Abstract: Factor VIII polypeptides having FVIII:C activity that contain modifications in the A3 and/or C1 and/or C2 domains of the sequence of the light chain of Factor VIII, characterized by the binding affinity to low density lipoprotein receptor protein, and methods for producing the same.

Abstract: An implantable flow control element is provided which prevents air from entering an isolated portion of a patient's lung. The element may permit air to escape from the isolated portion so that the element acts like a valve. Systems for implanting pulmonary devices are also provided.

Abstract: The present invention relates to a stable solid-state Raman laser, the solid-state Raman laser including a resonator cavity defined by at least two reflectors, a laser material located in the resonator cavity and capable of generating a cavity laser beam which propagates within the resonator cavity, a solid Raman medium located in the resonator cavity for shifting the frequency of the cavity laser beam to produce a Raman laser beam which propagates within the resonator cavity; and an output coupler for coupling and outputting the Raman laser beam from the resonator cavity, wherein at least one parameter selected from the group consisting of the position of the laser material relative to the position of the Raman medium in the cavity, the length of the cavity and the curvature of at least one of the reflectors, is selected such that changes in the focal lengths of both the laser material and the Raman medium as a result of thermal effects in the laser material and the Raman medium during operation of the laser

Abstract: An optical system has a diode pump source, and a gain media made of a material with an anisotropic absorption. The gain media is cut at an angle to produce substantially polarization-independent absorption of a pump beam. An optical coupler is positioned between the diode pump source and the gain media. The optical coupler produces a pump beam that has substantially equal amounts of pump power along any two orthogonal axis that are orthogonal to the pump beam in the gain medium. The wavelength range allowed for the pump source is extended.

Abstract: A novel approach to Borrelia vaccine formulation taking into account serological, genotypic and epidemiological information by which OspC proteins from different strains of B. burgdorferi are grouped together. OspC antigens are chosen in order to constitute a representative sample of such groupings, so that the resulting vaccine provides the greatest cross-protectivity with the fewest number of antigens.

Abstract: A photonic device includes a silicon semiconductor based superlattice. The superlattice has a plurality of layers that form a plurality of repeating units. At least one of the layers in the repeating unit is an optically active layer with at least one species of rare earth ion.

Abstract: This invention provides a new catalyst for purification of diesel engine exhaust gas comprising a carrier of at least one sulfur-resistant refractory oxide and at least one catalytic metal, wherein at least one solid acid and/or sulfuric acid is carried on the carrier by adding at least one precursor of said solid acid and/or sulfuric acid during the preparation of the carrier, and preparation thereof. The catalyst of this invention is thermally and chemically durable and can effectively remove particulate matters, hydrocarbons and nitrogen oxides contained in the diesel engine exhaust gas at low temperatures.

Abstract: A laser system includes a pump source that produces a first output. The pump source has a feedback loop with a first summing junction and a first command that has step quantization or digitized set point. An output device is coupled to the pump source to receive the first output and produce a second output. A feedback loop is coupled to the first summing junction. The feedback loop includes a second summing junction coupled to at least a portion of the second output. The second summing junction receives a second command and provides an input to the first summing junction. The feedback loop reduces the step quantization from the first output to provide finer control step of a property of the second output.

Abstract: The present invention provides an irradiated crosslinked polyethylene containing reduced free radicals, preferably containing substantially no residual free radical. Disclosed is a process of making irradiated crosslinked polyethylene by irradiating the polyethylene in contact with a sensitizing environment at an elevated temperature that is below the melting point, in order to reduce the concentration of residual free radicals to an undetectable level. A process of making irradiated crosslinked polyethylene composition having reduced free radical content, preferably containing substantially no residual free radicals, by mechanically deforming the polyethylene at a temperature that is below the melting point of the polyethylene, optionally in a sensitizing environment, is also disclosed herein.

Abstract: A method and system for managing sales data. One embodiment is a software application that assists in classification, review and approval of data to be stored in a database for the use of a product supplier or seller. In one embodiment, a method includes storing a plurality of data components as groups of data components in a database, wherein the plurality of data components comprises information relating to products, and information relating to customers. The method further includes assigning a subset of the plurality of users to a content review group (“CRG”), and notifying each user in the CRG to provide input regarding individual data components of a group of data components. Input may include indicating whether data components are accurate, entering comments regarding the data components, entering edits to the data components. The method further includes receiving and storing the input, notifying a content director (“CD”) to review the input.

Abstract: An equivalence checking method provides first and second logic functions. Don't care gates are inserted for don't care conditions in the first and second logic functions. The insertion of the don't care gates creates a first intermediate circuit and a second intermediate circuit. All 3DC gates of the first intermediate circuit are propagated and merged into a single 3DC gate when 3DC gates and SDC gates coexist in either of the first and second intermediate circuits. All 3DC gates of the second intermediate circuit are propagated and merged into a single 3DC gate when 3DC gates and SDC gates coexist in either of the first and second intermediate circuits. First and second circuits are produced in response to propagating and merging the 3DC gates. A combinational equivalence check is then performed of the first circuit to the second circuit under different equivalence relations.

Abstract: Replacement of codons in DNA encoding the first three SCRs of LHR-A of CR1 with others encoding the predicted amino acids in the CR1-like sequence can give rise to chimeric genes which can be expressed to give active complement inhibitors with functional complement inhibitory, including anti-haemolytic activity. There is provided a soluble polypeptide comprising, in sequence, one to four short consensus repeats (SCR) selected from SCR 1, 2, 3 and 4 of long homologous repeat A (LHR-A) as the only structurally and functionally intact SCR domains of CR1 and including at least SCR3, in which one or more of the native amino acids are substituted with the following: Val 4, Asp 19, Scr 53, Lys 57, Ala 74, Asp 79, Arg 84, Pro 91, Asn 109, Lys 116, Val 119, Ala 132, Thr 137, Ile 139, Ser 140, Tyr 143, His 153, Leu 156, Arg 159, Lys 161, Lys 177, Gly 230, Ser 235, His 236.

Abstract: A network includes a plurality of antennas coupled to a plurality of base stations. The network can be optical or constructed with RF microwave links. The antennas and base stations are configured to transmit and receive digital signals representing cellular signals and the digital signals are exchanged over the network. A plurality of links couple the plurality of antennas and the plurality of base stations. At least one link of the plurality of links provides multiple transmission paths between at least a portion of the base stations and at least a portion of the antennas.

Abstract: A laser apparatus includes a modelocked laser system with a high reflector and an output coupler that define an oscillator cavity. An output beam is produced from the oscillator cavity. A gain medium and a modelocking device are positioned in the oscillator cavity. A diode pump source produces a pump beam that is incident on the gain medium. A second harmonic generator is coupled to the oscillator cavity. A third harmonic generator that produces a UV output beam, is coupled to the second harmonic generator. A photonic crystal fiber is provided with a proximal end coupled to the laser system. A delivery device is coupled to a distal portion of the photonic crystal fiber.

Abstract: A method to obtain contamination free surfaces of a material chosen from the group comprising GaAs, GaAlAs, InGaAs, InGaAsP and InGaAs at crystal mirror facets for GaAs based laser cavities. The crystal mirrors facets are cleaved out exposed to an ambient atmosphere containing a material from the group comprising air, dry air, or dry nitrogen ambients. Any oxides and other foreign contaminants obtained during the ambient atmosphere exposure of the mirror facets are removed by dry etching in vacuum. Thereafter, a native nitride layer is grown on the mirror facets by treating them with nitrogen.

Abstract: A cylinder sleeve for an internal combustion engine having an engine block and a cylinder head. The cylinder sleeve includes a cylindrical section having a top portion and a bottom portion, and configured to receive a cylinder piston that reciprocates in the block. The top portion is configured to mate with the cylinder head. The cylinder sleeve also includes a flange section adjacent to the top portion of the cylindrical section. The flange section is configured with a coolant groove and at least one coolant hole to provide a passageway for coolant to pass into the coolant groove of the flange section.

Abstract: A scalable, distributed, highly available, load balancing server system having multiple machines is provided that functions as a front server layer between a network (such as the Internet) and a back-end server layer having multiple machines functioning as Web file servers, FTP servers, or other application servers. The front layer machines comprise a server cluster that performs fail-over and dynamic load balancing for both server layers. The operation of the servers on both layers is monitored, and when a server failure at either layer is detected, the system automatically shifts network traffic from the failed machine to one or more operational machines, reconfiguring front-layer servers as needed without interrupting operation of the server system. The server system automatically accommodates additional machines in the server cluster, without service interruption. The system operates with a dynamic reconfiguration protocol that permits reassignment of network addresses to the front layer machines.

Abstract: A variable optical gain equalizer in accordance with one embodiment of the present invention comprises a variable branching ratio beam splitter having a variable polarization rotator, the variable branching ratio beam splitter branching an input light beam into two light beams at an arbitrary power ratio, through control of the rotation angle of the polarization direction by the variable polarization rotator; an optical filter presenting different filter characteristics to the two branched output light beams; and a polarization coupler for polarization coupling the two light beams that have passed through the optical filter, wherein the rotation angle of the polarization direction is controlled by the variable polarization rotator so as to vary the spectra of the output light beams.

Abstract: A polypeptide comprising a portion of the sequence of the general formula (I): CNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSG, of 6-23 amino acids in length and comprising sequence a) and/or b): a) GGRKVF, b) FELVGEPSIY multimeric and chimeric derivatives, pharmaceutiocal compositions containing them and their use in therapy.