Chimeric flavivirus vectors
The invention provides chimeric flavivirus vectors including foreign peptides inserted into the envelope proteins of the vectors and methods of using these vectors.
Latest Sanofi Pasteur Biologics Co. Patents:
This application is a continuation of U.S. Ser. No. 10/160,939, filed May 31, 2002 (pending), which claims benefit of U.S. Provisional Application No. 60/295,265, filed Jun. 1, 2001.
BACKGROUND OF THE INVENTIONThis invention relates to chimeric flavivirus vectors and methods employing these vectors.
Flaviviruses are small, enveloped positive-strand RNA viruses. Flavivirus proteins are produced by translation of a single, long open reading frame to generate a polyprotein, which is followed by a complex series of post-translational proteolytic cleavages of the polyprotein by a combination of host and viral proteases to generate mature viral proteins (Amberg et al., J. Virol. 73:8083-8094, 1999; Rice, “Flaviviridae,” In Virology, Fields (ed.), Raven-Lippincott, New York, 1995, Volume I, p. 937). The virus structural proteins are arranged in the polyprotein in the order C-prM-E, where “C” is capsid, “prM” is a precursor of the viral envelope-bound M protein, and “E” is the envelope protein. These proteins are present in the N-terminal region of the polyprotein, while the non-structural proteins (NS1, NS2A, NS2B, NS3, NS4A, NS4B, and NS5) are located in the C-terminal region of the polyprotein.
A chimeric flavivirus that includes the C and non-structural proteins of the Yellow fever virus vaccine strain (YF 17D) and the prM and E proteins of a strain of attenuated Japanese encephalitis virus (SA 14-14-2) has been made. This chimera, designated ChimeriVax™-JE, has been shown to induce the production of neutralizing antibodies against JE in immunized rhesus monkeys, as well as to protect these monkeys from clinical encephalitis after JE challenge, as compared with unimmunized controls. ChimeriVax™-JE was shown to meet preclinical safety requirements for a human vaccine (Monath et al., J. Virol. 74(4):1742-1751, 2000).
A similar chimera was made that includes the C and non-structural proteins of YF 17D and the prM and E proteins of a Dengue-2 strain. This chimera, designated ChimeriVax-D2, was shown to induce neutralizing antibodies against Dengue-2 virus in rhesus monkeys, as well as to protect these monkeys from viremia after Dengue-2 challenge, as compared with unimmunized controls. ChimeriVax-D2 also was shown to be safe and genetically stable (Guirakhoo et al., J. Virol. 74(12):5477-5485, 2000).
SUMMARY OF THE INVENTIONThe invention provides methods for identifying sites in the envelope proteins of chimeric flaviviruses or genetically attenuated flaviviruses that are permissive for insertion of foreign peptides. These methods include the steps of: (i) introducing a nucleic acid molecule encoding a foreign peptide into a gene encoding a flavivirus envelope protein; (ii) generating a flavivirus vector including an envelope protein encoded by the gene, wherein the envelope protein contains the foreign peptide; and (iii) determining whether the flavivirus vector generated in step (ii) is permissive for the insertion.
The flavivirus vectors can be chimeric flavivirus vectors that include, for example, the C and non-structural proteins of a first flavivirus and the prM and E proteins of a second flavivirus. The first and second flaviviruses can be selected from the group consisting of Japanese encephalitis, Dengue (serotype 1, 2, 3, or 4), Yellow fever (e.g., YF 17D), Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, Ilheus, ticke-borne encephalitis, Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses.
The foreign peptides inserted into the vectors of the invention can include epitopes derived from, for example, antigens of viral, bacterial, or parasitic pathogens, or can include epitopes derived from tumor-associated antigens. Examples of these peptides and others are provided below.
The nucleic acid molecules can be introduced into the envelope genes of the flaviviruses, according to the methods of the invention, for example, randomly by transposon mutagenesis. Also, determination of whether the flavivirus vectors generated in step (ii) of the methods of the invention are permissive for the insertion can be carried out, for example, by analysis of (a) the infectivity of the flavivirus vectors, (b) the stability of the sequence of the foreign protein upon multiple passages of the vectors, (c) the growth properties of the flavivirus vectors, and/or (d) whether the flavivirus vectors can be neutralized with antibodies against the envelope protein of the first flavivirus. The methods of the invention can further include comparing the analysis of the flavivirus vectors with a similar analysis of the flavivirus from which it was derived.
The invention also includes flavivirus vectors that include envelope proteins that contain foreign peptides. The flavivirus vectors can be chimeric flaviviruses including the prM and E proteins of a first flavivirus and the C and non-structural proteins of a second flavivirus. The first and second flaviviruses can be selected from the group consisting of Japanese encephalitis, Dengue (serotype 1, 2, 3, or 4), Yellow fever (e.g., YF 17D), Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, Ilheus, ticke-borne encephalitis, Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses. The flavivirus vectors can, alternatively, be a genetically attenuated flavivirus, such as Yellow Fever YF 17D.
The foreign peptides inserted into the vectors can include epitopes derived from antigens of viral, bacterial, or parasitic pathogens. Alternatively, the foreign peptides can include epitopes derived from tumor-associated antigens.
Also included in the invention are pharmaceutical compositions that include the flavivirus vectors described above and pharmaceutically acceptable carriers or diluents, as well as methods of delivering peptides to patients by administering to the patients such compositions. These methods can be carried out, for example, when the peptides are antigens, to induce an immune response to pathogens or tumors from which the antigens are derived.
The invention also includes nucleic acid molecules that include the genomes of the flaviviruses described above or the complements thereof.
The invention provides several advantages. For example, chimeric flavivirus vectors that can be used in the invention are sufficiently attenuated so as to be safe, and yet are able to induce protective immunity to the flaviviruses from which the envelope proteins in the chimeras are derived and, in particular, the epitopes inserted into the chimeras. Additional safety comes from the fact that the vectors used in the invention are chimeric, thus eliminating the possibility of reversion to wild type. An additional advantage of the vectors used in the invention is that flaviviruses replicate in the cytoplasm of cells, so that the virus replication strategy does not involve integration of the viral genome into the host cell, providing an important safety measure. In addition, as is discussed further below, a single vector of the invention can be used to deliver multiple epitopes from a single antigen, or epitopes derived from more than one antigen.
Other features and advantages of the invention will be apparent from the following detailed description, the drawings, and the claims.
The invention provides methods of identifying sites in the envelope proteins of chimeric flaviviruses or genetically attenuated flaviviruses (e.g., YF 17D) into which foreign peptides can be introduced, chimeric flavivirus vectors having envelope proteins that include such peptides, and methods of delivering these peptides by administration of the vectors in order to, for example, induce an immune response to a pathogen from which an introduced peptide is derived. Details of these vectors, peptides, and methods are provided below.
Chimeric Flavivirus VectorsChimeric viruses that can be used in the invention consist of a first flavivirus (i.e., a backbone flavivirus) in which a structural protein (or proteins) has been replaced with a corresponding structural protein (or proteins) of a second virus. For example, the chimeras can consist of a first flavivirus in which the prM and E proteins have been replaced with the prM and E proteins of a second virus.
The chimeric viruses that are used in the invention can be made from any combination of viruses. Examples of particular flaviviruses that can be used in the invention, as first or second viruses, include mosquito-borne flaviviruses, such as Japanese encephalitis, Dengue (serotypes 1-4), Yellow fever, Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, and Ilheus viruses; tick-borne flaviviruses, such as Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses; as well as viruses from the Hepacivirus genus (e.g., Hepatitis C virus).
Details of making chimeric viruses that can be used in the invention are provided, for example, in U.S. patent application Ser. Nos. 09/007,664, 09/121,587, and 09/452,638; International applications PCT/US98/03894 and PCT/US00/32821; and Chambers et al., J. Virol. 73:3095-3101, 1999, each of which is incorporated by reference herein in its entirety.
A specific example of a type of chimeric virus that can be used in the invention is the yellow fever human vaccine strain, YF 17D, in which the prM and E proteins have been replaced with prM and E proteins of another flavivirus, such as Japanese encephalitis virus, West Nile virus, St. Louis encephalitis virus, Murray Valley encephalitis virus, a Dengue virus, or any other flavivirus, such as one of those listed above. For example, the following chimeric flaviviruses, which were deposited with the American Type Culture Collection (ATCC) in Manassas, Va., U.S.A. under the terms of the Budapest Treaty and granted a deposit date of Jan. 6, 1998, can be used in the invention: Chimeric Yellow Fever 17D/Japanese Encephalitis SA14-14-2 Virus (YF/JE A1.3; ATCC accession number ATCC VR-2594) and Chimeric Yellow Fever 17D/Dengue Type 2 Virus (YF/DEN-2; ATCC accession number ATCC VR-2593).
Methods for Identifying Permissive Sites in Chimeric Flavivirus Envelope ProteinsSites in chimeric flavivirus envelope proteins that are permissive to insertion of foreign sequences can be identified as follows. Nucleic acid sequences encoding a peptide are inserted into the envelope gene using standard methods of molecular biology. Preferably, such nucleic acid sequences are randomly inserted into the envelope gene, to facilitate the creation of a library of insertion mutants. However, a nucleic acid sequence can, alternatively, be inserted a specific point in an envelope gene and tested for efficacy. The latter approach may be desirable, for example, when a particular site has been identified as being permissive for insertion of a first foreign sequence and it is desired to confirm that it is also permissive for insertion of a second sequence that may, for example, differ in length or predicted secondary structure from the first foreign sequence.
Random insertion of nucleic acid sequences can be achieved, for example, by the use of a transposon mutagenesis approach. For example, a Tn5 transposition system can be used (Goryshin et al., J. Biol. Chem. 273:7367, 1998). As a specific example, the EZ::TN Insertion System, which is manufactured by Epicentre Technologies (Madison, Wis., U.S.A.), can be used. Details of the use of this system in the invention are provided further below. In summary, a cloned flavivirus envelope gene is subjected to mutagenesis with transposons that include sequences that encode peptides. A library of mutants that include randomly integrated transposons in flavivirus envelope genes is generated and, if desired, the insertion sites are mapped and/or sequenced. Full length genomic RNA that includes mutant envelope genes is then generated and used to make mutant viruses, which are then characterized for permissiveness to insertion of the transposons. The viruses can be analyzed for permissiveness by, for example, determination of infectivity, genomic stability, growth properties, and neutralization. Details of the use of this transposon mutagenesis system are provided below, in the context of the chimeric flavivirus ChimeriVax™-JE (also see
The vectors of the invention can be used in the delivery of any peptide or protein of prophylactic or therapeutic value. For example, the vectors of the invention can be used in the induction of an immune response (prophylactic or therapeutic) to any protein-based antigen that is inserted into a chimeric flavivirus envelope protein. Preferably, such an antigen not derived from the second flavivirus of the chimera. All that is required is that a nucleic acid sequence encoding the antigen be inserted at a permissive site within the envelope gene of a chimeric flavivirus, as described herein. Standard methods of molecular biology can be used to insert the antigen-coding nucleic acid molecules into chimera envelope genes, at permissive sites, which are identified as is described elsewhere herein.
The vectors of the invention can each include a single epitope. Alternatively, multiple epitopes can be inserted into the vectors, either at a single site (i.e., as a polytope, in which the different epitopes can be separated by a flexible linker, such as a polyglycine stretch of amino acids), at different sites, or in any combination thereof. The different epitopes can be derived from a single species of pathogen, or can be derived from different species and/or different genuses.
Antigens that can be used in the invention can be derived from, for example, infectious agents such as viruses, bacteria, and parasites. For example, antigens from the pathogens listed in Table 2, below, can be used. Specific examples of such antigens include those listed in Table 3. In addition, specific examples of epitopes that can be inserted into the vectors of the invention are provided in Table 4. As is noted in Table 4, epitopes that are used in the vectors of the invention can be B cell epitopes (i.e., neutralizing epitopes) or T cell epitopes (i.e., T helper and cytotoxic T cell-specific epitopes).
The vectors of the invention can be used to deliver antigens in addition to pathogen-derived antigens. For example, the vectors of the invention can be used to deliver tumor-associated antigens for use in immunotherapeutic methods against cancer. Numerous tumor-associated antigens are known in the art and can be used in the invention. Examples of cancers (and corresponding tumor associated antigens) are as follows: melanoma (NY-ESO-1 protein (specifically CTL epitope located at amino acid positions 157-165), CAMEL, MART 1, gp100, tyrosine-related proteins TRP1 and 2, and MUC1)); adenocarcinoma (ErbB2 protein); colorectal cancer (17-1A, 791Tgp72, and carcinoembryonic antigen); prostate cancer (PSA1 and PSA3). Heat shock protein (hsp110) can also be used as such an antigen.
In another embodiment of the invention, exogenous proteins that encode an epitope(s) of an allergy-inducing antigen to which an immune response is desired may be used. In addition, the vectors of the invention can include ligands that are used to target the vectors to deliver peptides, such as antigens, to particular cells (e.g., cells that include receptors for the ligands) in subjects to whom the vectors administered.
The size of the peptide or protein that is inserted into the vectors of the invention can range in length from, for example, from 5-500 amino acids in length, for example, from 10-100, 20-55, 25-45, or 35-40 amino acids in length. The feasibility of using any particular desired peptide can easily be determined using the methods described herein.
Use of Chimeric Flavivirus Vectors to Deliver Foreign PeptidesThe vectors of the invention are administered in amounts and by using methods that can readily be determined by persons of ordinary skill in this art. The vectors can be administered and formulated, for example, in the same manner as the yellow fever 17D vaccine, e.g., as a clarified suspension of infected chicken embryo tissue, or a fluid harvested from cell cultures infected with the chimeric yellow fever virus. Thus, the vectors of the invention can be formulated as sterile aqueous solutions containing between 100 and 1,000,000 infectious units (e.g., plaque-forming units or tissue culture infectious doses) in a dose volume of 0.1 to 1.0 ml, to be administered by, for example, intramuscular, subcutaneous, or intradermal routes. In addition, because flaviviruses may be capable of infecting the human host via the mucosal routes, such as the oral route (Gresikova et al., “Tick-borne Encephalitis,” In The Arboviruses, Ecology and Epidemiology, Monath (ed.), CRC Press, Boca Raton, Fla., 1988, Volume IV, 177-203), the vectors can be administered by a mucosal route.
When used in immunization methods, the vectors can be administered as a primary prophylactic agent in adults or children at risk of infection by a particular pathogen. The vectors can also be used as secondary agents for treating infected patients by stimulating an immune response against the pathogen from which the peptide antigen is derived.
For vaccine applications, adjuvants that are known to those skilled in the art can be used. Adjuvants that can be used to enhance the immunogenicity of the chimeric vectors include, for example, liposomal formulations, synthetic adjuvants, such as (e.g., QS21), muramyl dipeptide, monophosphoryl lipid A, or polyphosphazine. Although these adjuvants are typically used to enhance immune responses to inactivated vaccines, they can also be used with live vaccines. In the case of a chimeric vector delivered via a mucosal route, for example, orally, mucosal adjuvants such as the heat-labile toxin of E. coli (LT) or mutant derivations of LT can be used as adjuvants. In addition, genes encoding cytokines that have adjuvant activities can be inserted into the vectors. Thus, genes encoding cytokines, such as GM-CSF, IL-2, IL-12, IL-13, or IL-5, can be inserted together with foreign antigen genes to produce a vaccine that results in enhanced immune responses, or to modulate immunity directed more specifically towards cellular, humoral, or mucosal responses.
In addition to vaccine applications, as one skilled in the art can readily understand, the vectors of the invention can be used in gene therapy methods to introduce therapeutic gene products into a patient's cells and in cancer therapy. In these methods, genes encoding therapeutic gene products are inserted into permissive sites in the vectors.
ExampleThe following experimental example shows the identification of permissive sites in ChimeriVax™-JE. The methods described in this example can be used with other chimeric flaviviruses, such as those described above, as well.
The Yellow fever 17D (YF 17D) live attenuated vaccine strain has been used in humans for the past 60 years, has an excellent safety record, and provides long-lasting immunity after administration of a single dose. As is noted above, ChimeriVax™-JE is a live, attenuated recombinant vaccine strain in which the genes encoding the structural proteins (PrME) of YF 17D have been replaced with the corresponding genes from the genetically attenuated Japanese encephalitis (JE) virus SA14-14-2. Both capsid and all nonstructural (NS) genes responsible for intracellular replication of this chimera are derived from the YF 17D vaccine strain. As is noted above, an infectious molecular clone of ChimeriVax™-JE (YF/JE) has previously been described. In the experiments described below, ChimeriVax™-JE was evaluated as to its suitability as a delivery vehicle for biologically relevant peptides.
The EZ::TN In-Frame Linker Insertion Kit© (Epicentre) is a fast and efficient method for randomly inserting 19 amino acid peptides in-frame into proteins encoded by cloned DNA for a variety of applications. Using this approach, we have chosen to identify sites within the envelope gene of ChimeriVax™-JE that are permissive to foreign DNA. As is discussed in further detail below, random mutagenesis in E. coli of the gene encoding the JE envelope protein with EZ::TN identified a bank of stable insertion mutants that carried the 57 basepairs fragment that encodes the 19 amino acid peptide. DNA sequence analysis, restriction mapping, and PCR studies confirmed both the exact location of the transposon and the random nature of insertion. Engineering the mutated JE envelope gene back into the ChimeriVax™-JE infectious clone has allowed us to study infection in cell culture and provide valuable information on the use of recombinant flaviviruses as delivery vehicles for foreign antigens. We identified a panel of mutant clones infectious for Vero cells and characterized their biological properties. Specifically, we compared the growth properties of stable infectious clones to the parental ChimeriVax™-JE chimera in cell culture, as well as their ability to be neutralized in a plaque reduction neutralization test (PRNT) with JE-specific polyclonal antisera. We identified sites within the JE envelope that are permissive to insertion of foreign DNA, and these sites can be exploited for delivery of biologically relevant epitopes. Further details are provided as follows.
Cloning of the Gene Encoding the JE Envelope into pUC19
YF/JE viral RNA was extracted from infected Vero cells using Trizol reagent (Gibco BRL). Following cDNA synthesis with the FNOR antisense primer (see below), the gene encoding the JE SA14-14-2 envelope was amplified by XL-PCR with TN1.F/TN2.R primers (see below), and directionally cloned by conventional methods into pUC19 (New England Biologicals, NEB, U.S.A.) using KpnI and PstI recognition sequences incorporated at the 5′ ends of each oligonucleotide, generating pJEe1. PCR was carried out using a GeneAmp PCR System 2400 (Perkin Elmer).
Transposon Mutagenesis and Mapping of Insertion SitesInsertion mutagenesis was performed on pJEe1 using the EZ::TN™ In-Frame Linker Insertion Kit (EPICENTRE Technologies, U.S.A.), according to manufacturer's instructions. The EZ::TN <NotI/Kan-3> transposon contains a kanamycin resistance gene flanked by Not I restriction sites. As is discussed further below, removal of the kanamycin resistance gene following NotI digestion and re-ligation generates a 19 codon insertion that can be read in all three reading frames.
Insertion mutants were identified in E. coli by selection on LB agar plus kanamycin (50 μg/ml). PCR with TN1.F/TN2.R on select kanamycin-resistant clones following transposition revealed that 40% of clones stably maintained the transposon in the JE envelope (
The amino acid sequences of five mutant clones that were selected for transfection of Vero cells is shown in
The antibiotic resistance marker was removed from stable E. coli clones, which were then re-ligated, leaving a 57 basepair in-frame insertion that included a 9-basepair target site sequence duplication that flanks the transposon. Sample clones (n=5) containing re-ligated JE envelope were then digested with NheI/NarI (NEB, U.S.A.), to be compatible for cloning into a two plasmid system previously described for generating full length YF/JE genomes (Chambers et al., 1999, supra).
Transcription and TransfectionTranscription of linearized, full length genomic DNA harboring foreign DNA in the gene encoding the JE envelope was performed from the SP6 promoter using the AmpliScribe™ SP6 High Yield Transcription Kit (EPICENTRE Technologies). Six well plates seeded with Vero cells were transfected with in vitro transcribed genomic RNA in the presence of LIPOFECTIN Reagent (Life Techhologies) and maintained in MEM (Life Technologies) supplemented with 5% FBS (Hyclone), NEAA (Life Technologies), and 1% Penicillin-Streptomycin (Sigma Chemicals). Cell supernatants (500 mL) were passaged to fresh cells every 6 days through P6, and the monolayer was monitored for cytopathic effects (CPE). Viral RNA was extracted from the cell monolayer and supernatant at each passage.
As is shown in
The DNA sequence of RT PCR products from P2 through P6 was determined and, as is shown in
The biological properties of transposon mutant I-10 were determined and compared with those of ChimeriVax™-JE. First, the growth properties of clone I-10 were determined. As is shown in
Plaque reduction neutralization (PRNT) assays were then carried out. A preparation of anti-JE polyclonal antisera was shown to neutralize clone I-10 and ChimeriVax™-JE to the same degree (1:64,000), confirming the feasibility of inserting foreign DNA into the envelope of the JE chimera without unduly affecting the structural integrity of the viral envelope (
Claims
1. A method for identifying a site in the envelope protein of a chimeric flavivirus or a genetically attenuated flavivirus that is permissive for insertion of a foreign peptide of a Hepatitis C virus, a Hepatitis B virus, a Hepatitis A virus, or an Influenza virus, said method comprising the steps of:
- (i) introducing a nucleic acid molecule encoding said foreign peptide into a gene encoding a flavivirus envelope protein;
- (ii) generating a flavivirus vector comprising an envelope protein encoded by said gene, wherein said envelope protein comprises said foreign peptide; and
- (iii) determining whether the flavivirus vector generated in step (ii) is permissive for said insertion.
2. The method of claim 1, wherein said flavivirus vector is a chimeric flavivirus vector comprising a first flavivirus in which a structural protein or proteins has been replaced with a corresponding structural protein or proteins of a second flavivirus.
3. The method of claim 2, wherein said first flavivirus is selected from the group consisting of Japanese encephalitis, Dengue-1, Dengue-2, Dengue-3, Dengue-4, Yellow fever, Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, Ilheus, ticke-borne encephalitis, Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses.
4. The method of claim 3, wherein said first flavivirus is Yellow fever virus.
5. The method of claim 2, wherein said second flavivirus is selected from the group consisting of Japanese encephalitis, Dengue-1, Dengue-2, Dengue-3, Dengue-4, Yellow fever, Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, Ilheus, ticke-borne encephalitis, Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses.
6. The method of claim 5, wherein said second flavivirus is Japanese encephalitis virus.
7. The method of claim 2, wherein the structural proteins of the first flavivirus that have been replaced with the corresponding structural proteins of the second flavivirus are membrane and envelope proteins.
8. (canceled)
9. The method of claim 1, wherein said nucleic acid molecule is introduced into said envelope gene randomly by transposon mutagenesis.
10. The method of claim 1, wherein determination of whether said flavivirus vector generated in step (ii) is permissive for said insertion is carried out by analysis of (a) the infectivity of said flavivirus vector, (b) the stability of the sequence of said foreign peptide upon multiple passages of the vector, (c) the growth properties of said flavivirus vector, or (d) whether the flavivirus vector can be neutralized with antibodies against the envelope protein of said first flavivirus.
11. The method of claim 10, further comprising comparing the analysis of the flavivirus vector with a similar analysis of the flavivirus from which it was derived.
12. The method of claim 1, wherein said genetically attenuated flavivirus is Yellow Fever YF 17D.
13. A flavivirus vector comprising an envelope protein that comprises a foreign peptide of Hepatitis C virus, Hepatitis B virus, Hepatitis A virus, or Influenza virus.
14. The flavivirus vector of claim 13, wherein said vector is a chimeric flavivirus comprising a first flavivirus in which a structural protein or proteins have been replaced with a corresponding structural protein or proteins of a second flavivirus.
15. The flavivirus vector of claim 14, wherein said first flavivirus is selected from the group consisting of Japanese encephalitis, Dengue-1, Dengue-2, Dengue-3, Dengue-4, Yellow fever, Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, Ilheus, ticke-borne encephalitis, Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses.
16. The flavivirus vector of claim 14, wherein said first flavivirus is Yellow fever virus.
17. The flavivirus vector of claim 14, wherein said second flavivirus is selected from the group consisting of Japanese encephalitis, Dengue-1, Dengue-2, Dengue-3, Dengue-4, Yellow fever, Murray Valley encephalitis, St. Louis encephalitis, West Nile, Kunjin, Rocio encephalitis, Ilheus, ticke-borne encephalitis, Central European encephalitis, Siberian encephalitis, Russian Spring-Summer encephalitis, Kyasanur Forest Disease, Omsk Hemorrhagic fever, Louping ill, Powassan, Negishi, Absettarov, Hansalova, Apoi, and Hypr viruses.
18. The flavivirus vector of claim 17, wherein said second flavivirus is Japanese encephalitis virus.
19. The flavivirus vector of claim 14, wherein the structural proteins of the first flavivirus that have been replaced with the corresponding structural proteins of the second flavivirus are membrane and envelope proteins.
20. (canceled)
21. The flavivirus vector of claim 13, wherein said vector comprises a genetically attenuated flavivirus.
22. The flavivirus vector of claim 21, wherein said genetically attenuated flavivirus is Yellow Fever YF 17D.
23. A pharmaceutical composition comprising the flavivirus vector of claim 13 and a pharmaceutically acceptable carrier or diluent.
24. A method of delivering a peptide of a Hepatitis C virus, Hepatitis B virus, Hepatitis A virus, or Influenza virus to a patient, said method comprising administering to said patient the composition of claim 23.
25. (canceled)
26. A nucleic acid molecule comprising the genome of the flavivirus vector of claim 13 or the complement thereof.
27. The method of claim 1, wherein said foreign peptide is 10-100 amino acids in length or 20-55 amino acids in length.
28. The method of claim 1, wherein said foreign peptide is of a Hepatitis C virus selected from the group consisting of genotypes 1a, 1b, 2a, 2b, 2c, 3a, 4a, 4b, 4c, and 4d.
29. The method of claim 1, wherein said foreign peptide is of a Hepatitis C virus nucleocapsid protein, E1 glycoprotein, or E2 glycoprotein.
30. The flavivirus vector of claim 13, wherein said foreign peptide is 10-100 amino acids in length or 20-55 amino acids in length.
31. The flavivirus vector of claim 13, wherein said foreign peptide is of a Hepatitis C virus is selected from the group consisting of genotype 1a, 1b, 2a, 2b, 2c, 3a, 4a, 4b, 4c, and 4d.
32. The flavivirus vector of claim 13, wherein said foreign peptide is of a Hepatitis C virus nucleocapsid protein, E1 glycoprotein, or E2 glycoprotein.
33. The flavivirus vector of claim 13, wherein said vector comprises said foreign peptide at a single site in the envelope protein or comprises a multiplicity of said foreign peptides at different sites in the envelope protein.
34. The flavivirus vector of claim 33, wherein said foreign peptide(s) contain a single epitope or said foreign peptide(s) contain multiple epitopes.
35. The flavivirus vector of claim 34, wherein said multiple epitopes are from different species or genotypes.
36. The flavivirus vector of claim 35, wherein said different genotypes are selected from the group consisting of Hepatitis C genotypes 1a, 1b, 2a, 2b, 2c, 3a, 4a, 4b, 4c, and 4d.
37. The flavivirus vector of claim 34, wherein said epitope(s) is a B-cell epitope.
38. The flavivirus vector of claim 37, wherein the B-cell epitope is selected from the group consisting of: ETHVTGGNAGRTTAGLVGLLTPGAKQN (SEQ ID NO:29); IQLINTNGSWHINSTALNCNESLNTGW (SEQ ID NO:30); LFYQHKFNSSGCPERLASCR (SEQ ID NO:31); and PSPVVVGTTDRSGAPTYSWGANDTDVFVLNNTRPPL (SEQ ID NO:32).
39. The flavivirus vector of claim 34, wherein said epitope(s) is a TH cell or a cytotoxic T-lymphocyte (CTL) epitope.
40. The flavivirus vector of claim 39, wherein the TH cell epitope is IQLINT (SEQ ID NO:33) or said CTL epitope is selected from the group consisting of: STNPKPQR (SEQ ID NO:15); YLLPRRGPRL (SEQ ID NO:16); GPRLGVRAT (SEQ ID NO:17); YPWPLYGNEGCGWAGWLLSP (SEQ ID NO:18); GFADLMGYIPLVGAPL (SEQ ID NO:19); DLMGYIPLV (SEQ ID NO:20); LLALLSCLTV (SEQ ID NO:21); REGNASRCWVAVTPTVATRD (SEQ ID NO:22); STGLIHLHQ (SEQ ID NO:23); LLADARVCSC (SEQ ID NO:24); CWHYPPRPCGI (SEQ ID NO:25); CVIGGVGNNT (SEQ ID NO:26); RRLTDFAQGW (SEQ ID NO:27); and TINYTIFK (SEQ ID NO:28).
Type: Application
Filed: Jul 14, 2009
Publication Date: Jan 20, 2011
Applicant: Sanofi Pasteur Biologics Co. (Cambridge, MA)
Inventors: Harold Kleanthous (Westford, MA), Charles Miller (Medford, MA), Larisa Oros (Charlestown, MA)
Application Number: 12/460,110
International Classification: A61K 39/145 (20060101); C12Q 1/70 (20060101); C12N 15/63 (20060101); A61K 39/29 (20060101); C07H 21/00 (20060101); A61P 31/16 (20060101); A61P 31/14 (20060101);