Abstract: There is provided a method of identifying DNA responsible for conferring a particular phenotype in a cell which method comprises a) constructing a cDNA or genomic library of the DNA of the cell in a suitable vector in an orientation relative to a promoter(s) capable of initiating transcription of the cDNA or DNA to double stranded (ds) RNA upon binding of an appropriate transcription factor to the promoter(s), b) introducing the library into one or more of the cells comprising the transcription factor, and c) identifying and isolating a particular phenotype of the cell comprising the library and identifying the DNA or cDNA fragment from the library responsible for conferring the phenotype.

Abstract: The invention herein generally relates to kits and methods for detecting the presence of a bacterium in a subject, for example, methicillin resistant S. aureus.

Abstract: Methods and devices are provided for the rapid and specific detection of target microorganisms, cells, and the like. In one embodiment, the methods involve contacting a target microorganism (e.g., in a sample) with a permeabilization reagent that selectively permeabilizes or lyses the microorganism; contacting the selectively permeabilized microorganism with a detection reagent that is taken into the selectively permeabilized organism or that contacts metabolites or enzymes released by the selectively permeabilized microorganism, where the detection reagent produces a signal in the presence of said metabolites or enzymes; and detecting a signal produced by the detection reagent in the presence of the metabolites or enzymes wherein the strength of the signal indicates the presence and/or amount of the target microorganism in the sample.

Abstract: Devices and methods for the detection of antigens are disclosed. Devices and methods for detecting food-borne pathogens are disclosed.

Abstract: The present invention relates to blood group A/B/H determinant on Type 1 Core glycosphingolipids chains as recognition point for the FedF protein of F18-fimbriated Enterotoxigenic and verotoxinogenic Escherichia coli and the use of compounds comprising such determinants for the treatment of F18? E. coli infections in pigs and in screening methods.

Abstract: Devices and methods for the detection of antigens are disclosed. Devices and methods for detecting food-borne pathogens are disclosed.

Abstract: The present invention relates to bacteriophage tail proteins and the derivatives and fragments thereof that are capable of binding endotoxins in the absence of bivalent positive ions, especially Ca2+ or Mg2+. Further, the present invention relates to methods for depleting endotoxins from solutions and samples using the bacteriophage tail proteins according to the present invention and to a detection method for endotoxins.

Abstract: The present disclosure provides systems for the rapid and sensitive detection of organisms and molecules in samples. Reactants that produce Raman-active products are used in combination with Raman light scattering. The present disclosure can also be used to measure enzyme-kinetics.

Abstract: Filamentous phage comprising a matrix of cpVIII proteins encapsulating a genome encoding first and second polypeptides of an antogenously assembling receptor, such as an antibody, and a receptor comprised of the first and second polypeptides surface-integrated into the matrix via a filamentous phage coat protein membrane anchor domain fused to at least one of the polypeptides.

Abstract: The present invention is directed to satisfying the need to detect microbial contamination of food products. The described bioseparator/bioreactor coupled with an optical/electrochemical biosensor was able to specifically detect E. coli O157:H7 from 8.8×101 to 8.8×106 CFU/ml in 2.5 hours without any enrichment. Using this invention, concentrations of S. Typhimurium ranging from 8.6×102 to 8.6×106 CFU/ml in pure culture were detected in 2 hours without any enrichment. The invention may also be used for the detection of S. Seftenberg, which has the same sensitivity as S. Typhimurium. Other pathogens such as L. monocytogenes and S. Heidleberg did not interfere with the detection. The optimum inner diameter of the 25 cm long column for the detection of E. coli O157:H7 is 250 ?m.

Abstract: The invention provides means and methods for determining the presence of infecting microbes in a liquid. The method comprises steps of introducing the liquid to the sample container of a microbial analyzer, the sample container further containing nutrients. Other steps include carrying out a first incubation of said specimen, adding bioluminescent tester microbes to the specimen, carrying out a second incubation of the specimen and measuring bioluminescence, thereby determining said presence and/or concentration of infecting microbes.

Abstract: This invention provides methods for concentration of analyte from biological sample, or various liquid samples and methods for identification of the analyte. The method includes providing silica beads conjugated with analyte recognition element for concentration of analyte from sample, packaging the beads into a cartridge, and attaching the cartridge to a sample holder. After the analyte concentration, additional steps can be implemented to identify the analyte to provide visual positive/negative, qualitative or quantitative results. Another exemplary embodiment of the present invention provides a system for concentration of analyte from biological sample or other various liquid samples using silica beads. According to an exemplary implementation, the system includes a cartridge comprising silica beads conjugated with analyte recognition element to concentrate at least one analyte from the sample, and a sample holder having the cartridge attached thereto. A sample is passed through the cartridge.

Abstract: Provided herein are imaging methods for detecting, diagnosing and imaging pathogenic bacteria or a pathophysiological condition associated therewith using fluorogenic substrates for bacterial enzymes. Fluorescent, luminescent or colorimetric signals emitted by substrates or enzyme products in the presence of the bacteria are compared to controls to detect and locate the pathogenic bacteria. Provided is a method for screening therapeutic agents to treat the pathophysiological conditions by measuring a signal emitted from the fluorogenic substrates or products in the presence and absence of the potential therapeutic agent. In addition, a diagnostic method for detecting a mycobacterial infection in a subject by contacting biological samples with a fluorogenic substrate and imaging for signals emitted from a mycobacterial beta-lactamase product.

Abstract: The invention provides an atomic force microscope-based bioassay, assisted by thermodynamic characterizations to quickly and accurately screen for compounds that disrupt cell-cell or cell-substrate interactions.

Abstract: The present invention relates to human specific Escherichia coli strains.

Abstract: An antibody which reacts with N-acetylheparosan and heparan sulfate that is derived from bovine kidney but does not substantially react with heparan sulfate derived from a murine Engelbreath-Holm-Swarn tumor tissue, the antibody being produced with a hybridoma which is prepared using a substance composed of a protein and N-acetylheparosan bound to the protein.

Abstract: The invention provides methods for identifying a compound that inhibits cytochrome c synthesis. This invention further provides a method for the high throughput screening of compounds that inhibit cytochrome c synthesis.

Abstract: A method of detecting target cells and pathogens in a test sample concentrates to target cells in solution by filtering or capturing the target cells on a solid support. The target cells are tagged with a fluorescent dye and dispersed in a solution or suspension. The resulting solution or suspension are introduced to a fluorometer to specifically identify and quantitate the target cells. The target cells can be lysed or whole when introduced to the fluorometer.

Abstract: This invention concerns novel antibiotic peptide and peptide derivates, especially for use in medicine. Further, the invention relates to compositions and methods for killing microbes, like bacteria or fungus, and methods to treat microbial infections. The invention further relates to a method for drug screening analysis. The peptides and peptide derivates have the general formula Sub1-X1 N X2 X3 P V Y I P X4 X5 R P P H P-Sub2 wherein X1 is a neutral or positively charged moiety, X2 is a polar or positively charged moiety, X3 is a positively charged moiety, X4 is a polar or positively charged moiety, X5 is a proline or a proline derivate, Sub1 being the free or modified N-terminus, and Sub2 being the free or modified C-terminus.

Abstract: The invention provides methods and compositions for the detection of Ehrlichia chaffeensis.

Abstract: The invention provides for devices and methods for detecting an organism causing a urinary tract infection. In a preferred embodiment, detecting the organism causing a urinary tract infection follows a preliminary indication of a urinary tract infection by a urinary monitoring device to monitor for the presence or absence of markers indicative of a urinary tract infection. The invention also provides for methods of using such devices.

Abstract: An assay test solution, a method for using, and an apparatus for the rapid detection of multiple pathogens using a FRET-based phenomenon. A volume of fluid, possibly containing pathogens, is passed through an intake and combined with an assay solution of quantum dot/antibody-antigen/quencher complexes that dissociate and recombine with the pathogens into quantum dot/antibody-pathogen complexes. The quantum dot/antibody-antigen/quencher and quantum dot/antibody-pathogen complexes are captured on a detection filter which is illuminated by a light source. The quantum dot/antibody-pathogen complexes, but not the quantum dot/antibody-antigen/quencher complexes, fluoresce when excited by the light from the light source and the fluorescence is picked up by a photodetector, indicating the presence of the pathogens.

Abstract: Multiplexed lateral flow assays, related methods, and devices are disclosed which are capable of simultaneously detecting multiple analytes. The assays are preferably immunoassays and can be multiplexed spatially, spectrally, and both spatially and spectrally. Multiplexed assays are disclosed employing quantum dots for applications including the detection of human proteins and the monitoring of microorganisms relevant to water contamination. The multiplexed assays can employ one or more species of Surface Enhanced Raman Scattering nanoparticles, with one or more species having a unique Raman shift spectrum. The invention is widely adaptable to a variety of analytes such as biowarfare agents, human clinical markers, and other substances.

Abstract: The present invention provides compositions including peptide display scaffolds that present at least one candidate peptide and at least one detectable moiety in at least one of the N-terminal and C-terminal candidate peptide presenting domains that when expressed in a cell are accessible at a surface of the cell outermembrane. In addition, the present invention also provides kits and methods for screening a library of cells presenting the candidate peptides in peptide display scaffolds to identify a ligand for an enzyme.

Abstract: The present invention is directed to methods, assays and compositions for implementing such methods and assays for assessing efficacy of individual components in multi-component vaccines and for assessing efficacy of a vaccine against a pathogen. In one aspect, the method of assessing efficacy of a vaccine against a pathogen is a quick assay that tests for an activity correlated with efficacy such as binding in an ELISA rather than requiring the time and expense of an assay that detects actual bactericidal activity. In another aspect, the method for testing the efficacy of an individual component in a multi-component vaccine includes obtaining an immune sample from a subject inoculated with the multi-component vaccine; blocking the portion of the immune sample that recognizes the individual component such as by addition of the individual component, and testing the efficacy of the immune sample to respond to the pathogen.

Abstract: A method for detecting a microorganism in a sample containing or suspected of containing said microorganism, said method comprising: i) contacting said sample with a binding agent for said microorganism, wherein the binding agent is immobilised on a support, and allowing the binding agent to bind microorganism to form an immobilised complex; ii) separating the sample from the immobilised complex; iii) contacting the support with a liquid medium and a reagent which removes which eliminates, inactivates or inhibits a contaminant that may interfere with a microorganism detection assay; and iv) detecting microorganisms retained on the support using said microorganism detection assay.

Abstract: The present invention provides a method for the treatment and/or prevention of bacterial infection caused by klebsiella pneumoniae and other gram-negative bacteria in central nervous system and/or peripheral blood circulation in a mammal by administering effective amount of outer membrane protein A (OmpA) or its derivatives to a mammal. Also provided are a method for vaccinating a mammal to produce an antibody against bacterial infection caused by Enterobacteriaceae family in central nervous system and/or peripheral blood circulation and a method of detecting or diagnosing bacterial infections caused by Enterobacteriaceae family in central nervous system and/or peripheral blood circulation in a mammal.

Abstract: Assay systems and methods are provided for detecting a target pathogen, such as a microorganism (e.g., bacterium, bacterial toxin) which may be present in a fluid or other location. The method can include linking a magnetic microparticle to a first epitope of the target microorganism in a fluid via a first antibody; utilizing a magnetic field to separate the magnetic microparticle and linked targeted microorganism from at least a portion of other components in the fluid, thereby forming a test sample; linking a glucose molecule to a second epitope of the target microorganism via a second antibody; and detecting the glucose in the test sample to determine the presence or concentration of the target microorganism in the fluid. The glucose detection preferably is one that can be done rapidly, e.g., with a conventional glucometer, and may include measuring the electrical resistance, color, or pH of the test sample.

Abstract: The present invention relates to compositions and methods for analyzing and modulating (e.g., enhancing or inhibiting) protein-protein interactions. In particular, compositions and methods of the present invention find use in identifying, reconstituting and characterizing protein-protein interactions, identifying binding subunits, and drug screening. The methods and compositions of the invention may also be used to identify agents that may agonize or antagonize a protein-protein interaction (e.g., using test compounds).

Abstract: The invention enables efficient, rapid, and sensitive enumeration of living cells by detecting microscopic colonies derived from in situ cell division using large area imaging. Microbial enumeration tests based on the invention address an important problem in clinical and industrial microbiology—the long time needed for detection in traditional tests—while retaining key advantages of the traditional methods based on microbial culture. Embodiments of the invention include non-destructive aseptic methods for detecting cellular microcolonies without labeling reagents. These methods allow for the generation of pure cultures which can be used for microbial identification and determination of antimicrobial resistance.

Abstract: Chimeric molecules that include a pathogen recognition module derived from a pathogen binding domain of a pathogen recognition protein, e.g., a toll-like receptor (TLR), CD14, BPI, MD-2, scavenger receptors (SRs), surfactant proteins (SP), C-reactive protein (CRP), Mannan-binding lectin (MBL), or complement Clq globular binding domain, an optional linker, and an Fc portion of an antibody are described and are useful for, e.g., drug discovery and treatment of conditions related to TLR signaling.

Abstract: A monoclonal antibody to a consensus peptide of the formula: VEKNITVTASVDPTIDLLQADGSALPSAVALTYSPA. (SEQ ID NO:1) The monoclonal antibody of the invention binds exclusively to the sequence SAVALTYS (SEQ ID NO:2) and has use as a diagnostic and for prophylaxis against illness arising from E. coli which produce the CS4-CFA/I family of proteins and for treatment of disease arising therefrom.

Abstract: Devices for detecting analytes or analogues thereof in a biological sample are disclosed. The device includes a solid support. The solid support has several juxtaposed zones. The sample is able to migrate from a sample receiving zone towards a detection zone. The analyte, if present, is detected in the detection zone. Both zones have material allowing a capillary flow of the sample through the zones. In between the zones, there is an intermediate zone of transport of the sample which is free from any capillary material. This allows the ample to migrate by gravitational forces on the support laid in a vertical position. Methods for detecting analytes or analogues thereof in a biological sample using the device are also disclosed.

Abstract: Methods and composition for the screening and isolation of aglycosylated antibody Fc domain polypeptides. For example, in certain aspects methods for identifying aglycosylated Fc domains that bind to Fc receptors or preferentially bind to particular Fc receptors are described. Furthermore, the invention provides aglycosylated Fc domains that bind to Fc receptors with high affinity. Enhanced methods and media for prokaryotic based interaction screening are also provided.

Abstract: Methods and compositions for the screening and isolation of ligand-binding polypeptides, such as antibodies. In some aspects, methods of the invention enable the isolation of intact soluble antibodies comprising a constant domain. Screening methods that employ genetic packages such as bacteria and bacteriophages enable high through-put identification of ligand binding molecules.

Abstract: Assay systems and methods are provided for detecting a target pathogen, such as a microorganism (e.g., bacterium, bacterial toxin) which may be present in a fluid or other location. The method can include linking a magnetic microparticle to a first epitope of the target microorganism in a fluid via a first antibody; utilizing a magnetic field to separate the magnetic microparticle and linked targeted microorganism from at least a portion of other components in the fluid, thereby forming a test sample; linking a glucose molecule to a second epitope of the target microorganism via a second antibody; and detecting the glucose in the test sample to determine the presence or concentration of the target microorganism in the fluid. The glucose detection preferably is one that can be done rapidly, e.g., with a conventional glucometer, and may include measuring the electrical resistance, color, or pH of the test sample.

Abstract: The present application relates to the hybrid selection methods in prokaryotes using counterselectable reporter genes.

Abstract: The invention provides a vaccine for immunizing poultry and other animals against infection by a gram-negative bacteria, and a method of immunizing an animal using the vaccine. The vaccine may contain purified siderophore receptor proteins derived from a single strain or species of gram-negative bacteria or other organism, which are cross-reactive with siderophores produced by two or more strains, species or genera of gram-negative bacteria. The invention further provides a process for isolating and purifying the siderophore receptor proteins, and for preparing a vaccine containing the proteins. Also provided is a method for diagnosing gram-negative sepsis.

Abstract: Described are compositions and methods for activating a Plk1 protein as well as phospho-specific anti-Myt1 antibodies that can be used to detect phosphorylation of Myt1. Activated Plk1 protein, phospho-specific anti-Myt1 antibodies, and/or Plk1 substrates can be used in screening assays to identify compounds that modulate the ability of Plk1 to phosphorylate and/or bind to a Plk1 substrate.

Abstract: The invention relates to a technology by which antibodies directed to sources of infection in body fluids can be assayed with high accuracy, expediency and specificity. More particularly, the invention provides an antibody immunoassay method in which the antigen-antibody reaction between a target antibody in a sample and an assay antigen is conducted in the presence of an E. coli component and an antibody assay method which comprises using a reagent having a specific affinity for the Fc region of an antibody IgG as the antibody assay reagent.

Abstract: The present invention provides novel methods for producing nucleic acid fragment libraries that express highly diverse peptides or protein domains and, in particular, methods for producing nucleic acid fragment libraries wherein the nucleic acid fragments of the libraries are derived from two or more diverse characterized genomes.

Abstract: Monolithic bioelectronic devices for the detection of ammonia includes a microorganism that metabolizes ammonia and which harbors a lux gene fused with a heterologous promoter gene stably incorporated into the chromosome of the microorganism and an Optical Application Specific Integrated Circuit (OASIC). The microorganism is generally a bacterium.

Abstract: A biosensor includes a substrate with a receptive material layer of radiation-absorbing member (RAM)-tagged biomolecules disposed thereon. The receptive material is specific for an analyte of interest. A pattern of active and deactivated areas of the receptive material are defined in the receptive material layer by a masking process wherein areas are exposed through a mask with a light source to induce deactivation.

Abstract: A bacterial strain of Escherichia coli is described which produces L-threonine, and is obtained by a process comprising transduction by bacteriophage P1 which bears a transposon which inactivates threonine dehydrogenase activity, and isolation of a transductant lacking threonine dehydrogenase activity.

Abstract: The present invention provides a method of diagnosing Crohn's disease in a subject by determining the presence or absence of IgA anti-OmpC antibodies in the subject, where the presence of the IgA anti-OmpC antibodies indicates that the subject has Crohn's disease.

Abstract: A minicell display method has been developed which has significant advantages for screening peptide libraries for candidates that can bind and effectively modulate a particular biological process. The method, based on the small, anucleate minicell, has increased versatility in generating unique sequences to screen as well as increasing the size of the peptides to be screened. In vivo mutagenesis, at the level of protein synthesis, as well as DNA replication, increases diversification of the library to be screened and therefore substantially increases the number of potential peptides that can modulate a particular biological response or mechanism.

Abstract: An enhanced diffraction based biosensor system and method are provided for detecting an analyte of interest in a test medium. The system incorporates at least one additional detection tag substance with the analyte of interest, the tag emitting a measurable parameter that is different from optical diffraction characteristics of the analyte. The biosensor may be a “fluoroptical” system wherein the detection tag is a fluorescence emitting substance, including fluorescent-labeled diffraction enhancing elements. The enhanced diffraction biosensor system may determine the presence of analytes in biological fluids both qualitatively and quantitatively.

Abstract: Methods for identifying modulators of fatty acid transport and/or uptake, comprising contacting, under conditions favorable for fatty acid uptake, a putative modulator, e.g., an inhibitor with a system comprising genetic material encoding a fatty acid transport mediator (“TTM”), particularly FAA1, FAA2, FAA3, FAA4, FAT1, fadL, fadD, FATP, CD36 and FABP, or orthologs, homologs, isoforms, variants, analogs, derivatives or fragments thereof, and combinations thereof, or fatty acid transport mediator proteins (“TTMps”), e.g., Faa1p, Faa2p, Faa3p, Faa4p, Fat1p, FadL, fatty acyl CoA synthetase, FATP, CD36 and FABP, or orthologs, homologs, isoforms, variants, analogs, derivatives or fragments thereof, and combinations thereof, and determining the effect of the putative modulator. The test system may be a cell such as Saccharomyces cerevisiae, E. coli, H. sapiens, etc. or an in vitro system.

Abstract: A family of fatty acid transport proteins (FATPs) mediate transport of long chain fatty acids (LCFAs) across cell membranes into cells. These proteins exhibit different expression patterns among the organs of mammals. Nucleic acids encoding FATPs of this family, vectors comprising these nucleic acids, as well as the production of FATP proteins in host cells are described. Also described are methods to test FATPs for fatty acid transport function, and methods to identify inhibitors or enhancers of transport function. The altering of LCFA uptake by administering to the mammal an inhibitor or enhancer of FATP transport function of a FATP in the small intestine can decrease or increase calories available as fats, and can decrease or increase circulating fatty acids. The organ specificity of FATP distribution can be exploited in methods to direct drugs, diagnostic indicators and so forth to an organ such as the heart.

Abstract: Novel methods for the treatment and/or prophylaxis of diseases caused by tissue-adhering bacteria are disclosed. By interacting with periplasmic molecular chaperones it is achieved that the assembly of pili is prevented or inhibited and thereby the infectivity of the bacteria is diminished. Also disclosed are methods for screening for drugs as well as methods for the de novo design of such drugs, methods which rely on novel computer drug modelling methods involving an approximative calculation of binding free energy between macromolecules. Finally, novel pyranosides which are believed to be capable of interacting with periplasmic molecular chaperones are also disclosed.