGSVAHKSC SEQ ID 4 PGIADIEDLTLLARSMVVVRP SEQ ID 5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ ID 6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.

Abstract: Peptides have been identified that bind to tooth enamel. Compositions and methods comprising peptide-based oral care reagents having at least one tooth enamel-binding peptide and an oral care benefit agent are provided to adhere the benefit agent to the oral surface.

Abstract: The present invention relates to a method for treating a cardiovascular disease, for increasing the number of circulating angiogenic cells (CAC) and/or improving the function of CAC and a method for improving vascular remodeling and/or neovascularisation. The method comprises administering to the subject a therapeutically effective amount of unacylated ghrelin or a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1 or a fragment or analog thereof having the biological activity of SEQ ID NO: 1; and to pharmaceutical compositions comprising unacylated ghrelin or a polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 1 or a fragment or analog thereof having the biological activity of SEQ ID NO: 1.

Abstract: An objective of the present invention is to provide an antifreeze protein which is capable of being efficiently produced on an industrial level at low cost and which is safe and has an excellent antifreezing activity for use on a practical level. Also, an objective of the present invention is to provide a polypeptide that corresponds to the active part of the antifreeze protein; a composition, a food, a biological sample protectant and a cosmetic containing the antifreeze protein or the polypeptide; and an antibody that specifically reacts with the antifreeze protein or the polypeptide. The antifreeze protein according to the present invention is characterized in being derived from a plant and having a specific amino acid sequence or being a plant seed protein.

Abstract: The present invention provides a screening method for identifying a peptide capable of inducing a T cell response comprising: a) contacting a peptide having a level of identity with a sequence of a protein of a virus, with a test sample comprising T cells obtained from blood from a subject who is currently or has been recently infected with the virus, b) quantifying the response of the T cells to the peptide, c) comparing the T cells' response in b) to a response of a control sample comprising T cells obtained from blood from a subject who is not currently infected nor been recently infected with the virus, when contacted with the peptide, wherein a greater response to the peptide in b) than in c) is indicative of a peptide capable of inducing a T cell response.

Abstract: This invention relates to bispecific antibodies having combinations of linker and hinge sequences to create linker-hinge interface domains with biological significance. Such linker-hinge interface domains covalently join two molecules, maintain the biological activities of linked molecules (target binding), stabilize the biological characteristics of new molecule (solubility and 4° C. stability), maintain the chemical, biochemical and physical properties (cytotoxicity) of the linked molecules, and modulate the biological characteristics of the linked molecules (activating T-lymphocytes without significant sign of proliferations). Both linker (GGGGS) and hinge (CPPCP) sequences are required to establish functional linker-hinge interface domains as deletion of any of the component resulted in significant lost of T-lymphocyte mediated activity.

Abstract: Coccidioidomycosis (Valley Fever) is currently diagnosed by relying on infected individuals (humans, dogs, etc.) to generate antibodies against the fungus. Since the immune response against Valley Fever can be delayed or absent in many cases, methods that detect a polypeptide or peptide component of the Coccidioides sp. fungus in a bodily fluid such as blood are provided.

Abstract: The invention relates to a synthetic bifunctional non-antibody compound comprising one or more effector moieties and one or more binder moieties, wherein the effector moieties are operably linked to the binder moieties via a linker, the effector moieties are ligands to at least one pathogen pattern recognition receptor (PRR) and the binder moieties bind to a marker of a tumor cell.

Abstract: The invention relates to composition comprising a pharmaceutically effective amount of one or more functional vasoactive intestinal peptide (VIP) fragments, and the use of those compositions in the treatment of fibrosis, hypertension and other disorders.

Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of the antibodies.

Abstract: The present invention relates to peptides or fragments thereof, which peptides bind to mesenchymal stem cells. The present invention also relates to a method for identifying, isolating, specifically selecting and/or enriching mesenchymal stem cells, wherein the peptides, or fragments thereof, are employed for specifically binding to the mesenchymal stem cells. Also, the present invention relates to the use of the peptides of the invention, or fragments thereof, and of the mesenchymal stem cells isolated with the peptides of the invention, or fragments thereof, for treating, injuries and/or degenerated bone, cartilage or tissues.

Abstract: Disclosed are peptides that bind to Ang-2. Also disclosed are peptibodies comprising the peptides, methods of making such peptides and peptibodies, and methods of treatment using such peptides and peptibodies.

Abstract: The invention relates to conjugates that bind to Her2/neu, methods of using conjugates that bind to Her2/neu and methods of treating undesirable or aberrant cell proliferation or hyperproliferative disorders, such as tumors, cancers, neoplasia and malignancies that express Her2/neu.

Abstract: The present invention relates to new peptides, pharmaceutical composition and cosmetic composition comprising them and their use for wound healing.

Abstract: The application provides data from a clinical trial of a PSD-95 inhibitor in subjects undergoing endovascular repair of an aneurysm in or otherwise affecting the CNS. The subjects were stratified by whether the aneurysm ruptured before performing the endovascular surgery. Rupture is associated with higher mortality or increased debilitation if a subject survives. The trial provided evidence of significant benefit in subjects with and without aneurysm rupture before endovascular was surgery performed. Surprisingly, the subjects benefiting most from treatment as judged both by pathology and neurocognitive outcome were those in which the aneurysm had ruptured causing a subarachnoid hemorrhage. These data constitute evidence that a PSD-95 inhibitor is beneficial not only in ischemic and hemorrhagic stroke but in forms of hemorrhage in or affecting the CNS, particularly, subarachnoid hemorrhage.

Abstract: The invention provides polypeptides comprising an amino acid sequence comprising at least one variation from wild-type HCV NS5B polymerase, the at least one variation selected from the group consisting of cysteine, isoleucine, valine, or proline at amino acid position 419; alanine, valine, or asparagine at amino acid position 482; valine, isoleucine, threonine, or serine at amino acid position 486; and isoleucine at amino acid position 494, as the amino acid positions are defined in SEQ ID NO: 1, and having Hepatitis C Virus (HCV) NS5B polymerase activity. Polynucleotides encoding the polypeptide, antibodies, host cells, compositions, and methods for detecting an HCV NS5B polymerase having resistance to a polymerase inhibitor also are provided.

Abstract: The present invention relates to nociceptin peptide mimetics that have ?-helical structures and bind to and modulate the opioid receptor-like-1 (ORL-1) receptor. The peptide mimetics are constrained cyclic nociceptin analogues which have either agonist or antagonist activity. Pharmaceutical compositions comprising the nociceptin peptide mimetics and methods of treating or preventing a disease or condition ameliorated by modulating the ORL-1 receptor are also described.

Abstract: A method including advancing a delivery device through a lumen of a blood vessel to a particular region in the blood vessel; and introducing a synthetic apolipoprotein A-1 (Apo A-I) mimetic peptide into a wall of the blood vessel at the particular region, wherein the peptide has a property that renders the peptide effective in reverse cholesterol transport. A composition including a synthetic apolipoprotein A-I (Apo A-I) mimetic peptide, or combination of an Apo A-I synthetic peptide and an Acyl CoA cholesterol: acyltransferase (ACAT) inhibitor in a form suitable for delivery into a blood vessel, the peptide including an amino acid sequence in an order reverse to an order of an endogenous Apo A-I related peptide. A composition including an apolipoprotein A-1 (Apo A-I) synthetic peptide in a form suitable for delivery into a blood vessel, the peptide including an amino acid backbone that has less amino acid residues relative to endogenous Apo A-I and a chimera of helix 1 and helix 9 of Apo A-I.

Abstract: The present invention relates to diagnostic imaging and in particular to the diagnostic imaging of fibrosis. More particularly, the present invention provides a polypeptides, cyclic polypeptides and pharmaceutical compositions suitable for the non-invasive visualization of fibrosis. The polypeptide of the invention may comprise an amino acid sequence consisting of: X1-X2-M-H-G-L-X7-L-X9-X10-D-E (SEQ ID NO: 1) wherein amino acid X1 is R, F or P; amino acid X2 is F or V; amino acid X7 is Q, H or L; amino acid X9 is W or G and amino acid X10 is A or D.

Abstract: The present invention provides anti-Plasmodium immunogenic compositions comprising EVP1 (PFD0495c) or an antigenic portion thereof, as well as methods of immunizing against malaria employing these compositions. In other embodiments, the present invention provides methods of identifying Plasmodium infection employing agents that bind to EVP1 or an antibody generated thereto.

Abstract: The present disclosure relates to protein and peptide chemistry. More particularly, it relates to compounds, compositions and uses thereof for promoting and inhibiting angiogenesis. The peptides of the present disclosure include peptides comprising SEQ ID NOs: 1-4 which promote angiogenesis and cell proliferation. Further, the anti-angiogenic compounds of the present disclosure include antisense oligonucleotides that hybridize or are complementary to the polynucleotides of SEQ ID NOs: 5-16, and the like.

Abstract: The invention provides peptides that bind Tissue Factor Pathway Inhibitor (TFPI), including TFPI-inhibitory peptides, and compositions thereof. The peptides may be used to inhibit a TFPI, enhance thrombin formation in a clotting factor-deficient subject, increase blood clot formation in a subject, and/or treat a blood coagulation disorder in a subject.

Abstract: The invention describes peptide analogues of a-melanocyte-stimulating hormone (a-MSH), which posses an increased efficacy compared to the native ?-MSH peptide. The ?-MSH analogues exhibit increased anti-inflammatory effects and increased capability to prevent ischemic conditions compared to ?-MSH. The invention further discloses use of the peptides for the manufacture of pharmaceutical compositions for the treatment or prophylaxis of a condition in the tissue of one or more organs of a mammal, and moreover pharmaceutical compositions.

Abstract: The invention provides methods for identifying a HLA-B*0702-restricted cryptic epitope in an antigen, as well as methods for increasing the immunogenicity of HLA-B*0702-restricted cryptic epitopes. The HLA-B*0702-restricted cryptic epitopes and their cognate immunogenic epitopes are useful for stimulating an immune reaction against the cryptic epitopes in a subject. Accordingly, the invention further provides pharmaceutical compositions comprising a HLA-B*0702-restricted cryptic epitope or a cognate immunogenic epitope thereof, and vaccination kits comprising such epitopes. The novel materials of the invention are particularly useful for efficiently treating patients having an HLA-B*0702 phenotype.

Abstract: The invention relates to a peptide of 8-50 amino acids comprising the sequence of KAHKKRAD or KARKKHAD, or a cyclic peptide of 8-50 amino acids comprising the sequence of HKKR or RKKH. Also disclosed are methods of using the peptide for detecting, monitoring, or treating cancer.

Abstract: AV?6 peptide ligands, functional variants thereof and their nucleic acids encoding them are disclosed with their uses in the treatment and imaging of AV?6 mediated diseases.

Abstract: A method for regulating Src and its downstream signaling pathway which includes binding between Src and Na+/K+-ATPase is disclosed. The Na+/K+-ATPase/Src complex is a functional receptor for cardiotonic steroids such as ouabain. Also disclosed are Src inhibitors or activators which include either Na+/K+-ATPase or Src that interfere with the interaction between the Na/K-ATPase and Src, act via a different mechanism from ATP analogues, and is pathway (Na+/K+-ATPase) specific.

Abstract: The present invention concerns polypeptides derived from a tandem repeat of apoE141-149 and their uses as medicaments. The peptides may comprise the tandem repeat, and truncations thereof, for which at least one Leucine (L) is replaced by an amino acid with a side chain comprising at least 4 carbon atoms and at least one Nitrogen atom. Such peptides are useful for preventing or treating viral infections.

Abstract: Disclosed herein are polypeptides or their derivatives and their application. The polypeptides and their derivatives can treat or prevent cancer. The polypeptides of the invention have significant lethality to the cancer cells when used alone. When its clinical commonly used chemotherapy drugs such as cisplatin in combination, it can significantly increase the sensitivity of chemotherapeutic agents on cancer cells, to enhance its lethality of cancer cells, to reduce the dosage. The peptides can kill a variety of cancer cells, but without apparent toxicity enhancing effect on normal cells. The prepared peptides of the present invention can be chemically synthesized, high-purity, low molecular weight, specificity, non-immunogenic, safe and reliable.

Abstract: The present invention relates to parstatin peptides, compositions comprising parstatin peptides and their use in the treatment of various disorders, including angiogenesis-related diseases, ocular neovascularisation and related disease states, ischemia-reperfusion injury and myocardial-related disease states, and renal disorders.

Abstract: The present invention provides modified cycloalkyne compounds; and method of use of such compounds in modifying biomolecules. The present invention features a cycloaddition reaction that can be carried out under physiological conditions. In general, the invention involves reacting a modified cycloalkyne with an azide moiety on a target biomolecule, generating a covalently modified biomolecule. The selectivity of the reaction and its compatibility with aqueous environments provide for its application in vivo (e.g., on the cell surface or intracellularly) and in vitro (e.g., synthesis of peptides and other polymers, production of modified (e.g., labeled) amino acids).

Abstract: The present invention provides compositions for treating neurodegenerative diseases, including ALS, involving complex formation of cytosolic malate dehydrogenase with certain neurodegenerative disease-causing proteins, comprising an agent capable of reducing an interaction between a malate dehydrogenase protein and a conformationally altered or mutant protein associated with a neurodegenerative disorder, including mutant SOD1 protein. The present invention also provides methods of identifying an agent capable of treating such disorders, including ALS, comprising testing agents for the ability to disrupt or prevent formation of a malate dehydrogenase complex with a conformationally altered or mutant protein associated with a neurodegenerative disorder, including MDH-mutant-SOD1 complex, and methods of treating neurodegenerative disorders.

Abstract: The invention provides methods and compositions for modulating the HGF/c-met signaling pathway, in particular by regulating binding of HGF ? chain to c-met.

Abstract: The present invention relates generally to tissue differentiation factor (TDF) analogs. More specifically, the invention relates to structure-based methods and compositions useful in designing, identifying, and producing molecules which act as functional modulators of TDF-like receptors. The invention further relates to methods of detecting, preventing, and treating TDF-associated disorders.

Abstract: The present invention features methods and compositions (e.g., immune response stimulating peptides (e.g., ERG or SIM2 peptides), activated immune cells, antigen-presenting cells, and antibodies or antigen-binding fragments thereof) for generating an immune response for the treatment of cancer (e.g., prostate cancer).

Abstract: The invention provides a modified therapeutic agent, said modified agent comprising three or more membrane binding elements with low membrane affinity covalently associated with the agent which elements are capable of interacting independently and with thermodynamic additivity, with components of cellular or artificial membranes exposed to extracellular fluids wherein at least two membrane binding elements are lipophilic elements, which may be aliphatic acyl groups, which may be selected from the list consisting of Myristoyl, Decanoyl or Hexanoyl.

Abstract: The ?c-family cytokines, Interleukin-2 (IL-2), Interleukin-4 (IL-4), Interleukin-7 (IL-7), Interleukin-9 (IL-9), Interleukin-15 (IL-15), and Interleukin-21 (IL-21), are associated with important human diseases, such as leukemia, autoimmune diseases, collagen diseases, diabetes mellitus, skin diseases, degenerative neuronal diseases and graft-versus-host disease (GvHD). Thus, inhibitors of ?c-cytokine activity are valuable therapeutic and cosmetic agents as well as research tools. The present embodiments relate to the design of peptide antagonists based on the consensus ?c-subunit binding site to inhibit ?c-cytokine activity. In several embodiments, peptide antagonists exhibit Simul-Block activity, inhibiting the activity of multiple ?c-cytokine family members.

Abstract: Newly identified proteins as markers for the detection of breast, colon, lung and ovary tumors, or as therapeutic targets for their treatment, affinity ligands capable of selectively interacting with the newly identified markers and methods for tumor diagnosis and therapy using such ligands.

Abstract: Provided are a newly identified colon cancer marker and a diagnostic kit using the same. More particularly, the present invention relates to an identified colon cancer specific marker, a composition and a kit including agents determining presence of the marker, and a method of diagnosing colon cancer using the same. The diagnostic marker according to the present invention capable of detecting metastasis and prognosis of colon cancer may provide useful information for the treatment and management of colon cancer and be used for the development of colon cancer-specific anticancer agents.

Abstract: Peptides for the treatment of inflammation, and therapeutic uses and methods of using the same are disclosed. Peptides including a transducing sequence are effective for inhibiting cytokine activity and TNF-? secretion through interaction with toll-like receptors. Experiments are described illustrating the efficacy of the compounds in treating otitis media.

Abstract: Disclosed herein are novel peptide amphiphile molecules and compositions composed of a peptide sequence that non-covalently binds the growth factor TGF-?1. Also disclosed are methods of using these peptide amphiphiles to create a gel scaffold in situ that enhances articular cartilage regeneration when used in combination with microfracture. Significant improvement in tissue quality and overall O'Driscoll histological scores were observed in rabbits with full thickness articular cartilage defects treated with the TGF-binding peptide amphiphile. The gel can further serve as a delivery vehicle for recombinant TGF-?1 protein growth factor. Scaffolds that localize and retain chondrogenic growth factors may synergistically enhance cartilage repair when combined with microfracture, by inducing bone marrow mesenchymal stem cells into chondrogenic differentiation. This invention represents a promising new biomimetic approach to enhance current techniques of articular cartilage regeneration in the clinical setting.

Abstract: A collagen peptide with immune-enhancing activity from Cyanea nozakii, and a preparation method thereof are provided. The collagen peptide contains 80-90 wt % of proteins and 10-20 wt % of sugars, and has an average molecular weight of 1,000-3,000 Dalton. Monosaccharide contained in the collagen peptide are mainly glucose, glycine accounts for 16% or above and the sum of proline and hydroxyproline accounts for 18% or above of amino acids contained therein. The collagen peptide is capable of being used for preparation of medicines, health products, and skincare cosmetics having immune-enhancing function.

Abstract: Fusion proteins containing active agonist or antagonist fragments of parathyroid hormone (PTH) and parathyroid hormone related peptide (PTHrP) coupled to a collagen-binding domain are presented. The fusion proteins can be used to promote bone growth, to promote hair growth, to prevent cancer metastasis to bone, to promote immune reconstitution with a bone marrow stem cell transplant, to promote mobilization of bone marrow stem cells for collection for autologous stem cell transplant, and to treat renal osteodystrophy. Pharmaceutical agents comprising a collagen-binding polypeptide segment linked to a non-peptidyl PTH/PTHrP receptor agonist or antagonist are also presented.

Abstract: The present invention relates to a antimicrobial peptide or peptide derivative comprising the following sequence: Sub1-X1-D2-K3—P4—P5—Y6-L7-P8—R9—P10X2—P12—P13—R14—X3-T16-P17—N18—N19-X4-Sub2. The invention further relates to multimers comprising said peptides or peptide derivatives. Moreover, the invention provides a peptide or peptide derivative for use in the treatment of a disease. The peptide or peptide derivative may also be used in the screening for novel antimicrobial compounds.

Abstract: Use of antibodies against PLAC1 protein as biomarkers of infertility, diagnostic kit for the detection of immune response against PLAC1 and use of PLAC1 protein in therapeutic and contraceptive fields The present invention concerns the use of antibodies against PLAC1 protein as biomarkers of infertility, diagnostic kit for the detection of immune response against PLAC1 and use of PLAC1 protein in tolerogenic or immunogenic form in the therapy for infertility or as contraceptive or post-coital interception means, respectively.

Abstract: A conserved region of sequence in bacterial microcompartment (BMC) enzymes and proteins was identified. Peptide sequences derived from this conserved region of native BMC proteins and enzymes appear to target the hexameric facets of BMC shell proteins. These peptides were predicted to share general properties of a predicted alpha helical conformation, flanked by poorly conserved segment(s) of primary structure); for each type of encapsulated protein, and for each functionally distinct BMC. These peptides can be used as targeting signals for integrating biomolecules and molecules into bacterial microcompartments or for attaching molecules or biomolecules to native or non-native bacterial microcompartment shell proteins.

Abstract: A polypeptide comprising the sequence of SEQ. ID NO. 2, 3, 4, 7 or 8. The polypeptide may have the sequence of an immunogenic fragment thereof comprising at least eight amino acids, wherein the immunogenic fragment is not one of SEQ. ID NOS. 6 or 11 to 16. The polypeptide may have a sequence having at least 80% sequence identity to the aforementioned polypeptide or immunogenic fragment. The polypeptide is less than 100 amino acids in length and does not comprise the sequence of any of SEQ. ID NOS. 10, 46, 56, 57 or 59 to 62 and does not consist of the sequence of SEQ ID NO. 58. The polypeptide is useful in the treatment or prophylaxis of cancer.

Abstract: The present invention relates to monomeric and multimeric peptidic compounds which have antiviral activity, particularly against integrin-using viruses, more particularly against rotavirus. Further, the present invention refers to compositions comprising said peptidic compounds for medical use or for use as food additives.

Abstract: The present invention describes a method to inhibit replication of the human immunodeficiency virus (HIV) by negatively modulating or altering the cytoskeleton, more precisely the proteins forming the intermediate cytoskeletal filaments, wherein the said proteins are vimentin and/or keratin-10. The replication of the virus is inhibited in human cells by intervening in the structure of these proteins. The present invention is also related to the use of agents, which comprise peptides and/or interfering RNA and/or lipidic compounds, said agents producing a negative modulation or alteration of the cytoskeleton to prevent or to treat the HIV infection. The invention provides means and methods for altering the cytoskeleton/filament structure of cells, as a result of which the infection of human cells by HIV is disturbed and can even be completely inhibited. The cytoskeleton is altered by reducing the amount of vimentin and/or keratin (e.g.