Abstract: The present invention relates to a light-switchable polypeptide. In particular, the present invention relates to a polypeptide comprising a light-responsive element, wherein the configuration (i.e. the configurational state) of the light-responsive element can be switched between a trans and cis isomer by irradiating the polypeptide with (a) particular wavelength(s) of light, and wherein the switch of said configuration alters the conformation and binding activity of said polypeptide to a ligand (e.g. molecule of interest). Also, the present invention comprises using said light-switchable polypeptide for isolating and/or purifying a molecule of interest. The present invention further provides an affinity matrix, an affinity chromatography column, and an affinity chromatography apparatus comprising the light-switchable polypeptide of the invention.

Abstract: Methods (C) for converting a data signal (U). The methods may comprise (i) providing an input symbol stream (IB) of input symbols (Bj), the input symbol stream (IB) being representative for the data signal (U) to be converted and (ii) applying to consecutive disjunct partial input symbol sequences (IBp) of a number of p consecutive input symbols (IBj) covering said input symbol stream (IB), a distribution matching process (DM) to generate and output a final output symbol stream (OB) or a preform thereof, wherein the distribution matching process (DM) may be formed by a preceding shell mapping process (SM) and a succeeding amplitude mapping process (AM), wherein said shell mapping process (SM) may be configured to form and output to said amplitude mapping process (AM) for each of said consecutive partial input symbol sequences (IBp) a sequence (sq) of a number of q shell indices (s), and wherein said amplitude mapping process (AM) may be configured to assign to each shell index (s) a tuple of amplitude values.

Abstract: The present invention relates to novel polypeptides with xylanase activity, especially xylanase variants, such as genetically engineered xylanase variants, which show improved thermostability, improved resistance against acid treatment and increased enzyme activity on arabinoxylan. The invention includes the use of said polypeptides in applications, such as for food or feed, for brewing or malting, for the treatment of xylan containing raw materials like grain-based materials, e.g. for the production of biofuels or other fermentation products, including biochemicals, and/or for the wheat gluten-starch separation industry, and methods using these polypeptides, as well as compositions (such as feed additive compositions) comprising said polypeptides.

Abstract: The present invention, among others, relates to a compound having a structure according to formula (I) or a pharmaceutically acceptable salt thereof, wherein Xaa1 are the iodo-substituted or methyl-substituted amino acids D- and L-Tyr, iodo-substituted or methyl- substituted D- and L-homotyrosine, iodo-substituted or methyl-substituted D- and L-Phe, iodo-substituted or methyl-substituted D- and L-p-OH-phenylglycine, and iodo-substituted or methyl-substituted D- or L-Trp, Xaa2 to Xaa4 are independently of each other, an optionally N-alkylated natural or unnatural amino acid, R is H or methyl, L is a linker moiety, Ar is a spacer comprising an aromatic moiety, and D comprises, preferably is i) a combination of an organic complexation agent and a radioactive or a detectable label; or ii) a radioactive or a detectable label, an organic complexation agent or an active substance, said active substance particularly being selected from cytotoxic agents, lipids, sugars, sugar conjugates, sugar derivatives, proteins an

Abstract: A mutant ?-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.

Abstract: A method for determining the joint positions of a kinematic chain uses only an imaging sensor and a computing unit. Characteristic features on the links and joints of the kinematic chain are identified and the joint positions are calculated from these visual measurements. The robot can be controlled without the use of joint encoders. A sensor system for monitoring the status of a kinematic chain includes a computing unit and an imaging sensor. The imaging sensor may be mounted to the kinematic chain or in the surroundings of the kinematic chain and monitors the kinematic chain and/or the surroundings of the kinematic chain. The computing unit determines a pose and/or movement parameters of at least one element of the kinematic chain by analyzing an output signal of the imaging sensor, in particular by analyzing characteristic features and determines a rotational joint position by analyzing the characteristic features.

Abstract: A system for precision polymerization is disclosed comprising at least one Michael-type monomer and a metal compound MR1R2R3 as sole catalyst and initiator, wherein M is aluminum, gallium or indium, each of R1, R2, and R3 independently is CI, F, I, Br, linear, branched or cyclic alkyl, heterocycloalkyl, linear, branched or cyclic alkenyl, heterocycloalkenyl, linear, branched, or cyclic alkenyl, linear, branched, or cyclic alkinyl, heterocycloalkinyl, linear, branched, or cyclic alkoxy, aryl, heteroaryl, aryloxy, silyl, metallocenyl, nitro, nitroso, hydroxy, or carboxyl, wherein each alkyl, alkenyl, alkinyl or alkoxy group independently has up to 12 carbon atoms, wherein each aryl or heteroaryl independently has 5 to 14 ring atoms, wherein any hetero group has at least one hetero atom selected from the group consisting of O, S, and N, wherein each alkyl, alkenyl, alkinyl or alkoxy, heterocycloalkyl, heterocycloalkenyl, heterocycloalkinyl, aryl, heteroaryl, aryloxy group can be substituted by 1 up to the highes

Abstract: The present invention relates to inhibitors of the interaction between H. pylori IIopQ and a member of the carcinoembryonic antigen-related cell adhesion molecule (CEACAM) family as well as to immunogenic compositions based on H. pylori HopQ. The present invention further relates to the use of the inhibitors and immunogenic compositions for preventing or treating a disease or disorder caused by or associated with H. pylori.

Abstract: The invention relates to a housing for a cell stack of a battery, comprising: an integral frame from accommodating the cell stack, wherein the frame surrounds at least three end faces of a cell stack which is accommodated in the housing, and at least one electrically conductive connecting element for establishing an electrical connection between an external connection and a cell stack which is accommodated in the housing is integrated in the frame; and a cover for covering sides, in particular all sides, of a cell stack which is received in the housing, which sides are not surrounded by the frame.

Abstract: The present invention relates to nanocrystalline cellulose, an efficient way of its preparation and to uses of such nanocrystalline cellulose. The present invention also relates to porous metal oxides having a chiral nematic structure which are prepared using nanocrystalline cellulose.

Abstract: A signal receiver for interpreting a received signal is provided, the receiver being configured to perform: decoding the received signal so as to form a sequence of symbols hypothesised to represent the content of the received signal; comparing the frequency of occurrence of symbols within the sequence with a predetermined symbol distribution; and if the relative frequency of occurrence of symbols within the sequence of symbols does not match the predetermined distribution, treating the sequence of symbols as being an incorrect representation of the content of the received signal.

Abstract: A device and a method for detecting deposits in a membrane module which produces a permeate and which comprises at least one permeable or semipermeable membrane layer. At least one polymer optical fiber for detecting deposits on the membrane layer is integrated in the membrane module such that the polymer optical fiber is in contact with at least one membrane layer. A method of detecting deposits in a membrane module producing a permeate and to a membrane module for producing a permeate from a feed stream of a fluid, in particular an aqueous solution, with the membrane module comprising a plurality of adjacently disposed or stacked sheets of a permeable or semipermeable membrane layer and with at least one polymer optical fiber being embedded or integrated in the membrane module, which polymer optical fiber is in contact with at least one sheet of the membrane layer.

Abstract: The present invention relates to a biosynthetic random coil polypeptide or a biosynthetic random coil polypeptide segment or biosynthetic conjugate, in which the biosynthetic random coil polypeptide, the biosynthetic random coil polypeptide segment, or the biosynthetic conjugate comprises an amino acid sequence consisting solely of proline and alanine amino acid residues, wherein the amino acid sequence consists of at least about 50 proline (Pro) and alanine (Ala) amino acid residues. The at least about 50 proline (Pro) and alanine (Ala) amino acid residues may be (a) fconstituent(s) of a heterologous polypeptide or an heterologous polypeptide construct. Also uses and methods of use of these biosynthetic random coil polypeptides or polypeptide segments or conjugates are described.

Abstract: The present invention relates to a method for preparing oligosaccharides which can be used among others as food additives to reduce calorie content, to sweeten food products, to increase the fiber content of food products, to improve the texture of food products and to stimulate the gut microbiome bacteria. Furthermore they can be applied in the fields of animal feed, or other applications. More particularly, this invention is directed to a high temperature hydrolysis of xyloglucan polysaccharide to defined xyloglucan oligosaccharides. The invention further relates to oligosaccharide hydrolysates produced with the method of the invention and to the use of said oligosaccharide hydrolysates in human and/or animal nutrition, as prebiotic or other uses. Further provided are novel endoglucanases for use in the method of the invention as well as in other applications.

Abstract: The present invention relates to immunogenic compositions and their use in the prevention or treatment of diseases or disorders caused by or associated with Helicobacter pylori, in particular H. pylori infection and gastroduodenal disorders caused by H. pylori. The present invention further relates to methods of detecting H. pylori infection in a subject.

Abstract: The invention relates to fusion polypeptides, nucleic acid molecules encoding said fusion polypeptides and genetically modified cells including said nucleic acid molecules. Moreover, the invention relates to a method for preparing target polypeptides using the fusion polypeptides.

Abstract: Methods (C) for converting a data signal (U), comprising processes of (i) providing an input symbol stream (IB) of input symbols (IBj), the input symbol stream (IB) being representative for the underlying data signal (U) to be converted, and (ii) applying a distribution matching process to consecutive partial input symbol sequences (IBk) of a number of k consecutive input symbols (IBj) covering said input symbol stream (IB). The distribution matching process (DM) generates and outputs a final output symbol stream (OB) of consecutive output symbols (OBj) or a preform thereof, wherein the distribution matching process (DM) is based on and/or comprises a family ((ƒi)i?{0, 1, . . . , n-1}) of a number (n) of distribution matching functions (ƒi), the action of the distribution matching process (DM) is achieved by acting with one of said distribution matching functions (ƒi) selected from said family ((ƒi)i?{0, 1, . . .

Abstract: A method (C) for converting a data signal (U). The method comprises processes of (i) providing an input bit stream (IB) of input bits (IBj), the input bit stream (IB) being representative for the underlying data signal (U) to be converted, and (ii) applying to consecutive disjunct partial input bit sequences (IBk) of a number of k consecutive input bits (IBj) covering said input bit stream (IB) a distribution matching process (DM) to generate and output a final output bit stream (OB) or a preform thereof. The distribution matching process (DM) is formed by a quadrant constellation shaping process (QS) and configured to map a respective partial input bit sequence (IBk) to a constellation point of a four-dimensional 24·m-QAM constellation—in particular conveying two distinct polarizations for each of an in-phase and a quadrature component—with I and m being fixed natural numbers and with k and m fulfilling the relation 4·m?k.

Abstract: The present invention relates to a method for the preparation of a food product comprising rye, which comprises the steps of preparing a primary food mixture; adding to said primary food mixture a composition comprising at least one glycoside hydrolase family 10 (GH10) enzyme; and processing said primary food mixture to produce said food product comprising rye. The invention further provides GH10 enzymes, compositions comprising said enzymes and the use of said enzymes and said composition in preparing food products.

Abstract: The present disclosure relates to a collection of novel muteins derived from human ?1m (or a1m) polypeptide or a functional homologue thereof. The disclosure further refers to a ?1m mutein capable of specifically binding to one or more targets other than a target to which wild-type ?1m binds. The disclosure also relates to a method for producing such collection of muteins and a method for isolating a mutein capable of binding one or more such non-natural targets of wild-type ?1m polypeptide. These aspects are made possible due to, e.g, the structural elucidation of ?1m disclosed herein by the present inventors, an appreciation of ligand-binding sights thereof and, hence, an understanding of which amino acid positions are most suitable for mutagenesis for re-engineering specificity and affinity for any given target while maintaining the secondary and/or tertiary structure of a1m.