Patents Assigned to Okayama University
-
Publication number: 20190274214Abstract: A printed wiring board of the present disclosure includes a power supply layer and a ground layer. A power supply layer pattern to be formed partially on the power supply layer includes a branch and a power supply layer electrode. The branch is a direct-current power feeding path for connecting adjacent electromagnetic band gap (EBG) unit cells, and the power supply layer electrode is connected through a slit provided along the branch. A capacitive coupling element disposed to oppose the power supply layer electrode with an interlayer being provided therebetween has a structure in which the EBG unit cells are disposed at regular intervals, the EBG unit cells being connected to the branch in the power supply layer pattern through a via.Type: ApplicationFiled: July 20, 2017Publication date: September 5, 2019Applicants: National University Corporation Okayama University, KYOCERA CorporationInventors: Yoshitaka TOYOTA, Kengo IOKIBE, Xingxiaoyu LIN, Toshiyuki KANEKO, Masanori NAITO, Toshihisa UEHARA
-
Publication number: 20190246494Abstract: A printed wiring board of the present disclosure that includes a power supply layer and a ground layer. A power supply layer pattern formed in the power supply layer includes a power supply layer electrode and a branch that is a direct-current power feeding path connecting adjacent electromagnetic band gap (EBG) unit cells. A capacitive coupling element including a capacitive coupling element body is disposed to oppose the power supply layer electrode with an interlayer provided therebetween.Type: ApplicationFiled: July 20, 2017Publication date: August 8, 2019Applicants: National University Corporation Okayama University, KYOCERA CorporationInventors: Yoshitaka TOYOTA, Kengo IOKIBE, Xingxiaoyu LIN, Toshiyuki KANEKO, Masanori NAITO, Toshihisa UEHARA
-
Patent number: 10350192Abstract: The invention provides a lactate dehydrogenase inhibitor that makes it possible to suppress refractory epilepsy in which conventional antiepileptic drugs are ineffective, and an antiepileptic drug containing said inhibitor. The lactate dehydrogenase inhibitor of the invention contains a compound represented by formula (III); i.e., isosafrole or a compound having isosafrole as a scaffold, and the antiepileptic drug of the invention has these compounds as an active ingredient.Type: GrantFiled: February 9, 2016Date of Patent: July 16, 2019Assignee: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventors: Tsuyoshi Inoue, Nagisa Sada
-
Publication number: 20190201555Abstract: An embodiment relates to a method of evaluating a lymphatic system function including: selecting one or a plurality of lymphatic routes to be evaluated from a plurality of lymphatic routes existing in four limbs; determining an injection site of a visualization agent based on information on the selected lymphatic route and injection sites of peripheries of the four limbs corresponding to the selected lymphatic route; injecting the visualization agent from the selected injection site; and visualizing the injected visualization agent and evaluating functions of the one or plurality of lymphatic routes to be evaluated.Type: ApplicationFiled: December 31, 2018Publication date: July 4, 2019Applicants: National University Corporation Okayama University, HAMAMATSU PHOTONICS K.K.Inventors: Akira SHINAOKA, Yoshihiro KIMATA, Aiji OHTSUKA, Takahiro SHIKAYAMA
-
Publication number: 20190181454Abstract: A positive electrode material for a lithium secondary battery of the present disclosure includes a positive electrode active material, a barium titanate-based dielectric, and at least one of Compound I which contains the element Ba and has the largest peak at a position with 2?=24° to 26° in an X-ray diffraction pattern obtained according to X-ray diffraction measurement using CuK? rays; and Compound II which contains the element Ti and has the largest peak at a position with 2?=26° to 28° in an X-ray diffraction pattern obtained according to X-ray diffraction measurement using CuK? rays. At least one of Compounds I and II is disposed in contact with the dielectric.Type: ApplicationFiled: December 10, 2018Publication date: June 13, 2019Applicants: TOYOTA JIDOSHA KABUSHIKI KAISHA, NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventors: Daisuke HORIKAWA, Ryuta SUGIURA, Takashi TERANISHI
-
Publication number: 20190181448Abstract: The present disclosure relates to a positive electrode material for a lithium secondary battery which includes a positive electrode active material and a dielectric. The dielectric is a composite oxide represented by a general formula AmBnO? and has a dielectric constant of 10 to 500. Here, m and n are real numbers that satisfy 1.01?m/n?1.6, ? is a value that is determined so that charge neutral conditions are satisfied, A is one or more elements among alkali metal elements, alkaline earth metal elements, rare earth elements, Cu, Pb and Bi, and B is one or more elements among transition metal elements and Sn.Type: ApplicationFiled: December 6, 2018Publication date: June 13, 2019Applicants: TOYOTA JIDOSHA KABUSHIKI KAISHA, NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventors: Daisuke HORIKAWA, Ryuta SUGIURA, Takashi TERANISHI
-
Patent number: 10307342Abstract: There is provided an oral biofilm inhibitor having an exceptional inhibitory effect on oral biofilm formation. It is an oral biofilm inhibitor comprising a curable composition containing an antimicrobial agent, wherein a compressive strength of a cured product formed by curing the composition is 150 MPa or less, and a content of the antimicrobial agent is 0.001 to 3% by weight. An oral biofilm inhibitor thus obtained is used for inhibiting biofilm formation in an oral cavity by applying a curable composition containing an antimicrobial agent to a dental defect site for allowing the composition to cure at the dental defect site, and then disintegrating the cured composition.Type: GrantFiled: August 21, 2015Date of Patent: June 4, 2019Assignee: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventors: Kazuhiro Omori, Takashi Ito, Shogo Takashiba, Masao Irie
-
Patent number: 10285985Abstract: There is provided a pharmaceutical composition for treatment or prevention of a neurodegenerative disease, comprising an RXR agonist as an active ingredient, which is a compound represented by formula (1) or (2). The pharmaceutical composition is effective in treatment or prevention of neurodegenerative diseases such as dementia, Parkinson's disease and multiple sclerosis with reducing side effects such as enlargement of the liver and elevation of blood triglyceride level. In these formulas, A represents CMe2, N-methyl, N-ethyl or N-isopropyl; X represents N, CH or C—CF3; Y and Z represent N or CH; R1 represents methyl, hydroxy, methoxy or ethoxy; R2 represents H, methyl or ethyl; B represents NR3 or CHR3; R3 represents alkyl; and R4 represents H, halogen, alkyl, alkenyl, aryl, alkynyl, alkoxy or acyl.Type: GrantFiled: March 31, 2016Date of Patent: May 14, 2019Assignee: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventor: Hiroki Kakuta
-
Patent number: 10280216Abstract: The present invention provides an antitumor agent having high safety, which is a molecular target drug against malignant tumors. An anti-malignant tumor agent characterized by containing, as an active ingredient, a substance targeting ribosomal proteins shows increased expression in malignant tumor cells. The substance of the present inventions targeting the ribosomal protein showing increased expression in the malignant tumor cell may be a substance involved in one of biological defense mechanisms which are considered to be intrinsically provided in a living body and prevent onset of disease even if cancer cells develop. Specifically, the ribosomal protein showing increased expression is RPL29 and/or RPS4X.Type: GrantFiled: November 21, 2016Date of Patent: May 7, 2019Assignee: National University Corporation Okayama UniversityInventors: Yasuhiro Miyake, Kazuhide Yamamoto
-
Publication number: 20190125726Abstract: This invention provides a pharmaceutical composition for treating or preventing synucleinopathy comprising a compound represented by formula (I), or a pharmaceutically acceptable salt thereof.Type: ApplicationFiled: March 31, 2017Publication date: May 2, 2019Applicants: TOHOKU UNIVERSITY, NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventors: Kohji Fukunaga, Hiroyuki MIYACHI, Hiroaki ISHIDA, Shintaro BAN
-
Publication number: 20190070207Abstract: It is an object of the present invention to provide a novel therapeutic agent for hepatoma viruses. Specifically, the present invention relates to an anti-hepatoma virus agent, containing as an active ingredient a compound represented by the following Formula (I) or a pharmaceutically acceptable salt thereof: (wherein R1 is fluorine or hydrogen).Type: ApplicationFiled: March 10, 2017Publication date: March 7, 2019Applicants: KAGOSHIMA UNIVERSITY, NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITY, DAIKIN INDUSTRIES, LTD.Inventors: Masanori IKEDA, Midori TAKEDA, Masanori BABA, Nobuyuki KATO
-
Patent number: 10206979Abstract: Disclosed is a method of treatment for anti-Alzheimer's disease based on an action mechanism associated with amyloid ? protein, which action mechanism is different from conventional action mechanisms. The treatment Alzheimer's disease uses a therapeutic agent for cognitive impairment induced by amyloid ? protein, which therapeutic agent comprises a peptide having the amino acid sequence represented by SEQ ID NO:1 or a peptide similar to this peptide, especially a peptide containing the amino acid sequence represented by SEQ ID NO:2, which is a partial sequence of SEQ ID NO:1. VLSSQQFLHRGHQPPPEMAGHSLASSHRNSMIPSAAT (SEQ ID NO:1) HRGHQPPPEMA (SEQ ID NO:2).Type: GrantFiled: October 5, 2017Date of Patent: February 19, 2019Assignees: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITY, NATIONAL UNIVERSITY CORPORATION HOKKAIDO UNIVERSITYInventors: Tsuyoshi Inoue, Toshiharu Suzuki, Saori Ban
-
Patent number: 10178758Abstract: A printed wiring board includes a digital circuit, an analog circuit, and a power supply path that is disposed on an insulating layer between the digital circuit and the analog circuit. A plurality of open stub EBG structures are disposed at an end of a bridge section in a power supply plane. The open stub EBG structure is an open stub state whose one end is connected to the power supply path and other end is in an open state.Type: GrantFiled: November 25, 2015Date of Patent: January 8, 2019Assignees: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITY, KYOCERA CORPORATIONInventors: Yoshitaka Toyota, Kengo Iokibe, Yuki Yamashita, Toshiyuki Kaneko, Masanori Naito, Kiyohiko Kaiya, Toshihisa Uehara, Koichi Kondo
-
Publication number: 20180280300Abstract: An object of the present invention is to provide a method for encapsulating a poorly water-soluble pharmacologically active substance in a liposome with high efficiency. The present invention provides a composition comprising a lipid having a phosphatidylcholine group, a cholesterol compound, a lipid having a phosphatidylethanolamine group, and a poorly water-soluble pharmacologically active substance, wherein the molar ratio of the lipid having a phosphatidylcholine group, the cholesterol compound, the lipid having a phosphatidylethanolamine group, and the poorly water-soluble pharmacologically active substance is 3 to 8:2 to 7:0.1 to 3:0.001 to 5, respectively.Type: ApplicationFiled: October 6, 2016Publication date: October 4, 2018Applicants: ENSUIKO SUGAR REFINING CO., LTD., National University Corporation Okayama UniversityInventors: Hiroki HAMADA, Masaharu SENO, Tomonari KASAI, Tsukasa SHIGEHIRO, Koji HARA, Tetsuya ITO, Ichiro FUJIWARA
-
Publication number: 20180267040Abstract: This invention provides an anti-REIC antibody that specifically recognizes a cancer-associated protein (REIC/Dkk-3) and enables monitoring of cancer treatment effects involving the use of the REIC/Dkk-3 gene or the REIC/Dkk-3 protein as a medicine. This invention also provides a method of diagnosis involving the use of such antibody.Type: ApplicationFiled: September 27, 2016Publication date: September 20, 2018Applicants: National University Corporation Okayama University, Momotaro-Gene Inc.Inventors: Hiromi Kumon, Rie KINOSHITA, Junichiro FUTAMI
-
Patent number: 10071126Abstract: An object of the present invention is to provide a conditionally replicating adenovirus having a strong anticancer effect. A conditionally replicating adenovirus to replicate specifically in a cancer cell and express REIC protein or REIC C domain protein, wherein the conditionally replicating adenovirus is obtained by inserting full-length REIC DNA or REIC C domain DNA into a conditionally replicating adenovirus comprising an ITR (inverted terminal repeat) sequence of an adenovirus type 5 genome and insertion of an HRE sequence, an hTERT promoter, a decorin-encoding DNA, and a DNA encoding a peptide comprising an RGD sequence.Type: GrantFiled: May 26, 2015Date of Patent: September 11, 2018Assignees: National University Corporation Okayama University, Momotaro-Gene Inc., Industry-University Cooperation Foundation Hanyang UniversityInventors: Hiromi Kumon, Yasutomo Nasu, Masami Watanabe, Chae Ok Yun
-
Publication number: 20180252244Abstract: A McKibben artificial muscle 1, that can be improved durability in an end portion, includes an elastic tube 10 and a braided tube 20. The elastic tube 10 is a hollow-and-cylindrical elastic body. The braided tube 20 that is constituted by circular-knitted threads with a predetermined knitting angle twisted over a periphery of the elastic tube 10 in a movable manner. The braided tube 20 has a contraction portion 21 and a restriction portion 22. The braided tube 20 in the contraction portion 21 is circularly-knitted with a knitting angle that enables the elastic tube to expand radially and contract in a length direction so as to obtain contraction force. The braided tube 20 in the restriction portion 22 is circularly-knitted with a knitting angle that suppresses radial expansion adjacent to an end portion 11 of the elastic tube 10.Type: ApplicationFiled: July 8, 2016Publication date: September 6, 2018Applicants: Tokyo Institute of Technology, National University Corporation Okayama University, Koganei CorporationInventors: Koichi Suzumori, Shukushi Seita, Shuichi Wakimoto, Kazutoshi Kouno
-
Patent number: 10039861Abstract: There is provided a method for producing an artificial retina in which an organic dye compound that induces a receptor potential responding to photostimulation is fixed on a polymer sheet substrate, comprising a bonding step of immersing the substrate in a solution containing the organic dye compound to chemically bond the organic dye compound to the substrate; a first washing step of washing with water the substrate to which the organic dye compound has been chemically bonded; and a second washing step of, after the first washing step, washing with an organic solvent the substrate to which the organic dye compound has been chemically bonded. Thus, there can be provided an artificial retina which has excellent mechanical properties such as elongation at break and good biocompatibility, and is capable of inducing a receptor potential responding to photostimulation with high sensitivity.Type: GrantFiled: March 31, 2015Date of Patent: August 7, 2018Assignee: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventors: Tetsuya Uchida, Toshihiko Matsuo
-
Publication number: 20180185342Abstract: There is provided a drug for preventing or treating inflammatory bowel disease, comprising as an active ingredient an RXR agonist which is a compound represented by Formula (1). In Formula (1), it is preferred that: R1 is an alkyl group; R2 is an alkyl group; W is NR3, and R3 is an alkyl group; X1 is CH; Y1 is N; X2 and Y2 are CH; and Z is a carboxyl group. Thus, a drug capable of strongly preventing or treating inflammatory bowel disease while suppressing the onset of side effects is provided.Type: ApplicationFiled: June 29, 2016Publication date: July 5, 2018Applicant: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventor: Hiroki KAKUTA
-
Publication number: 20180092888Abstract: There is provided a pharmaceutical composition for treatment or prevention of a neurodegenerative disease, comprising an RXR agonist as an active ingredient, which is a compound represented by formula (1) or (2). The pharmaceutical composition is effective in treatment or prevention of neurodegenerative diseases such as dementia, Parkinson's disease and multiple sclerosis with reducing side effects such as enlargement of the liver and elevation of blood triglyceride level. In these formulas, A represents CMe2, N-methyl, N-ethyl or N-isopropyl; X represents N, CH or C—CF3; Y and Z represent N or CH; R1 represents methyl, hydroxy, methoxy or ethoxy; R2 represents H, methyl or ethyl; B represents NR3 or CHR3; R3 represents alkyl; and R4 represents H, halogen, alkyl, alkenyl, aryl, alkynyl, alkoxy or acyl.Type: ApplicationFiled: March 31, 2016Publication date: April 5, 2018Applicant: NATIONAL UNIVERSITY CORPORATION OKAYAMA UNIVERSITYInventor: Hiroki KAKUTA