Patents Assigned to Technische Universität München
  • Patent number: 11045090
    Abstract: A medical imaging apparatus for combined X-ray and optical visualization is provided. It comprises: an X-ray detector positioned above a patient; an X-ray source positioned below a patient; a control device; and a camera setup adapted to deliver an optical stereoscopic or 3D image. Thereby, the camera setup is positioned adjacent to the X-ray detector above the patient, and the control device is adapted to calculate an optical 2D image or a 3D surface from the data delivered by the camera setup, that optical 2D image or 3D surface having a virtual viewpoint similar to the viewpoint of the X-ray source. It is further adapted to superimpose an X-ray image acquired by the X-ray detector and the optical 2D image or 3D surface in order to achieve an augmented optical/X-ray image.
    Type: Grant
    Filed: September 28, 2016
    Date of Patent: June 29, 2021
    Assignee: Technische Universität München
    Inventor: Nassir Navab
  • Patent number: 11038525
    Abstract: A method (C) for converting a data signal (U), comprising (i) providing an input symbol stream (B) representative of the data signal (U), (ii) demultiplexing (DMX) the input symbol stream (B) to consecutively decompose the input symbol stream (B) into a number m of decomposed partial symbol streams (B_1, . . . , B_m), (iii) applying on each of the decomposed partial symbol streams (B_1, . . . , B_m) an assigned distribution matching process (DM_1, . . . , DM_m), thereby generating and outputting for each decomposed partial symbol stream (B_1, . . . , B_m) a respective pre-sequence (bn_1, . . . , bn_m) or n_j symbols as an intermediate output symbol sequence, and (iv) supplying the pre-sequences (bn_1, . . . , bn_m) to at least one symbol mapping process (BM) to generate and output a signal representative for a final output symbol sequence (S) as a converted data signal. Each of the distribution matching processes (DM_1, . . .
    Type: Grant
    Filed: September 29, 2017
    Date of Patent: June 15, 2021
    Assignee: Technische Universität München
    Inventors: Georg Böcherer, Patrick Schulte, Fabian Steiner
  • Patent number: 10959088
    Abstract: A communication method (S) for communication between mobile units (10, 20), and in particular between vehicles, in which information transmitted between the mobile units (10, 20) is encoded on the transmitter side by means of an encoder (12-1, 22-1) and is decoded on the receiver side by means of a decoder (12-2, 22-2), and the mobile units (10, 20) are synchronized in communication (S3) with an external interface unit (30) outside the mobile units (10, 20) prior to communication (S5) with one another in that a codebook (Cj) defining or specifying an encoder (12-1, 22-1) and/or a decoder (12-2, 22-2) is determined (S2) by the external interface unit (30) and is communicated (S3) to the mobile units (10, 20).
    Type: Grant
    Filed: April 24, 2018
    Date of Patent: March 23, 2021
    Assignees: Technische Universität München, Bayerische Motoren Werke Aktiengesellschaft
    Inventors: Holger Boche, Christian Arendt
  • Publication number: 20210079037
    Abstract: The present invention relates to a light-switchable polypeptide. In particular, the present invention relates to a polypeptide comprising a light-responsive element, wherein the configuration (i.e. the configurational state) of the light-responsive element can be switched between a trans and cis isomer by irradiating the polypeptide with (a) particular wavelength(s) of light, and wherein the switch of said configuration alters the conformation and binding activity of said polypeptide to a ligand (e.g. molecule of interest). Also, the present invention comprises using said light-switchable polypeptide for isolating and/or purifying a molecule of interest. The present invention further provides an affinity matrix, an affinity chromatography column, and an affinity chromatography apparatus comprising the light-switchable polypeptide of the invention.
    Type: Application
    Filed: May 9, 2018
    Publication date: March 18, 2021
    Applicant: TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Arne SKERRA, Andreas REICHERT, Martin DAUNER
  • Patent number: 10951455
    Abstract: Methods (C) for converting a data signal (U). The methods may comprise (i) providing an input symbol stream (IB) of input symbols (Bj), the input symbol stream (IB) being representative for the data signal (U) to be converted and (ii) applying to consecutive disjunct partial input symbol sequences (IBp) of a number of p consecutive input symbols (IBj) covering said input symbol stream (IB), a distribution matching process (DM) to generate and output a final output symbol stream (OB) or a preform thereof, wherein the distribution matching process (DM) may be formed by a preceding shell mapping process (SM) and a succeeding amplitude mapping process (AM), wherein said shell mapping process (SM) may be configured to form and output to said amplitude mapping process (AM) for each of said consecutive partial input symbol sequences (IBp) a sequence (sq) of a number of q shell indices (s), and wherein said amplitude mapping process (AM) may be configured to assign to each shell index (s) a tuple of amplitude values.
    Type: Grant
    Filed: November 23, 2017
    Date of Patent: March 16, 2021
    Assignee: Technische Universität München
    Inventors: Georg Böcherer, Patrick Schulte, Fabian Steiner
  • Publication number: 20210071161
    Abstract: The present invention relates to novel polypeptides with xylanase activity, especially xylanase variants, such as genetically engineered xylanase variants, which show improved thermostability, improved resistance against acid treatment and increased enzyme activity on arabinoxylan. The invention includes the use of said polypeptides in applications, such as for food or feed, for brewing or malting, for the treatment of xylan containing raw materials like grain-based materials, e.g. for the production of biofuels or other fermentation products, including biochemicals, and/or for the wheat gluten-starch separation industry, and methods using these polypeptides, as well as compositions (such as feed additive compositions) comprising said polypeptides.
    Type: Application
    Filed: November 22, 2018
    Publication date: March 11, 2021
    Applicant: TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Sigrid GRAUBNER, Vladimir ZVERLOV, Wolfgang SCHWARZ, Waldemar HAUF, Björn ANDREESSEN, Louis Philipp SCHULTE, Wolfgang LIEBL
  • Patent number: 10919938
    Abstract: The present invention, among others, relates to a compound having a structure according to formula (I) or a pharmaceutically acceptable salt thereof, wherein Xaa1 are the iodo-substituted or methyl-substituted amino acids D- and L-Tyr, iodo-substituted or methyl- substituted D- and L-homotyrosine, iodo-substituted or methyl-substituted D- and L-Phe, iodo-substituted or methyl-substituted D- and L-p-OH-phenylglycine, and iodo-substituted or methyl-substituted D- or L-Trp, Xaa2 to Xaa4 are independently of each other, an optionally N-alkylated natural or unnatural amino acid, R is H or methyl, L is a linker moiety, Ar is a spacer comprising an aromatic moiety, and D comprises, preferably is i) a combination of an organic complexation agent and a radioactive or a detectable label; or ii) a radioactive or a detectable label, an organic complexation agent or an active substance, said active substance particularly being selected from cytotoxic agents, lipids, sugars, sugar conjugates, sugar derivatives, proteins an
    Type: Grant
    Filed: June 6, 2014
    Date of Patent: February 16, 2021
    Assignee: TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Hans-Jürgen Wester, Margret Schottelius, Theresa Osl, Andreas Poschenrieder, Marina Willibald
  • Patent number: 10907140
    Abstract: A mutant ?-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.
    Type: Grant
    Filed: September 5, 2016
    Date of Patent: February 2, 2021
    Assignee: Technische Universitaet Muenchen
    Inventors: Vladimir Zverlov, Wolfgang Schwarz, Roman Prechtl, Benedikt Leis, Claudia Held, Wolfgang Liebl
  • Publication number: 20210023719
    Abstract: A method for determining the joint positions of a kinematic chain uses only an imaging sensor and a computing unit. Characteristic features on the links and joints of the kinematic chain are identified and the joint positions are calculated from these visual measurements. The robot can be controlled without the use of joint encoders. A sensor system for monitoring the status of a kinematic chain includes a computing unit and an imaging sensor. The imaging sensor may be mounted to the kinematic chain or in the surroundings of the kinematic chain and monitors the kinematic chain and/or the surroundings of the kinematic chain. The computing unit determines a pose and/or movement parameters of at least one element of the kinematic chain by analyzing an output signal of the imaging sensor, in particular by analyzing characteristic features and determines a rotational joint position by analyzing the characteristic features.
    Type: Application
    Filed: January 14, 2019
    Publication date: January 28, 2021
    Applicant: Technische Universität München
    Inventors: Nicolas ALT, Clemens SCHUWERK, Eckehard STEINBACH, Stefan LOCHBRUNNER, Dong QIUWEI
  • Patent number: 10894845
    Abstract: A system for precision polymerization is disclosed comprising at least one Michael-type monomer and a metal compound MR1R2R3 as sole catalyst and initiator, wherein M is aluminum, gallium or indium, each of R1, R2, and R3 independently is CI, F, I, Br, linear, branched or cyclic alkyl, heterocycloalkyl, linear, branched or cyclic alkenyl, heterocycloalkenyl, linear, branched, or cyclic alkenyl, linear, branched, or cyclic alkinyl, heterocycloalkinyl, linear, branched, or cyclic alkoxy, aryl, heteroaryl, aryloxy, silyl, metallocenyl, nitro, nitroso, hydroxy, or carboxyl, wherein each alkyl, alkenyl, alkinyl or alkoxy group independently has up to 12 carbon atoms, wherein each aryl or heteroaryl independently has 5 to 14 ring atoms, wherein any hetero group has at least one hetero atom selected from the group consisting of O, S, and N, wherein each alkyl, alkenyl, alkinyl or alkoxy, heterocycloalkyl, heterocycloalkenyl, heterocycloalkinyl, aryl, heteroaryl, aryloxy group can be substituted by 1 up to the highes
    Type: Grant
    Filed: March 22, 2017
    Date of Patent: January 19, 2021
    Assignee: Technische Universität München
    Inventors: Maximilian Knaus, Marco Giuman, Bernhard Rieger
  • Publication number: 20210008207
    Abstract: The present invention relates to inhibitors of the interaction between H. pylori IIopQ and a member of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family as well as to immunogenic compositions based on H. pylori HopQ. The present invention further relates to the use of the inhibitors and immunogenic compositions for preventing or treating a disease or disorder caused by or associated with H. pylori.
    Type: Application
    Filed: July 20, 2017
    Publication date: January 14, 2021
    Applicants: TECHNISCHE UNIVERSITÄT MÜNCHEN, MAX-PLANCK-GESELLSCHAFT ZUR FÖRDERUNG DER WISSENSCHAFTEN E.V.
    Inventors: Anahita JAVAHERI, Tobias KRUSE, Markus GERHARD, Bernhard B. SINGER, Daniel HORNBURG, Han REMAUT, Matthias MANN, Felix MEISSNER, Steffen BACKERT
  • Patent number: 10886511
    Abstract: The invention relates to a housing for a cell stack of a battery, comprising: an integral frame from accommodating the cell stack, wherein the frame surrounds at least three end faces of a cell stack which is accommodated in the housing, and at least one electrically conductive connecting element for establishing an electrical connection between an external connection and a cell stack which is accommodated in the housing is integrated in the frame; and a cover for covering sides, in particular all sides, of a cell stack which is received in the housing, which sides are not surrounded by the frame.
    Type: Grant
    Filed: November 12, 2015
    Date of Patent: January 5, 2021
    Assignee: Technische Universität München
    Inventors: Markus Westermeier, Thomas Knoche, Johannes Schmalz, Jakob Kurfer
  • Patent number: 10880037
    Abstract: A signal receiver for interpreting a received signal is provided, the receiver being configured to perform: decoding the received signal so as to form a sequence of symbols hypothesised to represent the content of the received signal; comparing the frequency of occurrence of symbols within the sequence with a predetermined symbol distribution; and if the relative frequency of occurrence of symbols within the sequence of symbols does not match the predetermined distribution, treating the sequence of symbols as being an incorrect representation of the content of the received signal.
    Type: Grant
    Filed: April 15, 2019
    Date of Patent: December 29, 2020
    Assignees: Huawei Technologies Duesseldorf GmbH, Technische Universitaet Muenchen
    Inventors: Peihong Yuan, Georg Boecherer, Patrick Schulte, Gerhard Kramer, Ronald Boehnke, Wen Xu
  • Patent number: 10875934
    Abstract: The present invention relates to nanocrystalline cellulose, an efficient way of its preparation and to uses of such nanocrystalline cellulose. The present invention also relates to porous metal oxides having a chiral nematic structure which are prepared using nanocrystalline cellulose.
    Type: Grant
    Filed: October 9, 2015
    Date of Patent: December 29, 2020
    Assignee: TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Vesna Müller, Heiko Briesen
  • Publication number: 20200376440
    Abstract: A device and a method for detecting deposits in a membrane module which produces a permeate and which comprises at least one permeable or semipermeable membrane layer. At least one polymer optical fiber for detecting deposits on the membrane layer is integrated in the membrane module such that the polymer optical fiber is in contact with at least one membrane layer. A method of detecting deposits in a membrane module producing a permeate and to a membrane module for producing a permeate from a feed stream of a fluid, in particular an aqueous solution, with the membrane module comprising a plurality of adjacently disposed or stacked sheets of a permeable or semipermeable membrane layer and with at least one polymer optical fiber being embedded or integrated in the membrane module, which polymer optical fiber is in contact with at least one sheet of the membrane layer.
    Type: Application
    Filed: April 18, 2018
    Publication date: December 3, 2020
    Applicant: Technische Universität München
    Inventors: Simon HAGER, Karl GLAS, Martin MEINARDUS, Matthias ALBERT
  • Patent number: 10844094
    Abstract: The present invention relates to a biosynthetic random coil polypeptide or a biosynthetic random coil polypeptide segment or biosynthetic conjugate, in which the biosynthetic random coil polypeptide, the biosynthetic random coil polypeptide segment, or the biosynthetic conjugate comprises an amino acid sequence consisting solely of proline and alanine amino acid residues, wherein the amino acid sequence consists of at least about 50 proline (Pro) and alanine (Ala) amino acid residues. The at least about 50 proline (Pro) and alanine (Ala) amino acid residues may be (a) fconstituent(s) of a heterologous polypeptide or an heterologous polypeptide construct. Also uses and methods of use of these biosynthetic random coil polypeptides or polypeptide segments or conjugates are described.
    Type: Grant
    Filed: August 21, 2018
    Date of Patent: November 24, 2020
    Assignees: TECHNISCHE UNIVERSITÄT MÜNCHEN, XL-PROTEIN GMBH
    Inventors: Arne Skerra, Uli Binder, Martin Schlapschy
  • Publication number: 20200362379
    Abstract: The present invention relates to a method for preparing oligosaccharides which can be used among others as food additives to reduce calorie content, to sweeten food products, to increase the fiber content of food products, to improve the texture of food products and to stimulate the gut microbiome bacteria. Furthermore they can be applied in the fields of animal feed, or other applications. More particularly, this invention is directed to a high temperature hydrolysis of xyloglucan polysaccharide to defined xyloglucan oligosaccharides. The invention further relates to oligosaccharide hydrolysates produced with the method of the invention and to the use of said oligosaccharide hydrolysates in human and/or animal nutrition, as prebiotic or other uses. Further provided are novel endoglucanases for use in the method of the invention as well as in other applications.
    Type: Application
    Filed: November 16, 2018
    Publication date: November 19, 2020
    Applicant: TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Sigrid GRAUBNER, Vladimir ZVERLOV, Wolfgang SCHWARZ, Petra KORNBERGER, Björn ANDREESSEN
  • Patent number: 10828358
    Abstract: The present invention relates to immunogenic compositions and their use in the prevention or treatment of diseases or disorders caused by or associated with Helicobacter pylori, in particular H. pylori infection and gastroduodenal disorders caused by H. pylori. The present invention further relates to methods of detecting H. pylori infection in a subject.
    Type: Grant
    Filed: December 14, 2016
    Date of Patent: November 10, 2020
    Assignees: TECHNISCHE UNIVERSITÄT MÜNCHEN, MAX-PLANCK-GESELLSCHAFT ZUR FÖRDERUNG DER WISSENSCHAFTEN E.V.
    Inventors: Tobias Kruse, Daniel Hornburg, Markus Gerhard, Matthias Mann, Felix Meissner
  • Publication number: 20200347373
    Abstract: The invention relates to fusion polypeptides, nucleic acid molecules encoding said fusion polypeptides and genetically modified cells including said nucleic acid molecules. Moreover, the invention relates to a method for preparing target polypeptides using the fusion polypeptides.
    Type: Application
    Filed: January 15, 2019
    Publication date: November 5, 2020
    Applicant: TECHNISCHE UNIVERSITÄT MÜNCHEN
    Inventors: Christoph KUTZNER, Marco GIUMAN
  • Patent number: 10826648
    Abstract: Methods (C) for converting a data signal (U), comprising processes of (i) providing an input symbol stream (IB) of input symbols (IBj), the input symbol stream (IB) being representative for the underlying data signal (U) to be converted, and (ii) applying a distribution matching process to consecutive partial input symbol sequences (IBk) of a number of k consecutive input symbols (IBj) covering said input symbol stream (IB). The distribution matching process (DM) generates and outputs a final output symbol stream (OB) of consecutive output symbols (OBj) or a preform thereof, wherein the distribution matching process (DM) is based on and/or comprises a family ((ƒi)i?{0, 1, . . . , n-1}) of a number (n) of distribution matching functions (ƒi), the action of the distribution matching process (DM) is achieved by acting with one of said distribution matching functions (ƒi) selected from said family ((ƒi)i?{0, 1, . . .
    Type: Grant
    Filed: January 16, 2018
    Date of Patent: November 3, 2020
    Assignee: Technische Universität München
    Inventors: Georg Böcherer, Patrick Schulte, Fabian Steiner