Abstract: The present invention is about the design and manufacturing method of constructing nano-structured lattices. The design of the four periodic two-dimensional lattices (hexagonal, triangulated, square and Kagome) is described; and the process of making nano-structured lattices is outlined in the present invention.

Abstract: Novel gripping structures based on van der Waals adhesive forces are disclosed. Pads covered with fibers can be activated in pairs by opposite forces, thereby enabling control of the adhesive force in an ON or OFF state. Pads can be used in groups, each comprising a group of opposite pads. The adhesive structures enable anchoring forces that can resist adverse forces from different directions. The adhesive structures can be used to enable the operation of robots on surfaces of space vehicles.

Abstract: The present invention provides a high-throughput sequencing method for methylated DNA, and use thereof. Particularly, the present invention provides a high-throughput sequencing method for methylated DNA, which combines methylated DNA immunoprecipitation, removal of repetitive sequences, and bisulfite treatment. The site of sequencing library will be decreased, and the cost will be reduced by using the method disclosed in the present invention.

Abstract: A method for controlling access of a processor to a resource, wherein the processor has an instruction set including a virtualization extension, may include executing a resource access instruction by the processor using the virtualization extension, whereby the resource access instruction conveys a virtual address (VA) and a virtual machine identifier. The method may also include translating the virtual address to a physical address based on the virtual machine identifier, and looking-up an access control rule table using the physical address as a search key. Each entry of the rule table includes a virtual machine identifier. The method further includes controlling access to the resource based on the output of the rule table and a match between the virtual machine identifier returned by the table and the virtual machine identifier conveyed in the resource access instruction.

Abstract: An electrochemical device comprises one or more anode, cathode, and separator. In some embodiments, the separator is also an electrolyte. In addition it has two or more current collectors. The anode and cathode are between the two current collectors and each is adhered to an adjacent current collector. The separator is between the anode and cathode and adhered to the anode and cathode. The current collectors are a barrier, and are bonded together to create a sealed container for the anode, cathode, and separator. The electrochemical device may be integrated into a composite panel suitable for uses such as structural load bearing panels or sheets for aircraft wings or fuselage, composite armor, torpedo, missile body, consumer electronics, etc. The electrochemical device may include, but is not limited to, energy storage (batteries, supercapacitors), and energy generation (fuel cells).

Abstract: The present disclosure relates to a three-dimensional montage generation system and method based on a two-dimensional single image. An embodiment of the present disclosure may generate a three-dimensional montage in an easy, fast and accurate way by using a two-dimensional front face image data, and estimate face portions, which cannot be restored by using a single photograph, in a statistic way by using a previously prepared face database. Accordingly, an embodiment of the present disclosure may generate a three-dimensional personal model from a single two-dimensional front face photograph, and depth information such as nose height, lip protrusion and eye contour may be effectively estimated by means of statistical distribution and correlation of data.

Abstract: MIR spectroscopy systems comprising hierarchical spectral dispersion that enables fine spectral resolution and high sensitivity spectroscopy are disclosed. Hierarchical spectral dispersion is derived by employing at least two diffractive lens arrays, located on either side of a test sample, each receiving input radiation having an input spectral range and distributing the input radiation into a plurality of output signals, each having a fraction of the spectral range of the input radiation. As a result, the signal multiplication factor of the two arrays is multiplied in a manner that mitigates the propagation of wavelength harmonics through the system. In some embodiments, an emitter array comprising a plurality of spectrally selective emitters provides the input MIR radiation to a spectroscopy system. In some embodiments, spectrally selective detectors are used to detect narrow spectral components in the radiation after they have passed through the test sample.

Abstract: A method for operating a machine-to-machine (M2M) device communicating with a gateway includes determining, by the gateway, a timing parameter for synchronizing the machine-to-machine device with the gateway; inserting the timing parameter into a control signal; and transmitting the control signal from the gateway to the machine-to-machine device.

Abstract: Disclosed is a convergence machining apparatus based on turning in which a rotational axis of a work piece fixed by a headstock and a tailstock and a center of a width of a slide surface of a bed on which a reciprocal carriage installed with a tool is transferred while being supported are positioned at the same virtual plane, thereby preventing an offset error according to a relative displacement between the work piece and the tool during processing.

Abstract: A method of transmitting a beamforming report frame for transmit beamforming is provided. The method may include acquiring, by a receiver, data of a signal transmitted by a transmitter, selecting either media access control (MAC) software or MAC hardware, to assign a sequence number based on a type of the data, and assigning a sequence number to the management frame based on the data, using either the MAC software or MAC hardware that is selected.

Abstract: Embodiments of an integrated method for step-wise conversion of 2,3-butanediol to 2-butanol, and optionally to hydrocarbons, are disclosed. The method includes providing an acidic catalyst, exposing a composition comprising aqueous 2,3-butanediol to the acidic catalyst to produce an intermediate composition comprising methyl ethyl ketone, providing a hydrogenation catalyst that is spatially separated from the acidic catalyst, and subsequently exposing the intermediate composition to the hydrogenation catalyst to produce a composition comprising 2-butanol. The method may further include subsequently exposing the composition comprising 2-butanol to a deoxygenation catalyst, and deoxygenating the 2-butanol to form hydrocarbons. In some embodiments, the hydrocarbons comprise olefins, such as butenes, and the method may further include subsequently exposing the hydrocarbons to a hydrogenation catalyst to form saturated hydrocarbons.

Abstract: The present invention provides a compound of the formula (I): wherein: R2 and R3 represent each independently a hydrogen atom or a hydrocarbon group; A represents an s-valent organic group; and s is an integer of 2-10. This nitrileoxide compound has stable and can be easily produced.

Abstract: The present invention belongs to the field of preparation of high performance polymers, and specifically relates to a low dielectric constant polymer containing dinaphthyl and hexafluorocyclobutyl ether units, and preparation method and use thereof. The polymer is prepared as follows: under the effect of an alkali, 1-naphthol bromotetrafluoroethane ether is prepared from 1-naphthol and tetrafluorodibromoethane in an organic solvent, and then reduced by a zinc powder so as to obtain 1-naphthol trifluorovinyl ether. 1-naphthol trifluorovinyl ether is treated at a high temperature to obtain a bisnaphthol hexafluorocyclobutyl ether monomer. The monomer is subjected to oxidative coupling in the presence of ferric trichloride so as to obtain a thermal polymer containing dinaphthyl and hexafluorocyclobutyl structural units with a good film-forming property, and in a nitrogen atmosphere, the temperature for 5% weight loss (Td5%) of the obtained film is 437° C., and the carbon residue yield at 1000° C. is 54.24%.

Abstract: Disclosed is a gas chromatography chip including: a substrate having an upper substrate and a lower substrate; a gas supply connecting part formed on one plane of one surface of the substrate or on one plane of an opposite surface of the substrate; a gas discharge connecting part formed another plane of the one surface of the substrate or on another plane of the opposite surface of the substrate; a micro channel continuously extending from the gas supply connecting part to the gas discharge connecting part to form a micro channel part and having a circular cross-section; at least two position alignment markers formed on one surface or an opposite surface of the opposite surfaces of the substrate; and a heat transfer part and a temperature control unit for controlling a temperature of the substrate.

Abstract: Genetically encoded calcium indicator (GECI) polypeptides and the nucleic acid molecules encoding such polypeptides are provided. In addition, methods of using such nucleic acids and polypeptides in methods of screening for agonists or antagonists of G-protein coupled receptor (GPCR) or ion channels and methods of monitoring neural activity also are provided.

Abstract: A method for preparing glycidol using glycerol includes mixing glycerol with urea in the presence of at least one zinc-based catalyst selected from the group consisting of Zn(NO3)2, ZnCl2, ZnO and Zn(OAc)2 under a pressure of 0.5-10 kPa at a temperature of 100-170° C. to obtain glycerol carbonate; filtering the glycerol carbonate mixed with the zinc-based catalyst through an adsorbent including a polymer resin coordinated with amine groups to separate the zinc-based catalyst and glycerol carbonate from each other; and carrying out reaction of the glycerol carbonate separated from the zinc-based catalyst in the presence of an anion alkali metal salt catalyst that is Na, K, Rb, Cs or a mixture thereof containing at least one anion selected from the group consisting of Cl?, Br?, I?, NO3?, NO2? and acetate under a pressure of 0.13-6.67 kPa at a temperature of 140-250° C. to obtain glycidol.

Abstract: Disclosed are a folded chlorotoxin, a chlorotoxin variant and a folded chlorotoxin variant and their preparation technology. The folded chlorotoxin has a peptide sequence of MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2, and the folded chlorotoxin variant has a peptide sequence of MCMPCFTTDHQMARSCDDCCGGSGRGSCYGPQCLCR-NH2 and is formed by replacing serine (Ser, S) by lysine (Lys, K) in the peptide sequence of chlorotoxin. The chlorotoxin and its derivatives have potential application values in biological and medical fields and good economic and social benefits to life, health, and personalized healthcare.

Abstract: A rare earth magnet, which is represented by a neodymium magnet (Nd2Fe14B) and neodymium magnet films with applications in micro-systems. A method for producing a rare earth magnet, comprising: (a) quenching a molten metal having a rare earth magnet composition to form quenched flakes of nanocrystalline structure; sintering the quenched flakes; subjecting the sintered body obtained to an orientation treatment; and applying a heat treatment with pressurization at a temperature sufficiently high to enable diffusion or fluidization of a grain boundary phase and at the same time, low enough to prevent coarsening of the crystal grains, (b) thick films deposited on a substrate, applying an annealing to crystallize with pressurization at a temperature sufficiently high to enable diffusion or fluidization of a grain boundary phase and, at the same time, low enough to prevent coarsening of the crystal grains.

Abstract: A method of determining an edge of an object on a digital image sequence comprising the step of determining a first gradient direction profile of a first image in the digital image sequence; determining a second gradient direction profile of a second image in the digital image sequence; computing a differential profile based on the first gradient direction profile and the second gradient direction profile; and determining the edge of the object based on the differential profile wherein the differential profile registers gradient magnitudes of the second gradient direction profile and angular differences between the first gradient direction profile and the second gradient direction profile. A system thereof is also disclosed.

Abstract: Disclosed herein is a digital-to-analog converter (DAC) including a clock driver for controlling a clock signal to provide an inverse delay clock signal to allow at least selective adjustment of a return to zero (RZ) section; and a DAC core comprising at least two DAC units for receiving a digital input value, the clock signal and the inverse delay clock signal and providing an analog output value. According to the present invention, distortion of the output of the DAC may be attenuated and loss of the output may be minimized by utilizing the RZ technique.