Patents Assigned to University
  • Publication number: 20110080452
    Abstract: Apparatus for depositing ink on a substrate includes a nozzle defining an outlet for the ink, with at least a portion of the nozzle being electrically conductive. A first voltage source applies a first potential to the outlet nozzle. One or more auxiliary electrodes are located adjacent the outlet nozzle, and a second voltage source applies a second potential to the auxiliary electrodes. The apparatus includes a piezo-electric or thermal actuator for expelling ink from the nozzle towards a target zone on a substrate, the ink comprising a liquid vehicle and pigment particles dispersed in the vehicle. At least the pigment particles are electrically charged, typically due to the applied potentials. In one embodiment, an auxiliary electrode is disposed coaxially around the electrode formed by the nozzle. In another embodiment, an auxiliary electrode located beyond the nozzle, on a common axis with the electrode formed by the nozzle.
    Type: Application
    Filed: June 2, 2009
    Publication date: April 7, 2011
    Applicant: University of Cape Town
    Inventors: David Thomas Britton, Ekundare Ayodele Odo, Margit Harting
  • Publication number: 20110082143
    Abstract: Bicyclic heteroaryl compounds of formula (I) shown below are disclosed. Each variable in formula (I) is defined in the specification. Also disclosed is treatment of cancer with these compounds.
    Type: Application
    Filed: October 1, 2010
    Publication date: April 7, 2011
    Applicant: National Taiwan University
    Inventors: Chung-Ming Sun, Min-Liang Kuo
  • Publication number: 20110082578
    Abstract: A process and system for fitting, customizing and manufacturing an orthosis for a subject. 3-dimensional coordinates for a plurality of landmarks corresponding to anatomical characteristics of the subject, means for attachment of the orthosis to the subject, and a reference plane are digitally acquired. Then, coordinates of one or more virtual landmarks corresponding to one or more anatomical joint centers or joint projection locations are calculated. The landmarks are clinically aligned in a reference position of one of the anatomical joint centers and a customized digital model of the orthosis is created using the clinically aligned landmarks. Finally, the orthosis is fabricated using a computer aided manufacturing process, based upon an output from the customized digital model.
    Type: Application
    Filed: September 10, 2010
    Publication date: April 7, 2011
    Applicant: University of Delaware
    Inventors: Steven J. Stanhope, Elisa Schrank
  • Publication number: 20110081663
    Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.
    Type: Application
    Filed: September 29, 2010
    Publication date: April 7, 2011
    Applicants: Kyoto University, ARKRAY, Inc.
    Inventors: Hideo Saji, Nobuya Inagaki, Kentaro Toyoda, Hiroyuki Kimura, Konomu Hirao, Kenji Nagakawa, Hirokazu Matsuda
  • Publication number: 20110082876
    Abstract: A computer system capable of providing assistance in the preparation of a patent application is provided. The computer system includes a database group. The database group includes a case database for storing a case file. The case database includes a drawing data storage for storing at least one drawing of an embodiment of an invention that is the subject of a patent application and that corresponds to the case file. The at least one drawing includes at least one component reference numeral. The case database further includes a component description data storage for storing component-descriptive text of at least one component of the embodiment that corresponds to the case file, the at least one component corresponding to the at least one component reference numeral included in the at least one drawing stored in the drawing data storage.
    Type: Application
    Filed: April 19, 2010
    Publication date: April 7, 2011
    Applicant: National Taiwan University
    Inventors: Shey-Shi Lu, Chih-Kung Lee, Hung-Wei Chiu, Yung-Chin Wang
  • Publication number: 20110081356
    Abstract: The present invention is directed to an anti-cancer drug containing an anti-MFG-E8 antibody as an active ingredient, and to an anti-cancer drug which employs an anti-MFG-E8 antibody in combination with a cancer therapy employing an anti-cancer agent other than the anti-MFG-E8 antibody.
    Type: Application
    Filed: April 28, 2009
    Publication date: April 7, 2011
    Applicant: The University of Tokyo
    Inventors: Hideaki Tahara, Masahisa Jinushi
  • Publication number: 20110079770
    Abstract: The invented ink-jet printing method for the construction of thin film transistors using all SWNTs on flexible plastic films is a new process. This method is more practical than all of exiting printing methods in the construction TFT and RFID tags because SWNTs have superior properties of both electrical and mechanical over organic conducting oligomers and polymers which often used for TFT. Furthermore, this method can be applied on thin films such as paper and plastic films while silicon based techniques can not used on such flexible films. These are superior to the traditional conducting polymers used in printable devices since they need no dopant and they are more stable. They could be used in conjunction with conducting polymers, or as stand-alone inks.
    Type: Application
    Filed: September 14, 2010
    Publication date: April 7, 2011
    Applicant: William Marsh Rice University
    Inventors: Gyou-Jin Cho, Min Hun Jung, Jared L. Hudson, James M. Tour
  • Publication number: 20110080273
    Abstract: There are provided a sensation presenting system and a sensation presenting device which allow a user to perceive a desired tactual stimulation based on a virtual bodily pseudo image recognized through a visual sensation.
    Type: Application
    Filed: June 12, 2009
    Publication date: April 7, 2011
    Applicant: Waseda University
    Inventors: Takashi Kawai, Hiroyuki Morikawa
  • Publication number: 20110081625
    Abstract: A denture is adapted to communicate with a radio frequency identification (RFID) reader. The denture includes a denture main body and at least one RFID tag embedded in the denture main body for storage of identification information of a user of the denture. The RFID tag transmits the information to the RFID reader by radio frequency wave.
    Type: Application
    Filed: October 6, 2009
    Publication date: April 7, 2011
    Applicant: China Medical University
    Inventor: Lih-Jyh Fuh
  • Publication number: 20110082072
    Abstract: In one aspect the present invention provides methods for inhibiting cell death or inflammation in a mammal, wherein the methods each include the step of administering to a mammal a Bcl protein in an amount sufficient to inhibit cell death or inflammation in the mammal. The invention also provides methods for identifying a Bcl protein that inhibits cell death or inflammation when administered to a mammal.
    Type: Application
    Filed: October 4, 2005
    Publication date: April 7, 2011
    Applicant: University of Washington
    Inventors: John M. Harlan, Robert K. Winn, Akiko Iwata, Joan Tupper, John Li
  • Publication number: 20110082295
    Abstract: To develop a highly safe measure to treat Alzheimer's disease using a secretase-inhibiting substance, there is provided a compound represented by the following general formula (I) or a salt thereof: wherein A represents a phenyl group or the like, R1 represents a chlorine atom, a bromine atom, or a nitro group or the like, R2, R3, R4, and R5 each represent a hydrogen atom or the like, and L represents CH2—CH2 or CH?CH.
    Type: Application
    Filed: May 27, 2009
    Publication date: April 7, 2011
    Applicants: Tokyo Institute of Technology, Kyoto University
    Inventors: Hachiro Sugimoto, Takashi Takahashi, Ichiro Hijikuro, Michiaki Okuda
  • Publication number: 20110081427
    Abstract: Administration of an HNO/NO? donating compound, such as Angeli's salt, increases myocardial contractility while concomitantly lowering left ventricular preload in subjects experiencing heart failure. Moreover, administration of the HNO/NO? donating compound isopropylamine (IPA)/NO (Na(CH3)2CHNHN(O)NO) surprisingly exhibited positive inotropic effects in subjects experiencing heart failure that were superior to those caused by the HNO/NO? donating compound Angeli's salt. Additionally, in contrast to the effects observed with NO? donors, administration of an HNO/NO? donor in combination with a positive inotropic agent did not impair the positive inotropic effect of the positive inotropic agent. Further, HNO/NO? exerts its positive inotropic effect independent of the adrenergic system, increasing contractility even in subjects receiving beta-antagonist therapy.
    Type: Application
    Filed: November 18, 2010
    Publication date: April 7, 2011
    Applicants: The Government of the U.S.A. as represented by the Secretary of the Dept. of Health and Human Servic, The Board of Supervisors of Louisiana State University and Agricultural and Mechanical College, The Regents of the University of California, Johns Hopkins University
    Inventors: David A. Wink, Martin Feelisch, David A. Kass, Nazareno Paolocci, Katrina Miranda, Jon Fukuto, Tatsuo Katori
  • Publication number: 20110082188
    Abstract: The present invention relates to methods for identifying and/or classifying patients with inflammatory bowel diseases (IBD), particularly patients with Crohn's disease or ulcerative colitis. Gene expression profiling shows broad and fundamental differences in the pathogenic mechanism of UC and CD. The subject method is based on the findings that certain genes are differentially expressed in intestinal tissue of IBD patients compared with related normal cells, such as normal colon cells. That change can be used to identify or classify IBD cells by the upregulation and/or downregulation of expression of particular genes, alterations in protein levels or modification, or changes at the genomic level (such as mutation, methylation, etc), e.g., an event which is implicated in the pathology of inflammatory bowel diseases.
    Type: Application
    Filed: October 4, 2010
    Publication date: April 7, 2011
    Applicant: Case Western Reserve University
    Inventor: Shukti Chakravarti
  • Patent number: 7920993
    Abstract: The present invention relates to methods for achieving an optimal function of a biochemical reaction network. The methods can be performed in silico using a reconstruction of a biochemical reaction network of a cell and iterative optimization procedures. The methods can further include laboratory culturing steps to confirm and possibly expand the determinations made using the in silico methods, and to produce a cultured cell, or population of cells, with optimal functions. The current invention includes computer systems and computer products including computer-readable program code for performing the in silico steps of the invention.
    Type: Grant
    Filed: September 22, 2006
    Date of Patent: April 5, 2011
    Assignee: The Regents of the University of California
    Inventors: Bernhard O. Palsson, Jeremy S. Edwards
  • Patent number: 7919601
    Abstract: This invention provides: 1) methods for the identification of broad-spectrum holins with a high level of nonenzymatic activity in membranes; 2) conditions required for maintaining and increasing the anti-microbial and anti-pest efficacy of holins in gene fusions; 3) a method for effective targeting of holins expressed in plants through use of a leader peptide to direct the holin protein to the plant apoplast and xylem; 4) methods for the control of bacterial and fungal diseases of plants and control of insect and nematode pests that attack plants by expression of gene fusions involving holins, C-terminal additions and leader peptides, and optionally, endolysins; 5) methods for increasing the shelf-life of cut flowers, and 6) transgenic plants useful for the production of novel antimicrobial proteins based upon holins.
    Type: Grant
    Filed: May 14, 2004
    Date of Patent: April 5, 2011
    Assignees: Integrated Plant Genetics, Inc., University of Florida Research Foundation
    Inventors: Chandrika Ramadugu, Dean William Gabriel
  • Patent number: 7920267
    Abstract: An integrated optical waveguide type surface plasmon resonance (SPR) sensor having an optical waveguide with a corresponding SPR sensing area, photodetectors, and wavelength tunable laser or any kind of external tunable laser source/coupler formed on a substrate. In an embodiment, the laser is a wavelength tunable laser and optionally, the integrated device may include a power source on the substrate for providing a electric power to the wavelength tunable laser and the photodetectors, or a circuit for signal processing, or a microfluidic structure for routing a target sample to the SPR sensor area. The microfluidic structure optionally includes a mixer or a reaction chamber for mixing and allowing a physical or chemical reaction to occur, respectively. In an embodiment, plural planar integrated optical waveguide type SPR sensors may be fabricated on a substrate to form an array of SPR sensors.
    Type: Grant
    Filed: January 15, 2009
    Date of Patent: April 5, 2011
    Assignee: University of Central Florida Research Foundation, Inc.
    Inventors: Hyoung Jin Cho, Hyungseok Bang, Patrick Li Kam Wa
  • Patent number: 7920409
    Abstract: A Static Random Access Memory (SRAM) cell having high stability and low leakage is provided. The SRAM cell includes a pair of cross-coupled inverters providing differential storage of a data bit. Power to the SRAM cell is provided by a read word line (RWL) signal, which is also referred to herein as a read control signal. During read operations, the RWL signal is pulled to a voltage level that forces the SRAM cell to a full-voltage state. During standby, the RWL signal is pulled to a voltage level that forces the SRAM cell to a voltage collapsed state in order to reduce leakage current, or leakage power, of the SRAM cell. A read-transistor providing access to the bit stored by the SRAM cell is coupled to the SRAM cell via a gate of the read transistor, thereby decoupling the stability of the SRAM cell from the read operation.
    Type: Grant
    Filed: June 5, 2007
    Date of Patent: April 5, 2011
    Assignee: Arizona Board of Regents for and on behalf of Arizona State University
    Inventors: Lawrence T. Clark, Sayeed Ahmed Badrudduza
  • Patent number: 7919069
    Abstract: Provided herein is a hydrothermal process for the rapid synthesis of inorganic nanomaterials (e.g., nanofibers) containing sodium, bismuth, titanium, and oxygen, as well as new compositions made thereby. The process involves heating an aqueous solution or suspension of suitable salts of aforementioned elements at elevated temperature and pressure under constant stirring in a hermetically sealed vessel for a predetermined amount of time (e.g., less than two hours). The powder thus obtained contains nanofibers of rectangular cross-section, with the smallest fibers typically have a cross section of 16 nm×40 nm. Example fibers made by such processes have an aspect ratio exceeding 200.
    Type: Grant
    Filed: June 13, 2008
    Date of Patent: April 5, 2011
    Assignee: Lehigh University
    Inventor: Animesh Kundu
  • Patent number: 7919079
    Abstract: Cellular compositions and methods for inducing an immune response to tumor cells are described. The cellular compositions include a tumor antigen and cells that have been modified to express a cytokine and one or more of a tumor antigen, anti-CTLA4 antibody and an additional cytokine. The cellular compositions find utility in methods for treating cancer.
    Type: Grant
    Filed: March 28, 2007
    Date of Patent: April 5, 2011
    Assignees: BioSante Pharmaceuticals, Inc., The Regents of the University of California
    Inventors: Andrew Simmons, Karin Jooss, James Allison
  • Patent number: 7919094
    Abstract: In one aspect, the invention provides methods of inhibiting the effects of MASP-2-dependent complement activation in a living subject. The methods comprise the step of administering, to a subject in need thereof, an amount of a MASP-2 inhibitory agent effective to inhibit MASP-2-dependent complement activation. In some embodiments, the MASP-2 inhibitory agent inhibits cellular injury associated with MASP-2-mediated alternative complement pathway activation, while leaving the classical (C1q-dependent) pathway component of the immune system intact. In another aspect, the invention provides compositions for inhibiting the effects of lectin-dependent complement activation, comprising a therapeutically effective amount of a MASP-2 inhibitory agent and a pharmaceutically acceptable carrier.
    Type: Grant
    Filed: December 22, 2006
    Date of Patent: April 5, 2011
    Assignees: Omeros Corporation, University of Leicester
    Inventors: Hans-Wilhelm Schwaeble, Cordula Margaret Stover, Clark E Tedford, James B Parent, Teizo Fujita