Abstract: The present invention relates to a material having improved mechanical properties, clarity, processability and/or degradation resistance comprising a polyurethane elastomeric composition which includes a soft segment derived from at least one polysiloxane macrodiol and at least one polyether and/or polycarbonate macrodiol. This material can function as a degradation resistant material or biomaterial and is particularly useful in the manufacture of medical devices, articles or implants which contact living tissues or bodily fluids. The present invention also provides a polyurethane elastomeric composition which includes a soft segment derived from about 60 to 98 wt % of at least one polysiloxane macrodiol and about 2 to 40 wt % of at least one polyether and/or polycarbonate macrodiol and processes for its preparation.

Abstract: Telechelic polymers are presented, comprising polysiloxane polymers having multiple epoxy end-groups of the formula G—R3—SiR1R2O(SiR1R2O)mSiR1R2—R3—G wherein each R1 and R2 are independently monovalent alkyl, alkoxy, aryl, aryloxy, and halohydrocarbon radicals having from 1 to 20 carbon atoms, halohydrocarbon radicals having the formula CnF2n+1CH2CH2— wherein n is an integer from 1 to 18; m is an integer in the range from 10 to about 1000; R3 is a divalent hydrocarbon radical having from 2 to 18 carbon atoms; and G is a silicon-based functionalized end group, wherein the functionalities are selected from the group consisting of epoxides, vinyl ethers, propenyl ether, or a combination thereof.

Abstract: The present invention relates to novel dimethicone copolyol amido quaternary compounds bearing a cationic group and an amido group. This invention also relates to a specific amido amine intermediate useful in the preparation of the compounds of the present invention. Compounds of the present invention are useful in the preparation of personal care products, specifically shampoos, conditioners and body washes.

Abstract: Polyfunctional mercaptoalkyl-substituted aryl compounds, one and two-part adhesive compositions including the compounds, and methods of making and using the compounds are disclosed. The compounds include one or more aromatic rings, wherein at least one, and in one embodiment, only one aromatic ring is substituted with at least one alkylthio group and at least one oxyalkylthio group, and preferably do not include hydrolyzable linkages. The aromatic nucleus can provide the cured products with higher glass transition temperatures (Tg's) than are available from most commercially available polymercaptans. The adhesive systems include an epoxy resin or other compounds such as terminal olefins which are known to react with thiols (polymerizable material). Preferably, the compounds are used in combination with amine curatives as a two-component curing system for epoxy resins.

Abstract: An aromatic polycarbodiimide having a specified structural unit is disclosed. The aromatic polycarbodiimide can give films, moldings, adhesives and the like each having excellent characteristics such as high heat resistance, high dimensional stability, high moisture resistance or the like, and therefore is suitable for use as a heat resistant covering material in, for example, production of electronic parts.

Abstract: The process for producing an aromatic polycarbonate of the present invention comprises subjecting an aromatic diol compound and a carbonic acid diester to transesterification reaction in the presence of a defoaming agent. In the process of the present invention, it is possible to produce a transparent and colorless aromatic polycarbonate having a high quality, at a high polymerization velocity without occurrence of significant foaming phenomenon.

Abstract: A high molecular weight copolymeric polyaspartic ester which has been hydrophobically modified with alkyl or alkenyl radicals having from 6 to 30 carbon atoms. The copolymers are derived from polyamino acids and have a molecular weight, Mw, of about 2500 or above.

Abstract: Device adapted for efficient light emission including a plurality of component layers of which a first outer layer is adapted for electron injection, a second opposing outer layer is adapted for hole injection, and plural intermediate layers arranged therebetween for charge semi-conduction. The intermediate layers include at least one semi-conducting polymer adapted for hole transport and/or electron blocking, and at least one semi-conducting polymer adapted for hole blocking and/or election transport. The at least one semi-conducting polymer adapted for electron transport and/or hole blocking comprises polymer selected from a nitrogen and/or sulphur containing polymer which is partially or substantially conjugated.

Abstract: The present invention is related to a method for preparing polyether polyol or copolymerized polyether polyol, which uses an acid catalyst consisting of heteropoly acidic salts and oxides and/or binders. It allows tetrahydrofuran and/or cyclic ether compounds to carry out the ring-opening polymerization or ring-opening copolymerization with/without telogen, and obtains polyether polyol or copolymerized polyether polyol. An acid catalyst is used in the present invention because of its low solubility in organic solvent, so its process is simpler and the catalyst is easy to recycle for repeated use. As well, its preparation process is highly advantageous.

Abstract: The present invention provides purified polypeptides which comprise at least a portion of a &dgr; T cell receptor polypeptide, a &ggr; T cell receptor polypeptide, a &ggr;, &dgr; T cell receptor complex or a &ggr;, &ggr; T cell receptor complex. Substances capable of forming complexes with these polypeptides are also provided. Additionally, methods for detecting T cells which have within them or on their surfaces a polypeptide of the present invention are provided. Moreover, methods for diagnosing immune system abnormalities are provided which comprise measuring in a sample from a subject the number of T cells which have within them or on their surfaces a polypeptide of the present invention.

Abstract: This invention comprises novel Rapamycin-FKBP12 binding proteins of mammalian origin for identification, design and synthesis of immunomodulatory, anti-restenosis or anti-tumor agents, as well as fragments of the proteins and the DNA, cDNA, antisense RNA and DNA segments corresponding to the proteins. This invention also comprises methods for isolating the proteins and therapeutic uses related to the proteins.

Abstract: The present invention relates to polypeptides that promote neurite outgrowth. The polypeptides contain fibronectin Type III repeats derived from a family of cell adhesion molecules characterized by having 6 immunoglobulin domains and 5 fibronectin Type III repeats. The polypeptides of this invention correspond to F80, 3-5 and 4-5 regions of the cell adhesion family members chicken Ng-CAM, chicken Nr-CAM, mouse L1CAM, human L1CAM and homologs thereof. Methods of promoting neurite outgrowth in both diagnostic and therapeutic applications are also described as are methods of making the disclosed polypeptides and devices for using thereof.

Abstract: The invention provides a human nucleolin-like protein (HNLP) and polynucleotides which identify and encode HNLP. The invention also provides expression vectors, host cells, antibodies, agonists, and antagonists. The invention also provides methods for treating or preventing disorders associated with expression of HNLP.

Abstract: A bovine- or human-derived calcium-binding protein with a prescribed amino acid sequence, a method for its production, and antibodies against the protein and uses thereof.

Abstract: This invention is directed to a novel &bgr;-secretase that produces the A&bgr; peptide found in Alzheimer's Disease. One &bgr;-secretase is a protein having a molecular weight of about 61, 81 or 88 kDa that cleaves an amyloid precursor protein (APP) substrate. Another is a protease complex having a molecular between about 180 and 200 kDa, which, in one embodiment, contains the 61, 81, and 88 kDa proteins and, in another embodiment, contains proteins having a molecular weight of about 66, 60, 33 and 29 kDa. Another &bgr;-secretase has a molecular weight between about 50 and 90 kDA. The invention is also directed to methods of selecting agents that inhibit A&bgr; peptide production and treating Alzheimer's disease in patients.

Abstract: TR6 polypeptides and polynucleotides and methods for producing such polypeptides by recombinant techniques are disclosed. Also disclosed are methods for utilizing TR6 polypeptides and polynucleotides in the design of protocols for the treatment of chronic and acute inflammation, arthritis, septicemia, autoimmune diseases (e.g. inflammatory bowel disease, psoriasis), transplant rejection, graft vs. host disease, infection, stroke, ischemia, acute respiratory disease syndrome, restenosis, brain injury, AIDS, Bone diseases, cancer, atheroschlerosis, and Alzheimers disease, among others and diagnostic assays for such conditions.

Abstract: The invention provides dbpB polypeptides and DNA (RNA) encoding dbpB polypeptides and methods for producing such polypeptides by recombinant techniques. Also provided are methods for utilizing dbpB polypeptides to screen for antibacterial compounds.

Abstract: The invention relates to OCT-3 polypeptides, nucleic acid molecules encoding OCT-3, and uses thereof. OCT-3 is a protein that is expressed in the plasma membrane of biological cells, across which it regulates the transport of organic molecules.

Abstract: A recombinant human IL-4 mutein numbered in accordance with wild-type IL-4 wherein the mutein comprises at least one amino acid substitution in the binding surface of either the A- or C-alpha helices of the wild-type IL-4 whereby the mutein binds to the IL-4R&agr; receptor with at least greater affinity than native IL-4. The substitution is more preferably selected from the group of positions consisting of, in the A-helix, positions 13 and 16, and in the C-helix, positions 81 and 89. A most preferred embodiment is the recombinant human IL-4 mutein wherein the substitution at position 13 is Thr to Asp. Pharmaceutical compositions, amino acid and polynucleotide sequences encoding the muteins, transformed host cells, antibodies to the muteins, and methods of treatment are also described.

Abstract: A high quality soy protein concentrate (SPC) was produced by a process of enzyme treatment combined with ultrafiltration. Soy flour, the starting material, was enzymatically treated with commercial pectinases and diafiltered with a porous stainless steel ultrafiltration system. The resulting product had reduced levels of physic acid and nucleic acids due to contaminant phytase and nuclease activity in the pectinase enzymes. The functionality of the SPC was improved due to increased solubility compared to conventional soy isolates produced by acid precipitation. High performance liquid chromatography gel filtration profiles indicated that the proteins in the SPC remained intact. The SPC also had reduced flavor when compared to the original soy flour according to gas chromatography flavor profiles and sensory evaluation.

Abstract: A protein containing one or more disulfide bonds, e.g., an antibody, is subjected to ultraviolet radiation to reduce one or more such bonds to reactive sulfhydryl groups; the resulting photoactivated protein is reacted with other chemical entity which is reactive with sulfhydryl, such as certain radiometals, chelating agents, drugs and toxins, so as to obtain a conjugate useful in, e.g., in vitro diagnosis, in vivo imaging, and therapy.

Abstract: Azo compounds of the formula (I) are functionalized with heterocycles.

Abstract: DNA encoding an endothelin receptor shown in SEQ ID NO: 1, SEQ ID NO: 2, SEQ ID NO: 3, or SEQ ID NO: 4. In the Sequence Listing is isolated from cDNA which is prepared from poly(A)+RNA derived from a human placenta. In addition, an expression vector containing the DNA and a transformant containing the expression vector are obtained. An endothelin receptor is obtained by culturing this transformant. A receptor shown in SEQ ID NO: 1 and SEQ ID NO: 2 is an ETA-receptor which has a high affinity for endothelins 1 and 2, especially for the endothelin 1. A receptor shown in SEQ ID NO: 3 and SEQ ID NO: 4 is an ETB-receptor which has an affinity for endothelins 1, 2 and 3 with no selectivity.

Abstract: The Breast Cancer Resistance Protein is described, as well as the cDNA encoding said protein. This protein has been found to confer resistance to cancer chemotherapeutic drugs.

Abstract: The present invention provides a human glutamate receptor and related DNA compounds useful not only in assays for potential pharmaceuticals but also in methods for molecular biology techniques.

Abstract: The current invention concerns SMAD interacting protein(s) obtainable by a two-hybrid screening assay whereby SMAD1 C-domain fused to GAL4 DNA-binding domain as bait and a cDNA library from mouse embryo as prey are used. Some characteristics of a specific SMAD interacting protein (SIP1) of the family of zinc finger/homeodomain proteins including &dgr;-crystallin enhancer binding protein and/or Drosophila zfh-1 include an inability to interact with full size XSMAD1 in yeast, SIP1czf binds to E2 box sites, SIP1czf binds to the Brachyury protein binding site and interferes with Brachyury-mediated transcription activation in cells and also interacts with C-domain of SMAD 1, 2 and 5. The minimal length of the amino acid sequence necessary for binding with SMAD appears to be a 51 amino acid domain encompassing amino acids 166-216 of SEQ ID NO 2 having the amino acid sequence as depicted in the one letter code: QHLGVGMEAPLLGFPTMNSNLSEVQKVLQIVDNTVSRQKMDCKTEDISKLK (SEQ ID NO. 21).

Abstract: A novel antigenic protein derived from the outer membrane of H. influenzae is provided. DNA sequences encoding such a protein are also provided as are vaccines comprising the protein and methods of immunising a subject against H. influenzae infection. The invention also includes methods for the prophylaxis or treatment of rerspiratory tract infections or otitis media, as well as methods for the detection of H. influenzae, and kits for use in such methods.

Abstract: Isolated DNA sequence which can serve as terminator region in a chimeric gene capable of being used for the transformation of plants 1) Chimeric gene for the transformation of plants. 2) It comprises at least, in the direction of transcription, a promoter region, a transgene and a terminator region, characterized in that the terminator region consists of at least one terminator region from a plant histone gene permitting the expression of the protein in the regions of rapid growth. 3) Production of transgenic plants.

Abstract: A new expression system is provided which comprises component(s) of a lipase regulation cascade. the lipase regulation cascade as disclosed herein includes a kinase, a DNA binding regulator, a polymerase, a promoter, an upstream activating sequence, and secretion factors. Plasmids and transformed cells are also provided as well as methods of transforming host cells using the plasmids. Further, there is provided a kinase that can regulate the expression of a protein, a DNA binding regulator that can regulate the expression of a protein, a Pseudomonas alcaligenes polymerase, a Pseudomonas alcaligenes sigma 54 promoter, a Pseudomonas alcaligenes upstream activating sequence, the Pseudomonas alcaligenes secretion factors XcpP, XcpQ, XcpR, XcpS, XcpT, XcpU, XcpV, XcpW, XcpX, XcpY, XcpZ and the xcp regulators OrfV, OrfX.

Abstract: A method of preparing an immobilized oligonucleotide having a free 3′-end comprises the steps of: i) preparing an oligonucleotide attached in a first position to a solid support via its 3′-end and having a free 5′-end; ii) binding said oligonucleotide in a second position remote from the 3′-end to the solid support; and iii) selectively releasing the 3′-end of the oligonucleotide from the solid support to obtain the oligonucleotide attached to the support in said second position in a reversed orientation with a free 3′-end.

Abstract: A process is described for purifying plasmid DNA from prokaryotic cells comprised thereof. This process comprises the steps of: (a) digesting the cells; (b) incubating the cells for about 4 to 24 hours to effect lysis and solubilization thereof, without effecting enzymatic digestion of RNA; (c) removing lysate contaminants from the cells to provide a plasmid DNA solution; (d) filtering the solution through a tangential flow filtration device to obtain a retentate containing the plasmid DNA; and (e) collecting the retentate.

Abstract: Nucleoside analogues containing the degenerate base analogue P and derivatives thereof are provided with reporter moieties preferably comprising signal moieties. The nucleoside analogues are useful for labeling DNA or RNA or for incorporating in oligonucleotides.

Abstract: Water-soluble sulfoalkyl-containing hydrophobically modified cellulose ethers, processes for preparing them, and their use in emulsion paints The present invention relates to water-soluble ionic cellulose ethers from the group of the hydroxyalkylcelluloses which are substituted by on average from 0.001 to 1.0 alkyl group per anhydroglucose unit and which carry from 0.01 to 0.1 sulfoalkyl group per anhydroglucose unit, to processes for preparing them and to the use of water-soluble ionic cellulose ethers from the group of the hydroxyalkylcelluloses which are substituted by on average from 0.001 to 1.0 alkyl group per anhydroglucose unit and which carry from 0.01 to 0.4 sulfoalkyl group per anhydroglucose unit in emulsion paints.

Abstract: A mixture is made of a plurality of different titanyltetraazaporphyrin compounds, each of which is represented by formula (1): wherein A, B, C and D are each independently an unsubstituted or substituted benzene ring or pyridine ring, a substituent thereof being selected from the group consisting of nitro group, cyano group, a halogen atom, an alkyl group having 1 to 8 carbon atoms, an alkoxyl group having 1 to 8 carbon atoms, and an aryl group. The above-mentioned mixture is contained in a photoconductive layer of an electrophotographic photoconductor as a photoconductive material.

Abstract: Crystalline 2-(amninothiazol-4-yl)-2-(tert.butoxycarbonylmethoxyimino)acetic acid-S-mercapto-benzo-thiazolylester in form of an N,N-dimethylacetamide solvate; a crystalline salt of a 7-[2-(aminothiazol-4-yl)-2-(carboxymethoxyimino)acetamido]-3-vinyl-3-cephem-4-carboxylic acid with an amine of formula N(R1)(R2)(R3), wherein R1, R2, and R3 have various meanings, a crystalline sulphuric acid addition salt of a 7-[2-(2-aminothiazol-4-yl)-2-carboxymethoxyimino)acetamido]-3-vinyl-3-cephem-4-carboxylic acid; and the use of these salts in the production of cefixime, e.g. in form of a trihydrate.

Abstract: The invention relates to azolobenzazepine derivatives of the formula I: wherein: X is O or S; R1, R2, R3 and R4 are independently hydrogen, perfluorolower-alkyl, halogen, nitro or cyano; and C together with the carbon atoms to which it is attached forms a 5-membered aromatic heterocycle, to pharmaceutical compositions containing them and to methods for the treatment of neurological disorders utilizing them.

Abstract: Fluorinated triazinic compounds having the formula: wherein Z=T—Y, with T=—(CH2)q, —SO2, —CO, q= is an integer from 1 to 20; Y=O—, O(C2H4O)p—, O(CH2)n—NR—, O (CH2)n—O—, O(C3H6O)p—, NR—, S—, S(C2H4O)p—, S(C3H6O)p—; wherein R=H, alkyl from 1 to 10 C atoms; n is an integer from 1 to 20; p is an integer from 1 to 5; Rf represents a linear or branched fluoroalkyl chain or a (per)fluoropolyether chain. X is selected from: Cl; Rf—CF2—Z; CF3—Z. Use of these triazinic compounds or of their formulations for the treatment of natural or synthetic fiber textiles.

Abstract: An improved process for the preparation of 4,6-disubstituted pyrido[3,4-d]pyrimidines is described where 5-amino-2-fluoropyridine is converted in seven operations to the desired products, as well as other valuable intermediates used in the process.

Abstract: The present invention relates to a process for the preparation of amides, comprising reacting amines with carboxylic acids in the presence of silicon amines. The present invention further relates to a process for the preparation of quinazoline derivatives, comprising reacting amines with carboxylic acids in the presence of silicon amines to obtain amides and contacting the resultant amides with quinazoline.

Abstract: The present invention provides a process for preparing an amide, which comprises reacting an amine with an ester in a molten form in the absence of a solvent.

Abstract: An improved process for the preparation of 6-(perfluoroalkyl)uracil compounds having the structural formula I from carbamate compounds having the structural formula II

Abstract: A compound of the formula: is disclosed as an HIV protease inhibitor. Methods and compositions for inhibiting an HIV infection are also disclosed.

Abstract: A process for preparing a 1-aryl-4-(arylethyl)piperazine of the formula (I) by reacting a 1-arylpiperazine of the formula (II) with an aromatic olefin of the formula (III) Ar′CR1═CHR2  (III) in an inert solvent in the presence of at least one basic catalyst, where in the formulae (I) to (III) Ar and Ar′ independently of one another are an aryl radical, selected from the group of the fused and unfused C6-C22-aromatics and the fused or unfused C5-C22-heteroaromatics which have at least one nitrogen, oxygen or sulfur atom in the ring; and R1 and R2 independently of one another are a hydrogen atom, a C1-C8-alkyl radical or an aryl radical Ar.

Abstract: Compounds of general structural formula I such as that shown in structural formula II are selective NPY Y5 receptor antagonists, useful in the treatment of obesity and the complications associated therewith.

Abstract: The present invention relates to quinolonecarboxylic acid derivatives having more excellent and broad antibacterial activities than the existing quinolone-series antibiotics. More specifically, it pertains to novel quinolonecarboxylic acid derivatives represented by following formula 1, which have a derivative of 7-[8-(alkoxyimino)-2,6-diazaspiro[3.4]oct-6-yl] as a substituent, and pharmaceutically acceptable salts and isomers thereof: Wherein, A is C—H, C—F, C—Cl, C—O—CH3 or N; Y is H or amino; R1 is cyclopropyl or 2,4-difluorophenyl; R2 is C1-4 alkyl; and R3 is H or C1-4 alkyl.

Abstract: A process for preparing an unsubstituted or substituted quinacridone of the formula or a solid solution of quinacridones of the formula (I), wherein X and Y are independently 1 or 2 substituents selected from hydrogen, fluorine, chlorine, C1-C3alkyl, C1-C3alkoxy and COOR wherein R is hydrogen or C1-C10alkyl in which a salt of a corresponding 6,13-dihydroquinacridone of formula II  having the same substitutions as the desired quinacridone of formula I, or a mixture of corresponding 6,13-dihydroquinacridones of formula II, is oxidized with an oxygen containing gas in the presence of an aqueous base and a catalytically effective amount of an oxidation catalyst, characterized in that the oxidation is performed in the presence of an polyglycolic reaction medium of formula R1—O—[(CH2)m—(CHR1′)n—O]x—O—R1″  (III).

Abstract: The present invention provides an intermediate for producing a thienopyridine derivative useful as a GnRH antagonist as well as an efficient and safe method for producing the same in an industrial scale at a high yield.

Abstract: A compound of the following formula: and the salts thereof, wherein A is hydrogen, halo, or hydroxy; the broken line represents an optional double bond with proviso that if the broken line is a double bond, then A is absent; Ar1 is optionally substituted phenyl; Ar2 is aryl or heteroaryl selected from phenyl, napththyl, or pyridyl, the aryl or heteroaryl being optionally substituted; R1 is hydrogen, hydroxy, or C1-C4 alkyl; and R2 and R3 are independently selected from optionally substituted C1-C7 alkyl, C3-C6 cycloalkyl, C2-C6 alkenyl, C2-C6 alkynyl, or R2 and R3, together with the nitrogen atom to which they are attached, form an optionally substituted pyrrolidine. These compounds are useful as kappa agonists.

Abstract: Processes for preparing sulfoxides useful as drugs such as acid secretion inhibitors or antiulcer drugs or intermediates for the preparation of drugs in high yields, at high purities, and with safety. Specifically, a process for the preparation of sulfoxides (II) by oxidizing a thio ether (I) with a peroxoborate salt in the presence of an acid anhydride or a metal catalyst; and a process for the preparation of sulfoxides (II) by oxidizing a thio ether (I) with an N-halosuccinimide, 1,3-dihalo-5,5-dimethyl-hydantoin or dichloroisocyanuric acid salt in the presence of a base.

Abstract: A compound having the formula selected from the group consisting of wherein either R3p and R4p are identical and selected from the group consisting of —OH, protected —OH and acyloxy of 1 to 8 carbon atoms, R2p is selected from the group consisting of —CN, —F, Br and I and R1p and R5p are hydrogen or R5p is —F and R1p and R2p are hydrogen or R1p and R2p are F and R5p is hydrogen, or R4p and R5p are identical and selected from the group consisting of —OH, protected —OH and acyloxy of 1 to 8 carbon atoms, R3p is selected from the group consisting of F and —CN and R1p and R2p are hydrogen, R8 is hydrogen or an amine protective group and R10 is the remainder in which the hydroxy or amino are protected wherein R′1 is selected from the group consisting of alkyl of 1 to 4 carbon atoms, —CN, carboxy and alkoxy carbonyl of 1 to 4 carbon atoms.