15 To 23 Amino Acid Residues In Defined Sequence Patents (Class 530/326)
-
Publication number: 20130130233Abstract: The present invention relates to novel monoclonal antibodies which may be used in the detection of Human Immunodeficiency Virus (HIV). These antibodies exhibit an unusually high degree of sensitivity, a remarkably broad range of specificity, and bind to novel shared, non-cross-reactive epitopes. In particular, the monoclonal antibodies of the present invention may be utilized to detect HIV-1 antigen and HIV-2 core antigen in a patient sample.Type: ApplicationFiled: October 9, 2012Publication date: May 23, 2013Applicant: ABBOTT LABORATORIESInventor: Abbott Laboratories
-
Publication number: 20130129740Abstract: The invention provides proteins from group B streptococcus (Streptococcus agalactiae) and group A streptococcus (Streptococcus pyogenes), including amino acid sequences and the corresponding nucleotide sequences. Data are given to show that the proteins are useful antigens for vaccines, immunogenic compositions, and/or diagnostics. The proteins are also targets for antibiotics.Type: ApplicationFiled: August 30, 2012Publication date: May 23, 2013Applicants: J. Craig Venter Institute, Novartis Vaccines and Diagnostics, Inc.Inventors: John Telford, Vega Masignani, Maria Scarselli, Guido Grandi, Hervé Tettelin, Claire Fraser
-
Publication number: 20130130268Abstract: The present invention refers to peptides comprised in the extracellular region of human PDGF receptor (hPDGFR) alpha, their use for detecting auto-antibodies anti-hPDGFR alpha and to a method for the diagnosis or the monitoring control for therapy of SSc. The present invention also refers to antibodies or recombinant or synthetic derivatives thereof able to recognize and bind to the above peptide and to their use in the treatment of SSc.Type: ApplicationFiled: July 29, 2011Publication date: May 23, 2013Inventors: Gianluca Moroncini, Ada Funaro, Armando Gabrielli, Vittorio Enrico Avvedimento, Silvia Svegliati Baroni, Mariarosaria Santillo, Roberto Paterno'
-
Publication number: 20130131313Abstract: Assays for identifying novel compounds for inhibiting eEF2 kinase and consequence peptides employed therein.Type: ApplicationFiled: January 7, 2013Publication date: May 23, 2013Applicant: University of Medicine and Dentistry of New JerseyInventor: University of Medicine and Dentistry of New Jersey
-
Publication number: 20130130995Abstract: Described herein are peptides, compositions, and related methods for treating upper gastrointestinal disorders and conditions (e.g., dyspepsia, gastroparesis, post-operative gastric ileus, a functional esophageal disorder, a functional gastroduodenal disorder, gastroesophageal reflux disease (GERD), or a duodenal or stomach ulcer) as well as other conditions and disorders that are described herein.Type: ApplicationFiled: December 7, 2010Publication date: May 23, 2013Applicant: IRONWOOD PHARMACEUTICALS, INCInventors: Mark G. Currie, Daniel P. Zimmer, Angelika Fretzen, Marco Kessler, Brian Cali
-
Publication number: 20130131286Abstract: The present invention generally relates to processes and methods of peptide and protein synthesis. The present invention also relates to specific compounds for use in such processes and methods. It is shown herein that peptides with a C-terminal tertiary N,N-bis(2-mercaptoethyl)-amide (BMEA) undergo N-to-S acyl transfer at weakly acidic pH to form a transient thioester which can be captured for direct ligation with a cysteinyl peptide. These C-terminal BMEA peptides are easily prepared with standard Fmoc solid-phase synthesis protocols, thus giving a very convenient access to the thioester components for native chemical ligation.Type: ApplicationFiled: July 6, 2011Publication date: May 23, 2013Applicant: NANYANG TECHNOLOGICAL UNIVERSITYInventor: Chuan Fa Liu
-
Publication number: 20130131311Abstract: Improved methods of native chemical ligation are provided. The methods involve reacting a thioacid (e.g. a peptide thioacid) with an aziridinyl compound (e.g. an aziridinyl peptide) under mild conditions without the use of protecting groups, and without requiring that a cysteine residue be present in the ligation product. Initial coupling of the thioacid and the aziridinyl compound yields a ligation product which contains an aziridinyl ring. Subsequent opening of the aziridinyl ring (e.g. via a nucleophilic attack) produces a linearized and modified ligation product.Type: ApplicationFiled: November 13, 2012Publication date: May 23, 2013Applicant: WASHINGTON STATE UNIVERSITYInventor: Washington State University
-
Publication number: 20130129764Abstract: The invention relates to compositions and methods for the detection of various infectious organisms, including heartworm (Dirofilaria immitis), Ehrlichia Canis, Anaplasma phagocytophilum, and Borrelia burgdorferi. More particularly, this invention relates to antibodies that bind to a heartworm antigen, the E. Canis gp36 polypeptide, the A. phagocytophilum p44 polypeptide, the B. burgdorferi OspA, OspC, OspF, p39, p41 and VlsE polypeptides, and uses thereof.Type: ApplicationFiled: November 2, 2012Publication date: May 23, 2013Applicant: VCA Antech, Inc.Inventor: VCA Antech, Inc.
-
Publication number: 20130130285Abstract: This invention provides reagents and methods for diagnosing renal disease. Differential levels of inosine metabolite, and proteins: apolipoprotein C-I, apolipoprotein C-II, fibrinogen alpha chain, or fibrinogen A-alpha chain, kininogen, Inter-Alpha Inhibitor H4 (ITIH4), keratin Type I cytoskeletol 10 cystatin A, cystatin B and other polypeptides and fragments thereof provide biomarkers of renal disease and are described herein.Type: ApplicationFiled: June 3, 2011Publication date: May 23, 2013Applicant: IDEXX LABORATORIES, INC.Inventors: Michael Randolph Atkinson, Mahalakshmi Yerramilli, Murthy V.S.N. Yerramilli
-
Patent number: 8445449Abstract: Method and peptide for regulating cellular activity includes a panel of synthesized peptides that have biological effects on inhibiting or enhancing cellular activity. Selected peptides can be used as therapy to reduce and/or inhibit, or initiate and/or enhance, an inflammatory response in a subject.Type: GrantFiled: October 23, 2012Date of Patent: May 21, 2013Assignees: The United States of America, as represented by the Department of Veterans Affairs, Oregon Health & Science UniversityInventors: Steven H. Hefeneider, Sharon L. McCoy
-
Patent number: 8445441Abstract: A purified polypeptide for inhibiting binding of BCL-2 to IP3 receptors includes an amino acid sequence consisting of about 10 to 80 amino acids. The amino acid sequence has a sequence identity at least 90% homologous to a portion of SEQ ID NO:1. The polypeptide inhibits binding of Bcl-2 to IP3 receptors of cells that express IP3R and Bcl-2 and induces apoptosis in a cell.Type: GrantFiled: August 26, 2011Date of Patent: May 21, 2013Assignee: Case Western Reserve UniversityInventors: Clark W. Distelhorst, Yiping Rong
-
Patent number: 8444995Abstract: Provided is a polypeptide having no more than 100 amino acids, which polypeptide comprises one or more sequences having at least 60% homology with any of SEQ ID 1-6, or comprises two or more epitopes having 7 amino acids or more, each epitope having at least 60% homology with a sub-sequence of any of SEQ ID 1-6 that has the same length as the epitope: SEQ?ID?1 DLEALMEWLKTRPILSPLTKGILGFVFTLTVP SEQ?ID?2 LLYCLMVMYLNPGNYSMQVKLGTLCALCEKQASHS SEQ?ID?3 DLIFLARSALILRGSVAHKSC SEQ?ID?4 PGIADIEDLTLLARSMVVVRP SEQ?ID?5 LLIDGTASLSPGMMMGMFNMLSTVLGVSILNLGQ SEQ?ID?6 IIGILHLILWILDRLFFKCIYRLF wherein, the polypeptide is immunogenic in a vertebrate expressing a major histocompatibility complex (MHC) allele, and wherein the polypeptide is not a complete influenza virus protein.Type: GrantFiled: May 7, 2012Date of Patent: May 21, 2013Assignee: PepTCell, Ltd.Inventors: Gregory Alan Soloff, Wilson Romero Capparros-Wanderlay
-
Patent number: 8445448Abstract: The present invention provides a peptide comprising a core residue sequence derivable from human FVIII which peptide is capable of binding to an MHC class II molecule without further antigen processing. The present invention also relates to the use of such peptides for the prevention or suppression of inhibitor antibody formation in haemophilia A and/or acquired haemophilia.Type: GrantFiled: December 3, 2008Date of Patent: May 21, 2013Assignee: Apitope International NVInventor: David Wraith
-
Publication number: 20130123201Abstract: A composition for treatment of a chronic inflammation condition or an autoimmune disorder wherein the composition comprises a therapeutically effective amount of a polypeptide molecule comprising an amino acid sequence that shares at least 80% sequence identity with an amino acid sequence selected from SEQ ID NO: 21, SEQ ID NO: 22, SEQ ID NO 23, and SEQ ID NO: 23. A composition for treatment of a chronic inflammation condition or an autoimmune disorder wherein the composition comprises a therapeutically effective amount of an analog of a LL-37 peptide molecule. A composition for treatment of a chronic inflammation condition or an autoimmune disorder wherein the composition comprises a therapeutically effective amount of an exogenous agonist for increasing cellular production and/or cellular activation and/or cellular expression of a LL-37 peptide. Use of one or more of the compositions for treatment of a chronic inflammation condition or an autoimmune disorder.Type: ApplicationFiled: February 25, 2011Publication date: May 16, 2013Applicant: UNIVERSITY OF MANITOBAInventor: Neeloffer Mookherjee
-
Publication number: 20130122030Abstract: Hyperimmune serum reactive antigens and fragments thereof are disclosed. In addition, methods for isolating such antigens and specific uses thereof, including the treatment of S. epidermidis infections, are disclosed.Type: ApplicationFiled: January 9, 2013Publication date: May 16, 2013Applicant: Intercell AGInventor: Intercell AG
-
Publication number: 20130122546Abstract: A use of a signal peptide for producing a recombinant polypeptide of interest in an expression system, the signal peptide includes at least 12 amino acids of formula (I): (X1)iX2X3X4SX5X6X7, wherein: X1 is a peptide containing from 3 to 6 amino acids, i equal to 0 or 1, X2 is a peptide containing from 3 to 9 hydrophobic amino acids, X3 is a peptide containing from 3 to 5 amino acids, the peptide including at least 3 contiguous or non-contiguous leucines X4 is a peptide containing from 2 to 5 amino acids chosen from Ala, Thr, Ser, Gln, Ile, Met, X5 is Ala or Val, X6 is Gln, Asn or His, X7 is Ala or Cys, provided that when the signal peptide originates from a natural precursor of a specific protein, the polypeptide of interest is different from the protein.Type: ApplicationFiled: March 17, 2011Publication date: May 16, 2013Applicant: LFB BIOTECHNOLOGIESInventor: Alexandre Fontayne
-
Publication number: 20130123202Abstract: Novel peptides that inhibit the release of microparticles from cells are disclosed. The peptide contains at least one VGFPV motif at the N-terminal and has a length of 10-100 amino acids. Also disclosed is polynucleotide encoding the peptide, expression vectors carrying the polynucleotide, and methods for treating AIDS and tumors using the novel peptides.Type: ApplicationFiled: December 4, 2012Publication date: May 16, 2013Applicant: MOREHOUSE SCHOOL OF MEDICINEInventor: Morehouse School Of Medicine
-
Publication number: 20130123187Abstract: A method of selecting an agent comprising a neuroprotecting activity is disclosed. The method comprises: (a) introducing a plurality of agents into a plurality of cells; and (b) analyzing Vesicular Monoamine Transporter 2 (VMAT2) transcription in the cells; and (c) identifying an agent of the plurality of agents capable of up-regulating DJ-1-dependent VMAT2 transcription in the cells, thereby selecting the agent comprising the neuroprotecting activity.Type: ApplicationFiled: October 29, 2012Publication date: May 16, 2013Applicant: Ramot at Tel-Aviv University Ltd.Inventor: Ramot at Tel-Aviv University Ltd.
-
Publication number: 20130123460Abstract: The present invention aims at providing a peptide fragment capable of improving biostability of a bioactive substance while maintaining the activity of the bioactive substance, and a bioactive substance to which the peptide fragment is added. The present invention relates to a partial peptide of a GA module having 5 to 25 amino acids, including a partial sequence of a GA module (SEQ ID NO: 1) and the amino acid sequence Ile-Asp-Glu-Ile-Leu (SEQ ID NO: 2), and a bioactive complex in which the partial peptide of the GA module is bound to a bioactive substance. The bioactive substance includes GLP-1, GLP-2, GIP, VIP, somatostatin, amylin, ghrelin, derivatives thereof, and the like.Type: ApplicationFiled: April 28, 2011Publication date: May 16, 2013Applicant: SANWA KAGAKU KENKYUSHO CO., LTD.Inventors: Masayuki Okamoto, Ryuhji Okamoto, Tomohiro Shigemori, Takayo Murase, Atsushi Miyachi, Mitsuaki Takeuchi, Miyuki Tamura, Hiroshi Kinoshita
-
Publication number: 20130122031Abstract: The invention provides an immunostimulatory peptide containing the amino acid sequence SAFFLFCSE and uses thereof. The invention also provides an immunostimulatory peptide containing the amino acid sequence DPNAPKRPPSAFFLX1X2X3X4 or derivatives thereof. In one embodiment, when X1 is alanine (A), glycine (G), or valine (V) then X2 is C, X3 is S and X4 is E; wherein when X2 is alanine (A), glycine (G), or valine (V) then X1 is F, X3 is S and X4 is E; wherein when X3 is alanine (A), glycine (G), or valine (V) then X1 is F, X2 is C and X4 is E; or wherein when X4 is alanine (A), glycine (G), or valine (V) then X1 is F, X2 is C and X3 is S.Type: ApplicationFiled: July 27, 2011Publication date: May 16, 2013Inventors: Davorka Messmer, Rebecca Saenz
-
Patent number: 8440792Abstract: The peptides and derivative metapeptides based upon natural antimicrobial peptides have potent and broad spectrum activity against pathogens exhibiting multiple antibiotic resistance. Specific peptides can also potentiate the antimicrobial functions of leukocytes, such as neutrophils. In addition, they exhibit lower inherent mammalian cell toxicities than conventional antimicrobial peptides, and overcome problems of toxicity, immunogenicity, and shortness of duration of effectiveness due to biodegradation, retaining activity in plasma and serum. The peptides and derivative metapeptides exhibit rapid microbicidal activities in vitro, can be used to potentiate conventional antimicrobial agents, to potentiate other antimicrobial peptides and are active against many organisms that exhibit resistance to multiple antibiotics currently in existence.Type: GrantFiled: October 25, 2010Date of Patent: May 14, 2013Assignee: Los Angeles Biomedical Research Institute at Harbor-UCLA Medical CenterInventors: Michael R. Yeaman, Alexander J. Shen
-
Patent number: 8440630Abstract: The present invention is to provide a polypeptide specifically inhibiting the activity of Akt (Protein Kinase B), the DNA thereof, the antibody thereof, an inhibitor of Akt activity or an antitumor agent, and the like. The polypeptide comprises polypeptides (SEQ ID NO: 1, 3, 5, 7, and 9 of the sequence listing) that contain an amino acid sequence corresponding to any of the position of amino acid residue 10-24 of human TCL1, amino acid residue 8-22 of human TCL1B, amino acid residue 5-19 of human MTCP1, and amino acid residue 9-24 of mouse or rat TCL1; and the derivatives. Further, the present invention includes DNA encording the polypeptide (SEQ ID NO: 2, 4, 6, 8 or 10 of the sequence listing), and the antibodies specifically binding to the polypeptides. The polypeptide of the present invention can be used for an inhibitor of Akt activity, an antitumor agent, or the like.Type: GrantFiled: December 14, 2004Date of Patent: May 14, 2013Assignee: Japan Science and Technology AgencyInventors: Masayuki Noguchi, Futoshi Okada, Makoto Hiromura
-
Publication number: 20130115277Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of said antibodies.Type: ApplicationFiled: January 8, 2013Publication date: May 9, 2013Inventors: Jan Nilsson, Prediman K. Shah
-
Publication number: 20130116405Abstract: The invention provides modified collagen and related therapeutic and diagnostic methods.Type: ApplicationFiled: September 6, 2012Publication date: May 9, 2013Applicant: THE JOHNS HOPKINS UNIVERSITYInventors: Michael Yu, Jennifer H. Elisseeff, Allen Y. Wang, Hyeseung J. Lee, Xiao Mo
-
Publication number: 20130116185Abstract: The present invention relates to a phosphatidylinositol 3-kinases activity regulator which include the fifth zinc finger domain of FOG2 and which, more specifically, can induce cancer cells to die due to the inclusion of the fifth zinc finger domain of FOG2. Since the death of cancer cells is induced by suppressing the transfer of PI3K signals, the fifth zinc finger domain of FOG2 according to the present invention can be suitably use as a composition for the prevention and treatment of PI3K-related diseases.Type: ApplicationFiled: June 8, 2010Publication date: May 9, 2013Applicant: SNU R&DB FOUNDATIONInventors: Vic Narry Kim, Jung Hyun Lee
-
Publication number: 20130115276Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of said antibodies.Type: ApplicationFiled: January 8, 2013Publication date: May 9, 2013Inventors: Jan Nilsson, Prediman K. Shah
-
Publication number: 20130116342Abstract: The invention relates to methods of modulating the stability of emulsions, especially the stability of emulsions to flocculation and coalescence. The use of peptide emulsifiers comprising at least one side chain carboxylate group in preparing emulsions that are stable to flocculation or coalescence in the presence of salt is also described.Type: ApplicationFiled: March 22, 2011Publication date: May 9, 2013Applicant: PEPFACTANTS PTY LTDInventor: Annette Faith Dexter
-
Publication number: 20130116406Abstract: The present invention relates to an isolated nucleic acid molecule encoding a protein, preferably a hyperimmune serum-reactive antigen from Borrelia, a vector comprising such nucleic acid molecule, a host cell comprising such vector, a protein, preferably a hyperimmune serum-reactive antigen from Borrelia, a process for producing such protein, a process for producing a cell which expresses such protein, an antibody that binds to such protein, a hybridoma cell producing such antibody, a method for producing such antibody, a pharmaceutical composition comprising such nucleic acid molecule, protein, or antibody, use of such nucleic acid molecule, protein, or antibody for the manufacture of a medicament, a method for identifying an antagonist capable of reducing or inhibiting the activity of such protein, a method for diagnosis or treatment of an infection with a pathogen causing Lyme disease or an infection with Borrelia burgdorferi s.l.Type: ApplicationFiled: October 9, 2012Publication date: May 9, 2013Applicant: Intercell AGInventor: Intercell AG
-
Publication number: 20130115275Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of said antibodies.Type: ApplicationFiled: January 8, 2013Publication date: May 9, 2013Inventors: Jan Nilsson, Prediman K. Shah
-
Publication number: 20130116138Abstract: Described herein are small peptide domains and consensus sequences that bind small target molecules of industrial importance, e.g., metals such as nickel, ? carotene, and isoflavones such as genistein. Also described are fusion proteins containing such binding domains fused to proteins or to peptide domains like GST or GBD that bind other ligands and can be used to immobilize the target binding domain on a support. One class of fusion proteins that is useful in industrial settings are fusions that contain concatemers of target binding domains, which increases the binding equivalents per molecule.Type: ApplicationFiled: January 28, 2011Publication date: May 9, 2013Applicants: Archer-Daniels-Midland Company, Iowa State University Research Foundation, Inc.Inventors: Thomas P. Binder, Aragula Gururaj Rao, Yasufumi Yamamoto, Paul Hanke
-
Publication number: 20130115278Abstract: The present invention relates to antibodies raised against fragments of apolipoprotein B, in particular defined peptides thereof, for immunization or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, using one or more of said antibodies.Type: ApplicationFiled: January 8, 2013Publication date: May 9, 2013Inventors: Jan Nilsson, Prediman K. Shah
-
Patent number: 8436140Abstract: Tracers comprising an oligopeptide comprising a fragment of a natriuretic peptide, wherein the fragment comprises the sequence Arg-Ile-Asp-Arg-Ile (SEQ ID NO.: 1), and a signaling moiety, are disclosed. Further disclosed are methods of imaging atherosclerotic plaque by PET scanning or MRI using a tracer.Type: GrantFiled: May 22, 2009Date of Patent: May 7, 2013Assignee: Washington UniversityInventors: Pamela K. Woodard, Michael J. Welch, Geoffrey E. Woodard, Rafaella Rossin
-
Patent number: 8436139Abstract: The present invention relates to a fragment of apolipoprotein B, for immunization for prophylactic or therapeutic treatment of mammals, including humans, against ischemic cardiovascular diseases, in particular myocardial infarction or stroke, as well as diagnosing the presence or absence of antibodies related to increased or decreased risk of developing ischemic cardiovascular diseases including stroke, using said peptide in an assay, pharmaceutical compositions comprising the peptide. The invention further encompasses a particular peptide sequence aggravating disease, which sequence then can be used for diagnostic assays.Type: GrantFiled: March 10, 2006Date of Patent: May 7, 2013Assignee: CardioVax, LLCInventor: Göran K. Hansson
-
Publication number: 20130109619Abstract: A peptide or peptidomimetic comprising an amino acid sequence based on conserved regions of IL10 or IFN-gamma receptor sequences, and related compounds and compositions, as well as methods for the use thereof to inhibit cytokine signaling.Type: ApplicationFiled: May 11, 2011Publication date: May 2, 2013Applicant: The United States of America, as represented by the Secretary, Department of Health and Human ServInventors: Nadya I. Tarasova, Giorgio Trinchieri, Howard A. Young, C. Andrew Stewart, Marco A. Cardone, Alan O. Perantoni
-
Publication number: 20130108662Abstract: A peptide having an amino acid sequence containing at least eight consecutive amino acids of the human lactoferrin protein or of the bovine lactoferrin protein. The peptide is suitable as a cell-penetrating peptide. A complex of the peptide and a cargo molecule non-covalently bound to the peptide. The cargo molecule may be a nucleic acid, an amino acid, a peptide, a protein, a carbohydrate, a lipid, or a small molecule. A method of penetrating or transfecting a cell using the complex.Type: ApplicationFiled: July 25, 2012Publication date: May 2, 2013Applicant: Evonik Roehm GmbHInventors: Roland Brock, Rainer Fischer, Mariola Fotin-Mleczek, Hansjoerg Hufnagel, Norbert Windhab
-
Publication number: 20130108575Abstract: This invention provides novel antimicrobial peptides and formulations thereof. The peptides and/or formulations are effective to kill or to inhibit the growth and/or proliferation of various bacteria, yeast, and fungi.Type: ApplicationFiled: October 16, 2012Publication date: May 2, 2013Applicant: C3 JIAN, INC.Inventor: C3 Jian, Inc.
-
Publication number: 20130109616Abstract: A method is provided for isolating protease resistant antimicrobial peptides (AMPs) from a peptide display library. A plurality of nucleic acid constructs that encode displayed peptides are expressed, resulting in the formation of a plurality of peptide-nucleic acid complexes, each complex comprising at least one displayed peptide associated with the corresponding nucleic acid construct encoding the displayed peptide. The complexes are exposed to at least one protease, to allow the proteolysis of protease-sensitive peptides, such that resistant peptides remain. The peptide-nucleic acid complexes are further exposed to a membrane composition to allow association of complexes that contain membrane-associating peptides. Complexes that remain unassociated with the membrane are removed; and membrane-associated complexes are recovered. The AMPs so characterised may be resistant to one or more protease enzymes and exhibit antimicrobial activity against one or more microbe.Type: ApplicationFiled: January 11, 2011Publication date: May 2, 2013Applicant: ISOGENICA LTDInventors: William Eldridge, Christopher Ullman, Marc Alan Fox, David Okhono Ulaeto, Joanne Elizabeth Thwaite
-
Publication number: 20130109627Abstract: SP-C peptoid compounds, lung surfactant compositions and related surfactant replacement therapies. Such SP-C peptoids can mimic lung surfactant protein C, and can be used in conjunction with biomimetic SP-B compounds over a range of lung surfactant compositions.Type: ApplicationFiled: April 1, 2011Publication date: May 2, 2013Applicant: Northwestern UniversityInventors: Annelise E. Barron, Nathan J. Brown
-
Patent number: 8431111Abstract: The present invention relates to labelled cMet binding peptides suitable for optical imaging in vivo. The peptides are labelled with a benzopyrylium dye suitable for imaging in the red to near-infrared region. Also disclosed are pharmaceutical compositions and kits, as well as in vivo imaging methods, especially of use in the detection, staging, diagnosis, monitoring of disease progression or monitoring of treatment of colorectal cancer (CRC).Type: GrantFiled: July 29, 2008Date of Patent: April 30, 2013Assignee: GE Healthcare LimitedInventors: Robert James Domett Nairne, Andrew John Healey, Edvin Wilhelm Johannesen
-
Publication number: 20130102522Abstract: Compounds that are capable of inhibiting the activity of one or more protein kinases are provided. The compounds are short, predominantly basic peptidic compounds comprising between about 5 and about 20 amino acids, and can optionally comprise an ATP mimetic moiety. The protein kinase inhibiting compounds can be used to inhibit the activity of one or more protein kinases in vitro or in vivo. Also provided are methods of inhibiting a protein kinase in a subject by administration of an effective amount of a protein kinase inhibiting compound and the use of the protein kinase inhibiting compounds, alone or in combination with other chemotherapeutic agents, in the treatment of protein kinase mediated diseases and disorders.Type: ApplicationFiled: March 15, 2012Publication date: April 25, 2013Applicant: PHARMAGAP INC.Inventors: Raphael Terreux, Jenny Phipps
-
Publication number: 20130102534Abstract: Compounds, compositions and methods for inhibiting vascular permeability and pathologic angiogenesis are described herein. Methods for producing and screening compounds and compositions capable of inhibiting vascular permeability and pathologic angiogenesis are also described herein. Pharmaceutical compositions are included in the compositions described herein. The compositions described herein are useful in, for example, methods of inhibiting vascular permeability and pathologic angiogenesis, including methods of inhibiting vascular permeability and pathologic angiogenesis induced by specific angiogenic, permeability and inflammatory factors, such as, for example VEGF, bFGF and thrombin. Methods for treating specific diseases and conditions are also provided herein.Type: ApplicationFiled: October 4, 2012Publication date: April 25, 2013Applicant: University of Utah Research FoundationInventors: Dean Li, Christopher Jones, Nyall London
-
Publication number: 20130102542Abstract: The invention is related to isoforms of components of transcription factor complexes that are specifically expressed in cancer cells. These isoforms can be used as biomarkers for detection, diagnosis, prognosis and monitoring of treatments of cancer, and as drug targets of pharmaceutical compositions for the treatment of various cancers expressing the targeted isoforms. Methods, molecules, materials and kits for these uses are disclosed.Type: ApplicationFiled: October 17, 2012Publication date: April 25, 2013Applicant: ONCOTX, INC.Inventor: Oncotx, Inc.
-
Publication number: 20130101624Abstract: Linear polypeptide epitopes of hazelnut cor a 1 and celery api 1.0101 allergen of a sequence length of ten to fifteen amino acids for treatment and prevention of hazelnut or celery allergy are provided. Means and methods for diagnosing hazelnut or celery allergy, and for detecting hazelnut or celery allergens in a sample, are also provided.Type: ApplicationFiled: July 4, 2011Publication date: April 25, 2013Applicant: CHARITE UNIVERSITATSMEDIZIN BERLINInventors: Margitta Worm, Rudolf Volkmer, Bernhard Ay, Elvira Ruppel
-
Publication number: 20130101628Abstract: Disclosed herein is a completely synthetic cell-free therapy based on peptide amphiphile nanostructures designed to mimic the activity of vascular endothelial growth factor (VEGF), one of the most potent angiogenic signaling proteins. The VEGF-mimetic filaments disclosed herein were found to induce phosphorylation of VEGF receptors and induce pro-angiogenic behavior in endothelial cells, indicated by an enhancement in proliferation, survival and migration in vitro.Type: ApplicationFiled: April 29, 2012Publication date: April 25, 2013Applicant: NORTHWESTERN UNIVERSITYInventors: Matthew J. Webber, Jörn Tongers, Douglas W. Losordo, Samuel I. Stupp
-
Patent number: 8426559Abstract: A peptide comprising the sequence VKVKVRVKVDPPTKVKVRVKV-NH2 forms a hydrogel which has the ability to shear-thin and recover. The hydrogel, both before and after shear-thinning, is capable of killing bacteria, including methicillin-resistant Staphylococcus aureus (MRSA).Type: GrantFiled: March 24, 2010Date of Patent: April 23, 2013Assignee: University of DelawareInventors: Daphne A. Salick, Darrin J. Pochan, Joel P. Schneider
-
Patent number: 8426558Abstract: The present invention is a peptide compound which stimulates the formation of hard tissues such as bone and cartilage. The invention is also related to a method to treat a defect in hard tissues such as bone and cartilage using the peptide. The method of the present invention may be used to treat or prevent the defects in bones and cartilages which are caused by rheumatoid arthritis or osteoarthritis which involves the regeneration of new bone or cartilage in or around the defects.Type: GrantFiled: December 15, 2010Date of Patent: April 23, 2013Assignee: OrthoTrophix, Inc.Inventors: Catherine Middleton-Hardie, Mirella Lazarov, David Rosen
-
Patent number: 8426367Abstract: Provided herein are compositions and methods for binding outgrowth endothelial cells (OEC). The compositions consist of peptide ligands capable of binding OEC with high affinity and specificity. The compositions of the invention include peptides set forth in SEQ ID NO: 1-38 and variants and derivatives thereof. Compositions also include the nucleotide sequences encoding the peptides of the invention. The compositions find use in methods for the isolation of OEC and for the recruitment and retention of OEC to sites of therapeutic interest. Methods for the identification and isolation of other peptides capable of binding OEC are also provided.Type: GrantFiled: March 5, 2008Date of Patent: April 23, 2013Assignees: The University of North Carolina at Chapel Hill, North Carolina State University, The Ohio State University Research FoundationInventors: Cam Patterson, Anka Veleva, Stuart Cooper
-
Publication number: 20130095122Abstract: The present invention relates to peptides and antibodies which bind to melanoma inhibitory activity protein and the uses of such peptides and antibodies. The invention also relates to nucleic acids coding for such peptides or antibodies. The invention also relates to pharmaceutical compositions comprising such peptides or antibodies or such nucleic acids. The present invention also relates to small molecule compounds which bind to melanoma inhibitory activity protein and to uses of such small molecule compounds. Moreover, the present invention also relates to a method of preventing dimerization and/or aggregation of melanoma inhibitory activity (MIA) protein. The invention is based on the identification of the relevant sites of interaction of the MIA protein with the inhibitory peptides/antibodies.Type: ApplicationFiled: March 17, 2011Publication date: April 18, 2013Inventors: Anja Katrin Bosserhoff, Burkhard König, Alexander Riechers, Jennifer Schmidt
-
Publication number: 20130095053Abstract: Disclosed herein are compositions and methods of using such compositions to modulate pigmentation and proliferation of a melanocyte, such as to prevent or treat skin disorders, including skin cancer or for use for cosmetic purposes. In one example, a method of modulating pigmentation of a melanocyte includes contacting the melanocyte (such as a human melanocyte) with an agent that modulates neuregulin-1 (NRG-1) activity, such as an agent that increases or decreases NRG-1 activity, thereby modulating pigmentation of the melanocyte. In one particular example, the method of increasing melanocyte pigmentation or proliferation can be used to reduce UV skin damage, including that associated with skin cancer. In another example, the method of decreasing melanocyte pigmentation can be used to treat a skin pigmentation disorder associated with undesired increased skin pigmentation.Type: ApplicationFiled: June 23, 2011Publication date: April 18, 2013Inventors: Vincent J. Hearing, Wonseon Choi, Ludger Kolbe, Rainer Wolber
-
Publication number: 20130095110Abstract: The present invention is directed to KIAA1199, which is a novel factor involved in decomposition of hyaluronic acid, and to use thereof. More specifically, the invention is directed to a hyaluronic acid decomposition-promoting agent containing the KIAA1199 gene and a protein encoded by the gene; to a hyaluronic acid decomposition-inhibiting agent characterized by inhibiting the activity or expression thereof (including an siRNA or a monoclonal antibody); and to a method for screening a novel hyaluronic acid decomposition-controlling agent, in which the method contains employing the expression of KIAA1199 as an index.Type: ApplicationFiled: June 3, 2011Publication date: April 18, 2013Applicant: KAO CORPORATIONInventors: Hiroyuki Yoshida, Shintaro Inoue, Shingo Sakai, Aya Nagaoka