Abstract: Storage-stable acrylate-functional alkyd resin compositions are disclosed that include an acrylate-functional alkyd resin and a monofunctional mercaptan such as a chain transfer agent. The compositions disclosed exhibit excellent stability on storage, and have utility as binders for coating compositions useful as low VOC, quick dry paints.

Abstract: A composition which is applied to substrate surfaces to form a membrane to provide structural reinforcement thereto and prevent the release of gases and moisture from the substrate. The composition consists of polymer resin binders and gypsum. Further provided is a method for dividing the composition into two separate components in order to preclude premature setting up of the composition ingredients until applied to the substrate. The present invention is particularly useful for creating membranes on the exposed surfaces of newly excavated rocks in subterranean mine systems. The composition may also be used in the construction industry as coatings for sandwich panels, molding, duct-work, piping and cladding systems. It also is useful in traffic paint applications and other transportation industry safety coatings. In addition, the invention may be used in the manufacture of fiber reinforced composite structures and composite construction components.

Abstract: A stabilized thermoplastic resin composition is disclosed which comprises structural units derived at least one substituted or unsubstituted polycarbonate, at least one substituted or unsubstituted polyester and a combination of at least two quenchers, wherein said quencher is selected from a group consisting of phosphorus compound, carboxylic acid, derivates of carboxylic acids, epoxy functional polymers and boron compound. Also disclosed is a stabilized thermoplastic resin composition comprising: structural units derived at least one substituted or unsubstituted polycarbonate, at least one substituted or unsubstituted polyester, an epoxy functional polymers and a combination of at least one quenchers, wherein said quencher is selected from a group consisting of phosphorus compounds, carboxylic acid compounds, polyols, and boron compounds. In addition the composition disclosed possess good optical properties, thermal properties and stability.

Abstract: The present invention discloses a paper coating latex containing copolymeric ionic monomer, a paper coating composition containing thereof, and a paper coated with the composition. More specifically, the present invention provides a styrene-butadiene latex for paper coating which contains sodium methallyl sulfonate, an ionic monomer copolymerizing with monomers used in latex manufacturing, as a monomer for emulsion polymerization, and has excellent stability and fluidity, a paper coating composition containing thereof, and a paper coated with the composition.

Abstract: A transparent, flame retardant polycarbonate composition consisting essentially of an aromatic polycarbonate resin and a flame-retarding amount of a guanidine salt or derivatives thereof, wherein the amount of guanidine salt or derivatives thereof is about 1 wt. % or less.

Abstract: The invention provides a sulfur vulcanizable silica-reinforced elastomeric compound having improved tensile mechanical and dynamic viscoelastic properties. The compounds are formed by mixing an elastomer optionally having an alkoxysilane terminal group, with silica in the presence of an alkyl alkoxysilane and a blocked mercaptosilane. In particular, the mercaptosilane moiety of the blocked mercaptosilane and the alkyl alkoxysilane are present in a weight ratio of about 0.001:1 to about 0.20:1. Preferably, the blocked mercaptosilane and the alkyl alkoxysilane are compounded with the elastomer and the silica at high temperature to facilitate the silica-silane reaction. A deblocking agent is added at any desired mixing stage, optionally with the cure package, to allow binding of the mercaptosilane to the polymer.

Abstract: The purpose of the invention is a coating precursor comprising a silicone resin, a mineral filler and an organic solvent capable of dissolving the said resin and putting the said mineral filler into suspension, the said silicone resin and the said mineral filler being capable of chemically reacting so as to produce a solid layer on a substrate after the organic solvent has evaporated and a cohesive refractory layer after a calcination operation. Another purpose of the invention is a method for coating a given surface of a substrate with at least one refractory layer containing silicon in which the substrate is coated with a coating precursor according to the invention so as to form a green layer and a heat treatment is carried out to calcine the said green layer and to form a cohesive refractory layer. The invention is a means of obtaining a protective coating capable of resisting oxidizing environments, liquid metal and solid or molten salt.

Abstract: A rubber composition usable for the manufacture of tires, based on at least one diene elastomer, one reinforcing inorganic filler and a coupling agent providing the bond between the inorganic filler and the elastomer. The inorganic filler comprises a synthetic aluminosilicate of the formula: MxSiAlyOa(OH)b, (H2O)c??(I) in which: M is a cation selected from of K+, Na+, Ca++ and mixtures of these cations; x>0; y>0; a?0; b?0, c?0 and a+b>0, and having the following characteristics: (a) a BET specific surface area of between 20 and 300 m2/g; (b) an average particle size by mass (dw) of between 20 and 400 nm; and (c) an ultrasound disagglomeration rate (?) greater than 5×10?4 ?m?1/min.

Abstract: The present invention is directed to a hybridized polymer matrix, a method of making such, and products incorporating such a matrix. The hybridized polymer matrix comprises a solvent-free polymer matrix base, a hybridized matrix comprising one or more poly(1-vinyl-2-pyrrolidones) and dimethyl sulfoxide, and at least one active substance. The hybridized polymer matrix is useful in the preparation of transdermal therapeutic systems, particularly making possible the introduction of pharmaceutically active substances which are otherwise difficult to dissolve, such as ibuprofen, into a non-polar matrix.

Abstract: An improved adhesive composition and method for adhering textile reinforcing elements to rubber, particularly ethylene-propylene-diene rubber in the manufacture of rubber articles such as power transmission belts, wherein the adhesive composition comprises a latex of a hydrogenated styrene-butadiene rubber, a carboxylated hydrogenated styrene-butadiene rubber, a hydrogenated nitrile-butadiene rubber, a carboxylated hydrogenated nitrile-butadiene rubber, a chlorosulfonated polyethylene or blends thereof; an aqueous solution of a half-ester of maleinized liquid poly butadiene; and, optionally, up to about 15% by weight carbon black in an aqueous solution.

Abstract: Disclosed are methods for advantageously producing maleated polypropylenes having a relatively high percentage of bound maleic anhydride, based on the total amount of maleic anhydride moieties present in the grafting reaction product, and the maleated polypropylenes produced therefrom. The methods produce maleated polypropylenes wherein at least about 60% of the maleic anhydride moieties in the grafting reaction product are bound to the polypropylene.

Abstract: A second-order modified block copolymer which can be obtained by reacting a first-order modified block copolymer with a second-order modifier, wherein the first-order modified block copolymer comprises a base block copolymer and a functional group-containing first-order modifier group bonded to the base block copolymer, wherein the base block copolymer comprises at least one polymer block comprised mainly of vinyl aromatic hydrocarbon monomer units and at least one polymer block comprised mainly of conjugated diene monomer units, and wherein the second-order modifier has a specific functional group which is reactive to the functional group of the first-order modifier group of the first-order modified block copolymer. A second-order modified block copolymer-containing polymer composition comprising the second-order modified block copolymer as well as a thermoplastic resin and/or a rubbery polymer.

Abstract: A film of a polyethylene produced by polymerization catalysed by a single site catalyst and comprising as comonomers to ethylene at least two C4-12 alpha olefins, preferably but-1-ene and hex-1-ene.

Abstract: In a process for producing a polymer blend, at least one first monomer is polymerized in a first slurry phase reaction zone in the presence of a supported first catalyst to produce a thermoplastic first polymer having a crystallinity of at least 30%. At least part of said first polymer is then contacted with at least one second monomer different from said first monomer in a second solution phase reaction zone in the presence of a second catalyst and in the absence of polyenes under conditions to produce a second polymer having a crystallinity of less than 20%.

Abstract: The invention provides methods and formulations involving the use of promoters that accelerate the polymerization of macrocyclic polyester oligomers (MPOs). For example, in certain embodiments, the invention provides blends of macrocyclic polyester oligomer (MPO), catalyst, and promoter that are substantially stable at ambient temperature for a period of time. The blend material may be stored without premature polymerization of MPO or deactivation of catalyst. The invention also provides processes employing one-part, ready-to-polymerize blends that contain MPO, catalyst, and promoter, as well as processes in which the catalyst and promoter are used in separate streams and are contacted when it is desired to accelerate polymerization of MPO. Methods of the invention offer advantages in the manufacture of thermoplastic parts and composites, due at least in part to the unique properties of MPO.

Abstract: Esterified polyalkene/UAR copolymer reaction products useful as (1) a friction modifier for lubricating oils such as automatic transmission fluids to improve torque capacity and anti-shudder durability and for continuous variable transmissions (CVTs), (2) a friction modifier for fuels or (3) a cold flow improver for diesel fuels are provided. The esterified copolymer reaction product may be used as is or can be further derivatized (e.g., by post treatment of the esterified copolymer reaction product with, for example, ethylene carbonate or boric acid).

Abstract: The present invention provides a novel silicon compound represented by Formula (1) having a living radical polymerization initiating ability for addition-polymerizable monomers and a polymer obtained using the same. The above polymer can provide an organic-inorganic composite material having a distinct structure. wherein R1 is hydrogen, alkyl, aryl or arylalkyl; R2 and R3 are alkyl, phenyl or cyclohexyl; and A is a group having an ability to initiate polymerization of a monomer.

Abstract: The present invention relates to a process for producing polymers comprising repeating units derived from at least one isoolefin monomer, at least one multiolefin monomer and optionally further copolymerization monomers in the presence of at least one organic nitro compound and AlCl3/water wherein the process is conducted in the absence of compounds selected from the group consisting of vanadium compounds, zirconium halogenid, and hafnium hallogenides.

Abstract: Provided is a polymeric fluorescent substance showing fluorescence in solid state, which has a specific carrier drift mobility, a specific repeating unit, and specific number-average molecular weight. The polymeric fluorescent substance is excellent in solubility to organic solvents, and has higher efficiency and longer lifetime in applying as a polymer LED.

Abstract: The present invention relates to compositions comprising poly-HEMA having a peak molecular weight between about 25,000 and about 100,000 , preferably between 25,000 and 80,000 and a polydispersity of less than about 2 to less than about 3.8 respectively and covalently bonded thereon, at least one cross-linkable functional group. The present invention further relates to low polydispersity poly-HEMA suitable for making the crosslinkable prepolymers, processes for functionalizing and purifying said poly-HEMA to form said crosslinkable prepolymers, viscous solutions made from said crosslinkable prepolymers, hydrogels made from said viscous solutions and articles made from said crosslinkable polymers, hydrogels and viscous solutions.

Abstract: The present invention includes a bimodal polyethylene polymerization process wherein metallocene catalyst to is used to adjust the hydrogen response of a Ziegler-Natta catalyst. The polymerization may be carried out in a single reactor or in two or more reactors in series, preferably two or more continuously stirred tank reactors in series. In an embodiment having two or more reactors, the Zeigler-Natta catalyst is added to a first reactor and the metallocene catalyst is added to a downstream reactor. In another embodiment having two or more reactors, the Zeigler-Natta catalyst and metallocene catalyst are added to the same reactor, preferably an upstream reactor. A preferred Zeigler-Natta catalyst comprises TiCl4, and a preferred metallocene catalyst comprises bis(cyclopentadienyl) titanium dichloride.

Abstract: A novel imide silicone resin is provided that on heat treatment is capable of easily forming a cured resin coating with excellent solvent resistance, humidity resistance and durability, as well as a production process therefor.

Abstract: Golf balls comprising thermoplastic, thermoset, castable, or millable elastomer compositions are presently disclosed. The compositions comprise at least one regioselective polyisocyanate having an asymmetric structure and comprising at least a first NCO group and a second NCO group, the first NCO group being substantially more sterically interfered than the second NCO group. The first NCO group is directly attached to a tertiary carbon atom or is one methine carbon atom away from either at least one quaternary carbon atom or at least two tertiary carbon atoms. These elastomer compositions can be used in any one or more portions of the golf balls, such as inner center, core, inner core layer, intermediate core layer, outer core layer, intermediate layer, cover, inner cover layer, intermediate cover layer, and/or outer cover layer.

Abstract: The object of the present invention is a biodegradable polymer network and methods to make it. The polymer network consists of a cross-linked polyester resin, which is composed of hydroxy acid units, structural units derived from an unsaturated bifunctional monomer, and structural units derived from a polyol monomer. The polyester resin is produced directly by a polyoon-densation reaction, after which it is cross-linked to a polymer of high molecular weight The polyester can be co-polymerised with a co-monomer increasing flexibility, or be blended with a reactive macromonomer, which adds elasticity and crosslinking density. The prepared polymer network can be especially used to coat continuous or singular objects made of fibrous, porous, biomass based or inorganic materials, or as a blending component in these, or used to impregnate these in order to induce water durability, barrier properties, elasticity, coherence or mechanical strength.

Abstract: Described are polymers and copolymers containing sorbitol, citric acid, starch, aspartic acid, succinic anhydride, adipic acid mixtures thereof, methods of their synthesis and their uses.

Abstract: Methods for the biochemical and immunohistochemical detection of cell apoptosis are described. The methods utilize the detection and measurement of polypeptide fragments generated during apoptosis. Conditions associated with apoptosis may be detected by the methods of this invention. Methods are also presented for the screening of potential therapeutic compounds which inhibit or stimulate apoptosis. Kits for detection of apoptosis and diagnosis of diseases are also provided.

Abstract: A secretin or secretin derivative protected against peptidase activity. The secretin or derivative comprises a peptidic sequence and a reactive group selected from the group consisting of succinimidyl and maleimido groups capable of reacting with an amino group, hydroxyl group or thiol group on a blood component to form a stable covalent bond. The reactive group is attached at a position along the peptidic sequence that provides, when conjugated to a blood component, a higher stability against peptidase degradation than the unconjugated secretin or derivative, and therefore an increased maintenance of the therapeutic activity compared to the unconjugated secretin or derivative. Such a compound is thus effective to provide a source of secretin having a high stability against peptidases. A method for synthesizing such a compound is also described.

Abstract: Peptide constructs including a first peptide segment which includes an amino acid sequence associated with autoimmune disease, asthma, allergy or xeno- or allograft transplantation rejections bonded directly or via a linker or spacer to a second peptide which binds to T cells and which will redirect the immune response from a harmful Th1 response to a less harmful Th2 response, or which will bind to T cells to initiate, but not complete, an immune response causing the T cells to which the first peptide binds, to undergo anergy and apoptosis, are useful in treating autoimmune conditions. For instance, the peptide construct NGQEEKAGVVSTGLIGGGDSAFDVLSFTAEEKAGVYK (SEQ ID NO:14) wherein Th2 stimulating Peptide G (SEQ ID NO:15) is covalently linked, via spacer GGG, to cardiac myosin molecule My1 (SEQ ID NO:16), can be used for treatment or prevention of myocarditis.

Abstract: The invention provides a CDK4 binding peptide, and a nucleic acid sequence coding therefore, that is capable of specifically binding cyclin dependent kinase (CDK4) to inhibit CDK4 activity and cell growth. The invention also includes variants of the CDK4 binding peptide which comprise polypeptides which have at least about 80% amino acid sequence identity with the amino acid sequence of the CDK4 binding peptide. In another embodiment, the invention provides chimeric molecules comprising a CDK4 binding peptide fused to a heterologous peptide or amino acid sequence, preferably a nuclear localization signal. Therapeutic and diagnostic methods are also provided.

Abstract: Pentapeptide compounds are disclosed. The compounds have biological activity, e.g., cytotoxicity. Prodrugs having targeting groups and pentapeptide moieities, as well as precursors thereof are also disclosed. For example, precursors having a reactive linker that can serve as a reaction site for joining to a targeting agent, e.g., an antibody, as disclosed.

Abstract: A method is described for a method for the regioselective liquid-phase pegylation of GRF, which increases the yield of the GRF-PEG conjugate having 1 PEG molecule covalently bound to the e-amino group of Lys12. This method is characterized in that the reaction is carried out in a structuring solvent, such as trifluorethanol.

Abstract: The present invention is a method for a covalent ligation of one or more molecules to one or more surfaces, that is site-specific and both rapid and high yielding. The covalent ligation to the surface is based on the reaction of an azide and a phosphinothioester to form an amide bond. The method of the invention is particularly well-suited to the immobilization of peptides, proteins or protein fragments to surfaces.

Abstract: The present invention provides isolated polypeptides of human p53 that contain mutations. These mutations can be toxic mutations, supertransactivating mutations or tox-suppressor mutations. Further provided by the invention are methods of identifying toxic, supertransactivating, weak transactivating and tox-suppressor mutations as well as methods of identifying compounds that mimic the toxic, supertransactivating and tox-suppressor mutations in human p53. Also provided are methods of inducing toxicity in a cell by administering a polypeptide comprising a supertransactivating or a toxic mutation.

Abstract: The present invention is directed to novel polypeptides encoded by nucleic acids that are differentially expressed in kidney, stomach, and melanoma tumors.

Abstract: The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies which bind to the polypeptides of the present invention and to methods for producing the polypeptides of the present invention.

Abstract: The present invention relates to high molecular weight Dermatophagoides proteins, nucleic acid molecules encoding such proteins, and therapeutic and diagnostic reagents derived from such proteins.

Abstract: The present invention is directed to novel polypeptides and to nucleic acid molecules encoding those polypeptides. Also provided herein are vectors and host cells comprising those nucleic acid sequences, chimeric polypeptide molecules comprising the polypeptides of the present invention fused to heterologous polypeptide sequences, antibodies which bind to the polypeptides of the present invention and to methods for producing the polypeptides of the present invention.

Abstract: Novel vaccines for use against ?-hemolytic Streptococcus colonization or infection are disclosed. The vaccines contain an immunogenic amount of a variant of streptococcal C5a peptidase (SCP). Also disclosed is a method of protecting a susceptible mammal against ?-hemolytic Streptococcus colonization or infection by administering such a vaccine. Enzymatically inactive SCP, and polynucleotides encoding these SCP proteins are further disclosed.

Abstract: The present invention provides novel polynucleotides encoding LSI-01 polypeptides, fragments and homologues thereof. Also provided are vectors, host cells, antibodies, and recombinant and synthetic methods for producing said polypeptides. The invention further relates to diagnostic and therapeutic methods for applying these novel LSI-01 polypeptides to the diagnosis, treatment, and/or prevention of various diseases and/or disorders related to these polypeptides. The invention further relates to screening methods for identifying agonists and antagonists of the polynucleotides and polypeptides of the present invention.

Abstract: The invention provides human high affinity choline transporter polynucleotides and polypeptides and compositions comprising human high affinity choline transporter polynucleotides and polypeptides.

Abstract: A microbial adherence inhibitor in the form of fowl egg antibodies is disclosed, along with the method of making it and methods of using it. The inhibitor functions by substantially preventing the attachment or adherence of colony-forming immunogens in the rumen and intestinal tracts of host food animals. The inhibitor is made by inoculating female birds with the immunogen, harvesting the eggs which contain antibodies to the immunogen, harvesting the eggs which contain antibodies to the immunogen, drying the egg contents and adding to the feed or water for the host animals.

Abstract: A microbial adherence inhibitor in the form of fowl egg antibodies is disclosed, along with the method of making it and methods of using it. The inhibitor functions by substantially preventing the attachment or adherence of colony-forming immunogens in the rumen and intestinal tracts of host food animals. The inhibitor is made by inoculating female birds with the immunogen, harvesting the eggs which contain antibodies to the immunogen, harvesting the eggs which contain antibodies to the immunogen, drying the egg contents and adding to the feed or water for the host animals.

Abstract: The present invention relates to a method for producing patient cancerous disease modifying antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies for therapeutic and diagnostic purposes. The antibodies can be used in aid of staging and diagnosis of a cancer, and can be used to treat primary tumors and tumor metastases. The anti-cancer antibodies can be conjugated to toxins, enzymes, radioactive compounds, and hematogenous cells.

Abstract: The present invention relates to a method for producing patient specific anti-cancer antibodies using a novel paradigm of screening. By segregating the anti-cancer antibodies using cancer cell cytotoxicity as an end point, the process makes possible the production of anti-cancer antibodies customized for the individual patient that can be used for therapeutic and diagnostic purposes. The invention further relates to the process by which the antibodies are made and to their methods of use. The antibodies can be made specifically for one tumor derived from a particular patient and are selected on the basis of their cancer cell cytotoxicity and simultaneous lack of toxicity for non-cancerous cells.

Abstract: The invention provides improved agents and methods for treatment of diseases associated with amyloid deposits of A? in the brain of a patient. Preferred agents include humanized antibodies.

Abstract: The invention relates to the field of apoptosis. The invention provides novel therapeutic possibilities, for example novel combinatorial therapies or novel therapeutic compounds that can work alone, sequentially to, or jointly with Apoptin, especially in those cases wherein p53 is (partly) nonfunctional.

Abstract: This invention pertains to the field of combination oligomers, including the block synthesis of combination oligomers in the absence of a template, as well as related methods, kits, libraries and other compositions.

Abstract: Promoter sequences capable of driving gene expression in plants are presented. The promoters are capable of driving constitutive expression of an associated nucleotide sequence encoding a protein that confers a phenotypic trait. The atRSp41 promoter and promoter fragments are described, and these promoters can be used to create transgenic plants expressing a gene or genes of interest at all times and in most tissues and organs.

Abstract: A nucleic acid sequence encoding Mammastatin, a specific mammary cell growth inhibitor. Mammastatin is encoded by a single nucleic acid sequence and has an approximate molecular weight of 44 kDa in its inactive, non-phosphorylated form. Normal mammary cells express functional phosphorylated forms having approximate molecular weights of 53 kDa and 49 kDa. Metastatic mammary cells either do not express Mammastatin at all, or do not express the 53 kDa or 49 kDa, phosphorylated forms. Mammary cancer cells are inhibited in their growth by the administration of phosphorylated mammastatin.

Abstract: A sialyltransferase having the following physico-chemical properties; (1) Activity: transfers sialic acid from a sialic acid donor selectively to a 3-hydroxyl group of a galactose residue contained in lactosylceramide as a sialic acid acceptor to produce ganglioside GM3; (2) Optimal reaction pH: 6.0 to 7.0; and (3) Inhibition and activation: the activity increases at least 1.5 times with 10 mm of Mn2+ as compared with the case in the absence thereof.