Patents Issued in January 26, 2017
  • Publication number: 20170022456
    Abstract: A cleaning system for laundry which includes a washing agent and a protective agent. The washing agent is configured to remove unwanted matter from the laundry. The protective agent is configured to create a bonded barrier comprising organosilane antimicrobial(s) on the laundry for protection against odors from bacteria, mold and mildew and/or the like. The washing agent and the protective agent are configured to be used in a two-step water-based treatment process in which the washing agent is provided in a given first step of the treatment process and the protective agent is provided in a given subsequent second step of the treatment process.
    Type: Application
    Filed: June 30, 2016
    Publication date: January 26, 2017
    Inventor: Drew Westervelt
  • Publication number: 20170022457
    Abstract: The invention relates to compositions and methods of treatment employing compositions comprising polyelectrolyte complexes. The compositions include a water-soluble first polyelectrolyte bearing a net cationic charge or capable of developing a net cationic charge and a water-soluble second polyelectrolyte bearing a net anionic charge or capable of developing a net anionic charge. The total polyelectrolyte concentration of the first solution is at least 110 millimolar. The composition is free of coacervates, precipitates, latex particles, synthetic block copolymers, silicone copolymers, cross-linked poly(acrylic) and cross-linked water-soluble polyelectrolyte. The composition may be a concentrate, to be diluted prior to use to treat a surface.
    Type: Application
    Filed: October 4, 2016
    Publication date: January 26, 2017
    Applicant: THE CLOROX COMPANY
    Inventors: DAVID R. SCHEUING, THOMAS F. FAHLEN, JARED HEYMANN, MIKE KINSINGER, WILLIAM OUELLETTE, WILLIAM L. SMITH
  • Publication number: 20170022458
    Abstract: The present application relates to perfume compositions, delivery systems comprising such perfumes products comprising such perfumes and/or delivery systems, and processes for making and using same. Such perfume compositions, delivery systems comprising such perfumes and products containing such perfumes and/or delivery systems can deliver a character that can signal/connotes that a situs treated with such materials has superior cleanliness and is essentially asepsis.
    Type: Application
    Filed: July 20, 2016
    Publication date: January 26, 2017
    Inventors: Rafael TRUJILLO, Katrina San Gabriel REYES, Junji HAMANO, Hiroki ITO
  • Publication number: 20170022459
    Abstract: The present application relates to perfume compositions, delivery systems comprising such perfumes products comprising such perfumes and/or delivery systems, and processes for making and using same. Such perfumes and delivery systems provide improved perfume performance under high soil conditions and in cold water washing and a shell that at least partially surrounds said core.
    Type: Application
    Filed: October 6, 2016
    Publication date: January 26, 2017
    Inventors: Hugo Robert Germain DENUTTE, Jonathan Richard CLARE, Javier MEDINA, Philip Andrew CUNNINGHAM, Johan SMETS, Laura ORLANDINI
  • Publication number: 20170022460
    Abstract: This invention relates to cleaning of deposits or scale or fouling from external surface of air coolers tubes bundle. Air coolers in different configurations are used in oil refineries, chemical plants, and power plants to cool process liquids or to condensate gas into liquid. High thermal efficiency of air coolers is critical to maximize production and minimize waste of energy. Current cleaning methods consist on high pressure water blast, soap (detergents), “dry ice” blast or using weak acids. Those methods have significant disadvantages: damage to fins, confined space entry, scaffolding, shut-down of the process unit, and more. The invention is based on On-Line pneumatic spraying of dry thin powder, combining chemical and mechanical cleaning simultaneously. Performing bottom-to-top cleaning obviates the need for water, confined space entry, scaffolding, removal of safety nets.
    Type: Application
    Filed: July 20, 2016
    Publication date: January 26, 2017
    Inventor: Talmor Suchard
  • Publication number: 20170022461
    Abstract: The present invention provides a kit, method, and device for removing an adhesive from a surface that includes a micro-adhesive material, such as a foam, and a solvent composition.
    Type: Application
    Filed: July 18, 2016
    Publication date: January 26, 2017
    Inventor: Joseph Albert PACIFICI
  • Publication number: 20170022462
    Abstract: A beer making system may use direct steam injection during wort manufacturing. Steam may be added directly to the wort, and may be part of a recirculating mash system. The steam may be the primary mechanism for adding heat to the system, and may eliminate many problems that often occur when using conventional heating systems. A water reservoir may feed a stream generator, which may inject steam into wort during mashing or boiling steps.
    Type: Application
    Filed: July 23, 2015
    Publication date: January 26, 2017
    Inventors: James B. Mitchell, Avi R. Geiger
  • Publication number: 20170022463
    Abstract: The invention relates to a method for producing beer from beer granulate according to the following steps, in any order: the beer granules are dissolved in water, carbon dioxide is dissolved in the water.
    Type: Application
    Filed: October 5, 2016
    Publication date: January 26, 2017
    Inventor: Gerhard Kamil
  • Publication number: 20170022464
    Abstract: A microfluidic device for simulating a function or response of a tissue is disclosed. The device includes an inlet for receiving a fluid in the device, and an outlet for removing the fluid from the device. The device further includes a fluid channel in fluid communication with the inlet and the outlet for flowing the fluid through the device. The fluid channel defines a chamber well that receives cells associated with the tissue. The device also includes an interface structure between the fluid channel and the chamber well for permitting migration of at least one of cells, particulates, chemicals, molecules, liquids, or gases between the fluid within the fluid channel and the chamber well.
    Type: Application
    Filed: July 22, 2016
    Publication date: January 26, 2017
    Inventors: Richard Novak, David Conegliano, Liliana Teixeira, Donald E. Ingber
  • Publication number: 20170022465
    Abstract: Disclosed herein is an improved rocked bioreactor system used for carrying out cell and tissue cultures.
    Type: Application
    Filed: July 22, 2016
    Publication date: January 26, 2017
    Inventor: Timothy Ray Ho
  • Publication number: 20170022466
    Abstract: An improved dry grind system and method for producing a sugar stream from grains or similar carbohydrate sources and/or residues, such as for biofuel production. In particular, a sugar/carbohydrate stream, which includes a desired Dextrose Equivalent (DE) where DE describes the degree of conversion of starch to dextrose (aka glucose) and/or has had removed therefrom an undesirable amount of unfermentable components, can be produced after saccharification and prior to fermentation (or other sugar conversion process), with such sugar stream being available for biofuel production, e.g., alcohol production, or other processes. In addition, the systems and methods also can involve the removal of certain grain components, e.g., corn kernel components, including protein, oil and/or fiber, prior to fermentation or other conversion systems. In other words, sugar stream production and/or grain component separation occurs on the front end of the system and method.
    Type: Application
    Filed: August 5, 2016
    Publication date: January 26, 2017
    Inventors: Neal Jakel, John Kwik, Michael Franko, Andrew Whalen
  • Publication number: 20170022467
    Abstract: A method and apparatus for carrying out measurements on single cells, either one or many single cells at a time in order to characterize the cellular response to stimuli in a perfused liquid. The apparatus for performing the respirometry includes a double-barrel pipette probe.
    Type: Application
    Filed: April 17, 2015
    Publication date: January 26, 2017
    Applicant: Drexel University
    Inventors: Zulfiya Orynbayeva, Gennady Friedman, Yuri Gogotsi, Yang Gao
  • Publication number: 20170022468
    Abstract: A modular incubator comprising a housing structure divided into cells and having several incubator modules, each of which can be housed, in a removable manner, in a relative cell and is provided with an incubation chamber to incubate microbiological or cellular cultures. Each cell has a first group of connectors and each incubator module has a second group of connectors, each of which can be coupled to a corresponding connector of the first group of connectors of the relative cell when the incubator module is housed in said cell. The first group of connectors has at least one pneumatic connector communicating with at least one source of aeriform substance, and the second group of connectors has a corresponding pneumatic connector communicating with the relative incubation chamber to allow the aeriform substance to be introduced into the incubation chamber.
    Type: Application
    Filed: April 22, 2016
    Publication date: January 26, 2017
    Applicant: Comecer S.p.A.
    Inventors: Massimiliano Cesarini, Filippo Galassi, Alessia Zanelli
  • Publication number: 20170022469
    Abstract: A cell culturing apparatus according to the present invention includes a culture-medium retaining unit that retains a culture medium for culturing a cell, a culture bag provided with a feed port and a discharge port, a culture-medium feeding unit that connects the culture-medium retaining unit and the feed port and that feeds the culture medium from the culture-medium retaining unit to the culture bag, a negative-pressure supplying unit that supplies negative pressure to the discharge port, and a waste retaining unit that retains the culture medium from the discharge port.
    Type: Application
    Filed: July 13, 2016
    Publication date: January 26, 2017
    Applicant: OLYMPUS CORPORATION
    Inventors: Hiroyuki KIMURA, Tatsuya MINAMI, Yasunori MAKARA
  • Publication number: 20170022470
    Abstract: The present invention relates to a method of analysis comprising the preparation and the analysis of a sample in a flexible container without direct handling of the sample and without reopening the flexible container at the end of the preparation of the sample, and also to a container and a kit that enable the implementation of this method.
    Type: Application
    Filed: April 3, 2015
    Publication date: January 26, 2017
    Inventors: Roberto CALEMCZUK, David CARRARA, Thierry LIVACHE, Thibaut MERCEY, Félix PIAT, Yoann ROUPIOZ, Sami SLIMANI
  • Publication number: 20170022471
    Abstract: A method for stem or progenitor cell culture. More precisely, the invention relates to a method for cell culture using one or more I?I (inter-alpha trypsin inhibitor or inter-alpha inhibitor) protein(s) or part(s) thereof as a component in a cell culture media or a coating on a cell culture surface material. Furthermore the invention relates to a cell culture media and a cell culture coating/matrix provided with one or more I?I proteins(s) or part(s) thereof.
    Type: Application
    Filed: October 7, 2016
    Publication date: January 26, 2017
    Inventors: Sara Pijuan Galito, Christoffer Tamm, Cecilia Anneren
  • Publication number: 20170022472
    Abstract: The invention is directed to producing large numbers of cells using hollow fiber bioreactor technology. The cells are non-embryonic stem, non-germ cells that can be characterized by one or more of the following: extended replication in culture and markers of extended replication, such as telomerase, markers of pluripotentiality, and broad differentiation potential, without being transformed.
    Type: Application
    Filed: September 16, 2016
    Publication date: January 26, 2017
    Applicant: ReGenesys BVBA
    Inventors: Jozef Albert Martha PINXTEREN, David CRAEYE
  • Publication number: 20170022473
    Abstract: A polypeptide including: (1) a first region containing at least one selected from the group consisting of an amino acid sequence represented by CSYYQSC (SEQ ID NO:1) and an amino acid sequence represented by RGD; and (2) a second region containing (2-i) an amino acid sequence represented by PRPSLAKKQRFRHRNRKGYRSQRGHSRGRNQN (SEQ ID NO:2), (2-ii) an amino acid sequence having an identity of not less than 50% to the amino acid sequence represented by SEQ ID NO:2 and having an adsorption ability to a cultivation container, or (2-iii) an amino acid sequence that is the amino acid sequence represented by SEQ ID NO:2 in which from 1 to 30 amino acid residues are added, substituted, or deleted, and has an adsorption ability to a cultivation container, in which the polypeptide includes from 40 to 450 amino acid residues.
    Type: Application
    Filed: October 12, 2016
    Publication date: January 26, 2017
    Applicant: FUJIFILM Corporation
    Inventors: Yuta MURAKAMI, Rie IWATA, Yoshihide IWAKI, Tasuku SASAKI
  • Publication number: 20170022474
    Abstract: Disclosed herein are cell cultures comprising dorsal and/or ventral PDX1-positive foregut endoderm cells and methods of producing the same. Also disclosed herein are cell populations comprising substantially purified dorsal and/or ventral PDX1-positive foregut endoderm cells as well as methods for enriching, isolating and purifying dorsal and/or ventral PDX1-positive foregut endoderm cells from other cell types. Methods of identifying differentiation factors capable of promoting the differentiation of dorsal and/or ventral PDX1-positive foregut endoderm cells, are also disclosed.
    Type: Application
    Filed: October 11, 2016
    Publication date: January 26, 2017
    Applicant: ViaCyte, Inc.
    Inventors: Kevin Allen D'Amour, Alan D. Agulnick, Susan Eliazer, Emmanuel E. Baetge
  • Publication number: 20170022475
    Abstract: Disclosed herein are compositions, systems, and methods for modulating proliferation, differentiation and pluripotency of cells.
    Type: Application
    Filed: April 7, 2015
    Publication date: January 26, 2017
    Applicant: Memorial Sloan Kettering Cancer Center
    Inventors: Lydia W.S. FINLEY, Bryce W. CAREY, Craig B. THOMPSON, C. David ALLIS
  • Publication number: 20170022476
    Abstract: The present disclosure relates generally to methods and compositions useful in cell and tissue biology and therapeutics. In particular, an in vitro method for differentiating pluripotent cells into endothelial colony forming cell-like cells (ECFC-like cells) is provided. A purified human cell population of NRP-1+CD31+ ECFC-like cells is provided, wherein at least some of the cells in the population have a high proliferation potential. Therapeutic and test agent screening methods for using the cell populations of the present disclosure are provided.
    Type: Application
    Filed: March 11, 2015
    Publication date: January 26, 2017
    Inventors: Mervin Yoder, Nutan Prasain
  • Publication number: 20170022477
    Abstract: A culture medium for animal cells for enhancing a metabolism activity of the TCA cycle (tricarboxylic acid cycle) in respiration of the animal cells includes, as effective components, amino acids metabolized to succinyl CoA that is an element constituting the TCA cycle at a concentration of 2.3 mmol/L to 6.0 mmol/L.
    Type: Application
    Filed: October 7, 2016
    Publication date: January 26, 2017
    Applicant: TOYO SEIKAN GROUP HOLDINGS, LTD.
    Inventors: Kyohei Ota, Satoshi Tanaka
  • Publication number: 20170022478
    Abstract: The present invention provides methods for producing cell populations enriched for stable, regulatory T cells (Tregs). In particular, the invention relates to methods for culturing T cells such that the final culture is enriched for stable, regulatory T cells. It also relates to methods for stabilizing regulatory T cells. Also provided are compositions enriched for stable, regulatory T cells, which are useful for treating individuals in need of such treatment. The methods and compositions disclosed herein can also be used to treat an individual suffering from an immune-mediated disease.
    Type: Application
    Filed: October 4, 2016
    Publication date: January 26, 2017
    Inventors: Yong Chan Kim, Ethan Shevach
  • Publication number: 20170022479
    Abstract: Methods of purifying an adenovirus from an impure preparation are provided. In some embodiments, a combination of mixed mode chromatography and anion exchange chromatography is used to purify the adenovirus.
    Type: Application
    Filed: July 24, 2015
    Publication date: January 26, 2017
    Inventor: Mark Irwin Fitchmun
  • Publication number: 20170022480
    Abstract: A method of purification of non-enveloped or pseudo-enveloped virus produced in vitro uses a composition with at least one detergent. A method of purification can use multiple detergents, and a method of determining the presence and/or level of a non-enveloped or pseudo-enveloped virus in a sample includes treating with at least one detergent.
    Type: Application
    Filed: July 19, 2016
    Publication date: January 26, 2017
    Inventors: BRETT BUNO, TERRI JOURNIGAN, JOANN HOTTA, MICHAEL BURDICK
  • Publication number: 20170022481
    Abstract: Polybrene as an additive in cell culture medium is used in methods for the generation of high-titer hepatitis E virus stocks and assays for titration of hepatitis E virus. A cell culture medium containing polybrene is used for high-titer HEV generation, a method for determining the presence and/or the level of HEV in a sample, and an HEV titration assay using polybrene.
    Type: Application
    Filed: July 19, 2016
    Publication date: January 26, 2017
    Inventors: BRETT BUNO, TERRI JOURNIGAN, JOANN HOTTA, MICHAEL BURDICK
  • Publication number: 20170022482
    Abstract: The present invention relates to a novel method for improving the viral safety of liquid Factor VII compositions, in particular those comprising active Factor VII polypeptides (a Factor VIIa polypeptide).
    Type: Application
    Filed: October 5, 2016
    Publication date: January 26, 2017
    Inventors: Jesper Christensen, Erik Halkjaer, Turid Preuss, Thomas Budde Hansen, Lene Vaedele Madsen Tomoda, Nina Johansen
  • Publication number: 20170022483
    Abstract: There is provided a method of producing a stabilized microcrystalline cellulose powder containing catalase enzyme. In the method, cellulose is thoroughly mixed with phosphate borate and catalase, rinsed with water and a surfactant added. The stabilized powder may be mixed with various skin solutions (lotions, ointments and the like). The catalase enzyme can catalyze the reaction of peroxide to oxygen.
    Type: Application
    Filed: October 4, 2016
    Publication date: January 26, 2017
    Inventors: Bhalchandra M. Karandikar, Sunita J. Macwana, Zhongju Liu Zhao
  • Publication number: 20170022484
    Abstract: The present disclosure provides engineered transaminase polypeptides for the production of amines, polynucleotides encoding the engineered transaminases, host cells capable of expressing the engineered transaminases, and methods of using the engineered transaminases to prepare compounds useful in the production of active pharmaceutical agents.
    Type: Application
    Filed: October 11, 2016
    Publication date: January 26, 2017
    Inventors: Weng Lin Tang, Helen Hsieh, Son Pham, Derek Smith, Steven J. Collier
  • Publication number: 20170022485
    Abstract: The present invention relates to a Truncated isoform of Anaplastic Lymphoma Kinase (“TALK”). Expression of this isoform is associated with malignancy and with responsiveness to ALK inhibitors. Detection of the isoform may be used in diagnostic and therapeutic methods. Because it arises as a result of variant transcription rather than genetic rearrangement, its presence would be undetected by genomic testing.
    Type: Application
    Filed: October 7, 2016
    Publication date: January 26, 2017
    Inventors: Ping Chi, Thomas Wiesner, Yu Chen
  • Publication number: 20170022486
    Abstract: The present invention relates to the field of genetic engineering, in particular, the present invention relates to a method for producing a phytase variant with an improved thermal stability, and a phytase variant and the use thereof. The phytase variant contains at least one proline modification, compared to the phytase from Escherichia coli and other mutants thereof. The phytase variants with the modification have preferably improved properties, such as the thermal stability, optimal reaction temperature, pH property, specific activity, protease resistance and performance in animal feeds.
    Type: Application
    Filed: November 12, 2013
    Publication date: January 26, 2017
    Inventors: BIN YAO, HUOQING HUANG, HUIYING LUO, CHAO SHAO, YINGGUO BAI, YARU WANG, PEILONG YANG, PENGJUN SHI, KUN MENG, HENG ZHAO, RUI MA
  • Publication number: 20170022487
    Abstract: Novel synthetic catalytic structures or “synzymes,” e.g., fatty acid modified polypeptides, with catalytic properties are provided. It is believed that these synthetic catalytic structures mimic some of the precise conformational changes necessary for catalytic activities seen in enzymes. The catalytic properties of these synthetic catalytic structures or synzymes can be further improved by the application of controlled external forces, e.g., electric fields, or fluidized bed.
    Type: Application
    Filed: April 1, 2015
    Publication date: January 26, 2017
    Inventors: Michael J. Heller, Tsukasa Takahashi, Edward Lewis Sheldon, III
  • Publication number: 20170022488
    Abstract: Compositions and methods comprising polynucleotides and polypeptides having meganuclease activity are provided. Further provided are nucleic acid constructs, yeast, plants, plant cells, explants, seeds and grain having the meganuclease sequences. Various methods of employing the meganuclease sequences are provided. Such methods include, for example, methods for producing a meganuclease with increased activity at a wide range of temperatures, methods for producing a yeast, plant, plant cell, explant or seed comprising a meganuclease with increased activity.
    Type: Application
    Filed: October 11, 2016
    Publication date: January 26, 2017
    Inventors: ERICKA BERMUDEZ, ANDREW MARK CIGAN, JAMES ENGLISH, CARL FALCO, HUIRONG GAO, LU LIU, ZHAN-BIN LIU, AZALEA ONG, SERGEI SVITASHEV, JOSHUA K YOUNG
  • Publication number: 20170022489
    Abstract: The present invention relates to hybrid polypeptides having cellobiohydrolase activity. The present invention also relates to polynucleotides encoding the hybrid polypeptides; nucleic acid constructs, vectors, and host cells comprising the polynucleotides; and processes of using the hybrid polypeptides.
    Type: Application
    Filed: October 6, 2016
    Publication date: January 26, 2017
    Applicant: NOVOZYMES, INC.
    Inventors: Ye Liu, Tarana Shaghasi
  • Publication number: 20170022490
    Abstract: The present invention provides methods and compositions comprising at least one neutral metalloprotease enzyme that has improved storage stability. In some embodiments, the neutral metalloprotease finds use in cleaning and other applications. In some particularly preferred embodiments, the present invention provides methods and compositions comprising neutral metalloprotease(s) obtained from Bacillus sp. In some more particularly preferred embodiments, the neutral metalloprotease is obtained from B. amyloliquefaciens. In still further preferred embodiments, the neutral metalloprotease is a variant of the B. amyloliquefaciens neutral metalloprotease. In yet additional embodiments, the neutral metalloprotease is a homolog of the the B. amyloliquefaciens neutral metalloprotease. The present invention finds particular use in applications including, but not limited to cleaning, bleaching and disinfecting.
    Type: Application
    Filed: April 8, 2016
    Publication date: January 26, 2017
    Applicant: Danisco US Inc.
    Inventors: Andrew Shaw, Louise Wallace, David A. Estell, Ronaldus W.J. Hommes, Sang-Kyu Lee, Hiroshi Oh, Eugene S. Sadlowski
  • Publication number: 20170022491
    Abstract: Provided are a method for regulating acid resistance of a microorganism by suppressing the expression of the fadD gene therein and a screening method for a microorganism having acid resistance by using the expression level of the fadD gene as an index. A method for regulating acid resistance of a microorganism, including suppressing the expression of fadD gene present in the microorganism.
    Type: Application
    Filed: December 3, 2014
    Publication date: January 26, 2017
    Applicant: KABUSHIKI KAISHA YAKULT HONSHA
    Inventors: Hoshitaka MATSUMOTO, Mika MIURA, Mayumi KIWAKI, Tohru IINO
  • Publication number: 20170022492
    Abstract: Method, composition, kit and system for isolating amplifiable nucleic acid from specimens preserved in a liquid-based cytology preservative that contains formaldehyde. The technique relies on the use of 2-imidazolidone and a protease enzyme, such as proteinase K, at elevated temperatures. Advantageously, RNA can be isolated and used as a template in nucleic acid amplification reactions.
    Type: Application
    Filed: March 21, 2014
    Publication date: January 26, 2017
    Inventors: Deborah C. JENSEN, Brett W. KIRKCONNELL, Timothy J. WILSON
  • Publication number: 20170022493
    Abstract: Methods and reagents are provided for the rapid extraction of nucleic acids from a cell or tissue sample. In certain embodiments the sample comprises a formalin fixed paraffin embedded sample (e.g., a FFPET sample), or a fine needle aspirate and/or a cell/tissue smear. In some embodiments, the methods comprise incubating one or more sections of said tissue sample in a lysis solution comprising a buffer sufficient to maintain the pH of said solution at a pH ranging from about pH 4 to about pH 9; a chaotropic agent; a chelating agent; and a detergent; where the incubating is at a temperature ranging from about 50° C. to about 100° C.; and recovering the nucleic acid from said lysis solution.
    Type: Application
    Filed: July 12, 2016
    Publication date: January 26, 2017
    Inventor: KENNETH E. HO
  • Publication number: 20170022494
    Abstract: The present invention is based, at least in part, on the development of a mating-based yeast two-hybrid screen that allows simultaneous screening for mutations that disrupt yeast two-hybrid interactions between a protein and multiple interacting partners. By coupling PCR mutagenesis and homologous recombination/gapped plasmid repair with a mating-based assay, the present invention allows screening for unique mutations that disrupt interaction with one partner, but not others. It also allows identification of specific mutations that may lie at protein-protein interfaces common to two or more partners, without employing multiple rounds of screening. In addition to screening against multiple interacting partners, the present invention removes the need for a two-step selection because truncations, frameshifts, or any mutations that affect folding are eliminated as disruptions that affect all protein partners.
    Type: Application
    Filed: February 1, 2016
    Publication date: January 26, 2017
    Inventors: R. Blake Hill, Cara Marie Manlandro
  • Publication number: 20170022495
    Abstract: The present invention is directed to RNA interference (RNAi) molecules targeted against a nucleic acid sequence, and methods of using these RNAi molecules to reduce off-target toxicity.
    Type: Application
    Filed: August 27, 2013
    Publication date: January 26, 2017
    Applicant: University of Iowa Research Foundation
    Inventors: Beverly L. Davidson, Alejandro Mas Monteys, Jodi L. McBride, Ryan Boudreau
  • Publication number: 20170022496
    Abstract: The present invention relates to an avian influenza virus miRNA and the identification, detection and application thereof. In particular, a kind of specific microRNA, miR-HA-3p, is screened for the first time through detecting the microRNA expression levels in samples of animals with avian influenza. The experiments prove that the miR-HA-3p, as a microRNA marker, can be very effective in detecting avian influenza virus and avian influenza. Furthermore, inhibiting the function of miR-HA-3p can be very effective in relieving symptoms of avian influenza and treating avian influenza. The microRNA revealed in the present invention for the first time can be developed into a detection agent and a therapeutic agent as well as the corresponding kits for the detection and treatment of avian influenza (e.g., H5N1).
    Type: Application
    Filed: December 9, 2014
    Publication date: January 26, 2017
    Inventors: Chenyu ZHANG, Ke ZENG, Jin WANG, Li XIHAN
  • Publication number: 20170022497
    Abstract: The present invention is directed compositions for delivery of RNA interference (RNAi) triggers to integrin positive tumor cells in vivo. The compositions comprise RGD ligand-targeted amphipathic membrane active polyamines reversibly modified with enzyme cleavable dipeptide-amidobenzyl-carbonate masking agents. Modification masks membrane activity of the polymer while reversibility provides physiological responsiveness. The reversibly modified polyamines (dynamic polyconjugate or conjugate) are further covalently linked to an RNAi trigger.
    Type: Application
    Filed: September 28, 2016
    Publication date: January 26, 2017
    Inventors: David B. Rozema, So Wong, Weijun Cheng, Aaron M. Almeida, Andrei V. Blokhin, Jeffrey C. Carlson
  • Publication number: 20170022498
    Abstract: The present invention relates, in general, to gene expression and, in particular, to a method of inhibiting the expression of a target gene and to constructs suitable for use in such a method.
    Type: Application
    Filed: October 5, 2016
    Publication date: January 26, 2017
    Applicant: DUKE UNIVERSITY
    Inventors: Bryan R. CULLEN, Yan ZENG
  • Publication number: 20170022499
    Abstract: Various aspects and embodiments of the present disclosure relate to methods and compositions that combine multiple mammalian RNA regulatory strategies, including RNA triple helix structures, introns, microRNAs, and ribozymes with Cas-based CRISPR transcription factors and ribonuclease-based RNA processing in human cells. The methods and compositions of the present disclosure, in some embodiments, enable multiplexed production of proteins and multiple guide RNAs from a single compact RNA-polymerase-II-expressed transcript for efficient modulation of synthetic constructs and endogenous human promoters.
    Type: Application
    Filed: April 3, 2015
    Publication date: January 26, 2017
    Applicant: Massachusetts Institute of Techology
    Inventors: Timothy Kuan-Ta Lu, Lior Nissim, Samuel David Perli
  • Publication number: 20170022500
    Abstract: Provided are: a targeting molecule targeting a target cell which is selected from the group consisting of a stellate cell, a myofibroblast, a cancer-associated fibroblast, a tumor cell and a cell expressing STRA6, said targeting molecule being selected from the group consisting of (1) a peptide containing an amino acid sequence in the cell-binding region of RBP, (2) a variant peptide of the aforesaid peptide (1), said variant peptide having a comparable targetability to peptide (1), and (3) a peptide mimetic having a comparable targetability to peptide (1) or peptide (2); a targeting agent, a carrier, a complex and a medicinal composition each comprising the targeting molecule; a method for treating, examining, diagnosing or monitoring a disease related to the aforesaid target cell; a method for labeling, detecting or imaging the target cell, etc.
    Type: Application
    Filed: April 1, 2015
    Publication date: January 26, 2017
    Inventors: Kenjiro Minomi, Hirokazu Takahashi, Erika Terada, Yoshiro Niitsu
  • Publication number: 20170022501
    Abstract: This invention provides methods of preventing formation of, or treating, fibrotic lesions, including skin scars such as keloids and hypertrophic scars which comprise administering to the subject by one or more injection a compound which comprises a modified oligonucleotide, such as a modified antisense oligonucleotide, siRNA, or oligodeoxyribonucleotide, which inhibits expression of protein involved in fibrosis. Dosing of the antisense using an intradermal threading technique is also described.
    Type: Application
    Filed: September 25, 2015
    Publication date: January 26, 2017
    Applicant: EXCALIARD PHARMACEUTICALS, INC.
    Inventors: Nicholas M. Dean, Lincoln Krochmal, Gregory Hardee, J. Gordon Foulkes, Niall O'Donnell, Leroy Young, Mark Jewell
  • Publication number: 20170022502
    Abstract: Certain disclosed oligomers induce exon skipping during processing of myostatin pre-mRNA. The oligomers may be in a vector or encoded by the vector. The vector is used for inducing exon skipping during processing of myostatin pre-mRNA. A therapeutically effective amount of the oligomer may be administered to a subject patient such that exon skipping during processing of myostatin pre-mRNA is induced. The administration to a subject may be used in order to increase or maintain muscle mass, or slowing degeneration of muscle mass in the subject. The administration to a subject may ameliorate muscle wasting conditions, such as muscular dystrophy.
    Type: Application
    Filed: March 23, 2016
    Publication date: January 26, 2017
    Applicant: Royal Holloway And Bedford New College
    Inventors: John George Dickson, Jagjeet Kaur Kang
  • Publication number: 20170022503
    Abstract: The present invention provides methods and agents for modulating WARS2 expression, WARS2 activity, or a combination thereof, thereby modulating angiogenesis. Also provided herein are methods for identifying individuals who could benefit from agents that modulate WARS2 expression, WARS2 activity, or a combination thereof.
    Type: Application
    Filed: March 13, 2015
    Publication date: January 26, 2017
    Inventor: Stuart A. Cook
  • Publication number: 20170022504
    Abstract: This invention relates to long non-coding RNAs (lncRNAs), libraries of those ncRNAs that bind chromatin modifiers, such as Polycomb Repressive Complex 2, inhibitory nucleic acids and methods and compositions for targeting lncRNAs.
    Type: Application
    Filed: June 2, 2016
    Publication date: January 26, 2017
    Inventors: Jeannie T. Lee, Jing Zhao, Kavitha Sarma, Mark Borowsky, Toshiro Kendrick Ohsumi
  • Publication number: 20170022505
    Abstract: The invention provides novel compounds and conjugates of these compounds useful for the delivery of biologically active substances. Further novel design criteria for chemically stabilized siRNA particular useful when covalently attached to a delivery polymer to achieve in vivo mRNA knock down are disclosed therein.
    Type: Application
    Filed: April 4, 2016
    Publication date: January 26, 2017
    Applicant: Hoffmann-La Roche Inc.
    Inventors: Philipp Hadwiger, Torsten Hoffmann, Kerstin Jahn-Hofmann, Eric A. Kitas, David L. Lewis, Peter Mohr, Hans Martin Mueller, Guenther Ott, Ingo Roehl, David B. Rozema