Abstract: A method for preparing glycidol using glycerol includes mixing glycerol with urea in the presence of at least one zinc-based catalyst selected from the group consisting of Zn(NO3)2, ZnCl2, ZnO and Zn(OAc)2 under a pressure of 0.5-10 kPa at a temperature of 100-170° C. to obtain glycerol carbonate; filtering the glycerol carbonate mixed with the zinc-based catalyst through an adsorbent including a polymer resin coordinated with amine groups to separate the zinc-based catalyst and glycerol carbonate from each other; and carrying out reaction of the glycerol carbonate separated from the zinc-based catalyst in the presence of an anion alkali metal salt catalyst that is Na, K, Rb, Cs or a mixture thereof containing at least one anion selected from the group consisting of Cl?, Br?, I?, NO3?, NO2? and acetate under a pressure of 0.13-6.67 kPa at a temperature of 140-250° C. to obtain glycidol.

Abstract: Disclosed are a folded chlorotoxin, a chlorotoxin variant and a folded chlorotoxin variant and their preparation technology. The folded chlorotoxin has a peptide sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2, and the folded chlorotoxin variant has a peptide sequence of MCMPCFTTDHQMARSCDDCCGGSGRGSCYGPQCLCR-NH2 and is formed by replacing serine (Ser, S) by lysine (Lys, K) in the peptide sequence of chlorotoxin. The chlorotoxin and its derivatives have potential application values in biological and medical fields and good economic and social benefits to life, health, and personalized healthcare.

Abstract: A foldable transport container substantially slides and folds so that the transport container can be folded and unfolded conveniently. In an example embodiment, a foldable transport container comprises a planar foldable base, a pair of opposing straight side walls, a pair opposing foldable end walls, a foldable top, and a folding mechanism. A first straight side wall is operable to slide towards a second straight side wall along a first longitudinal axis, and a first foldable end wall and a second foldable end wall are operable to fold inwardly towards each other along a second latitudinal axis. The folding mechanism allows surfaces of the first and second foldable base sections to be used for storing goods within the container without any interfering protrusions when the foldable transport container is in its erected configuration.

Abstract: A method of determining an edge of an object on a digital image sequence comprising the step of determining a first gradient direction profile of a first image in the digital image sequence; determining a second gradient direction profile of a second image in the digital image sequence; computing a differential profile based on the first gradient direction profile and the second gradient direction profile; and determining the edge of the object based on the differential profile wherein the differential profile registers gradient magnitudes of the second gradient direction profile and angular differences between the first gradient direction profile and the second gradient direction profile. A system thereof is also disclosed.

Abstract: A process for the production of ezetimibe and intermediates used in said process are disclosed. A kind of Morita-Baylis-Hillman adduct can be altered to chiral carboxylic acid derivatives of ?-arylamino ?-methylene with high activity and selectivity by means of ally lamination reaction, and the above carboxylic acid derivatives of ?-arylamino ?-methylene can be altered to the chiral intermediates of ezetimibe by means of simple conversion and further synthesized into the chiral drug ezetimibe. The synthesis route introduces chirality through the use of a chiral catalysis method, thereby avoiding the use of the chiral auxiliary oxazolidinone; and the route is economical and eco-friendly.

Abstract: Provided are compositions and methods for treating hematological malignancies, such as multiple myeloma, in a subject by increasing levels or activity of miR-30 RNA in plasma cells of the subject.

Abstract: Disclosed are a method of manufacturing a flexible thin-film type super-capacitor device and a super-capacitor device manufactured by the same. The flexible thin-film type super-capacitor device comprises a base film which has flexibility; a separator which is interposed between the base films; and an active material which is formed on the base film. Thus, flexibility is given since thickness is very thin while maintaining high electrical conductivity and high binding property. In addition, economic feasibility is high and mass production is possible. Further, it is possible to stably and efficiently contain a highly corrosive material.

Abstract: The present invention relates to vaccine compositions comprising attenuated strain of Tilapia Lake Virus (TiLV) for protecting tilapia fish against infection by (TiLV). The invention also relates to methods for using the vaccines to protect tilapines from TiLV-induced disease.

Abstract: Apparatus for improving a three-dimensional (3D) reconstruction of a sample is programmed to execute instructions including: removing uncorrelated noise in said 3D reconstruction with COMET or other regularization techniques; and removing correlated noise in said 3D reconstruction by applying an Extended Field Iterative Reconstruction Technique (EFIRT) procedure.

Abstract: The present disclosure relates to a thermal storage material containing a hexanary composition of NaNO3—NaNO2—KNO3—KNO2—Ca(NO3)2—LiNO3 for lowering a melting point of molten salts.

Abstract: An absorbable periodontal tissue and bone regeneration material uses bacterial cellulose that has been exposed to radiation. The bacterial cellulose was confirmed to block the invasion of soft tissue in a calvarial defect in rat and rabbit models and to display excellent absorptiveness enough to contribute bone formation. Therefore, the bacterial cellulose can be developed as an absorbable periodontal tissue and bone regeneration material useful in the field of medical engineering by regulating biodegradability without using chemicals that are toxic to human and environment.

Abstract: A method of encoding or decoding coding units of a video content in a palette coding mode using an adaptive palette predictor is provided. The method includes adaptively determining a maximum size of the adaptive palette predictor based on at least one of a complexity of the video content and coding quality of the video content; and encoding or decoding the coding units of the video content in the palette coding mode using the adaptive palette predictor while limiting the adaptive palette predictor that is derived from all palette(s) of previously encoded or decoded coding unit(s) of the video content within the maximum size determined in the adaptively determining step. An apparatus of encoding or decoding coding units of a video content in a palette coding mode using an adaptive palette predictor is also provided.

Abstract: The method provides methods and compositions for treating metabolic disorders such as impaired glucose tolerance, elevated blood glucose, insulin resistance, dyslipidemia, obesity, and fatty liver.

Abstract: The invention provides a class of block copolymers having a plurality of chemically different blocks, at least a portion of which incorporating polymer side chain groups having a helical secondary structure. The invention also provides structures generated by self-assembly of polymer blends including at least one block copolymer component, such as a brush block polymer or wedge-type block polymer. The invention provides, for example, periodic nanostructures and microstructures generated by self-assembly of block copolymers and polymer blends comprising a mixture of at least one block copolymer component, such as a brush block copolymer, and at least a second component.

Abstract: Aspects of the invention relate to methods for producing lactic acid from organic waste, comprising contacting organic waste with a microbial community to form a fermentation mixture, and fermenting the fermentation mixture under controlled pH and temperature conditions for a time sufficient to produce lactic acid.

Abstract: The present invention relates to the novel compounds represented by Formula (Ia) or (Ib) and to their pharmaceutical preparations for the treatment of atherosclerosis and cholesterol level reduction.

Abstract: A base station defines a short TTI (transmission time interval) equal to the length of one subslot as the minimum unit of a time resource for data transmission in a subframe including a plurality of subslots, determines the RS type the terminal will use for transmission, among a plurality of RS types, based on the positions of RSs (reference signals) within the short TTI, and sends information on the RS type the terminal will use for transmission to the terminal.

Abstract: Disclosed are a method for inducing a prediction motion vector and an apparatus using the same. An image decoding method can include: a step of determining the information related to a plurality of spatial candidate prediction motion vectors from peripheral predicted blocks of a predicted target block; and a step of determining the information related to temporal candidate prediction motion vectors on the basis of the information related to the plurality of spatial candidate prediction motion vectors. Accordingly, the present invention can reduce complexity and can enhance coding efficiency when inducing the optimum prediction motion vector.

Abstract: Provided is a communication method in a wireless communication system using an interference alignment. The method includes: receiving, by a first AP, a data stream by using N1 (natural number) first reception antennas, and receiving, by a second AP, the data stream by using N2 (natural number) second reception antennas, in a wireless communication system including the first AP and the second AP which receive the data stream through a transmission beam which one or more user terminals having m (natural number) transmission antennas within a given number transmit; and updating to selectively add a part of user terminals which are newly connected to the first AP and the second AP to a set of connected user terminal, and transmitting, by each terminal of the set of connected user terminal, linearly independent transmission beams by applying an interference alignment with respect to a plurality of the first and the second reception antennas for the updated set of connected user terminal.

Abstract: Current methods for annotating and interpreting human genetic variation typically exploit only a single information type (e.g., conservation) and/or are restricted in scope (e.g., to missense changes). Here, a method for objectively integrating many diverse annotations into a single measure (integrated deleteriousness score, or C-score) for each variant is described. The method may be implemented as a support vector machine (SVM) trained to differentiate high-frequency human-derived alleles from simulated variants. C-scores were precomputed for all 8.6 billion possible human single-nucleotide variants and allow scoring of short insertions-deletions. C-scores correlate with allelic diversity, annotations of functionality, pathogenicity, disease severity, experimentally measured regulatory effects and complex trait associations, and they highly rank known pathogenic variants within individual genomes.