Nucleic acids and corresponding proteins entitled 191P4D12(b) useful in treatment and detection of cancer

A novel gene 191P4D12(b) and its encoded protein, and variants thereof, are described wherein 191P4D12(b) exhibits tissue specific expression in normal adult tissue, and is aberrantly expressed in the cancers listed in Table I. Consequently, 191P4D12(b) provides a diagnostic, prognostic, prophylactic and/or therapeutic target for cancer. The 191P4D12(b) gene or fragment thereof, or its encoded protein, or variants thereof, or a fragment thereof, can be used to elicit a humoral or cellular immune response; antibodies or T cells reactive with 191P4D12(b) can be used in active or passive immunization.

Skip to: Description  ·  Claims  · Patent History  ·  Patent History
Description
CROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application is a non-provisional utility patent application that claims priority from U.S. provisional patent application U.S. S No. 60/404,306, filed 16 Aug. 2002 and this application claims priority from U.S. provisional patent application U.S. S No. 60/423,290, filed 01 Nov. 2002. The contents of the applications listed in this paragraph are fully incorporated by reference herein.

STATEMENT OF RIGHTS TO INVENTIONS MADE UNDER FEDERALLY SPONSORED RESEARCH

[0002] Not applicable.

FIELD OF THE INVENTION

[0003] The invention described herein relates to genes and their encoded proteins, termed 191P4D12(b), expressed in certain cancers, and to diagnostic and therapeutic methods and compositions useful in the management of cancers that express 191P4D12(b).

BACKGROUND OF THE INVENTION

[0004] Cancer is the second leading cause of human death next to coronary disease. Worldwide, millions of people die from cancer every year. In the United States alone, as reported by the American Cancer Society, cancer causes the death of well over a half-million people annually, with over 1.2 million new cases diagnosed per year. While deaths from heart disease have been declining significantly, those resulting from cancer generally are on the rise. In the early part of the next century, cancer is predicted to become the leading cause of death.

[0005] Worldwide, several cancers stand out as the leading killers. In particular, carcinomas of the lung, prostate, breast, colon, pancreas, and ovary represent the primary causes of cancer death. These and virtually all other carcinomas share a common lethal feature. With very few exceptions, metastatic disease from a carcinoma is fatal. Moreover, even for those cancer patients who initially survive their primary cancers, common experience has shown that their lives are dramatically altered. Many cancer patients experience strong anxieties driven by the awareness of the potential for recurrence or treatment failure. Many cancer patients experience physical debilitations following treatment. Furthermore, many cancer patients experience a recurrence.

[0006] Worldwide, prostate cancer is the fourth most prevalent cancer in men. In North America and Northern Europe, it is by far the most common cancer in males and is the second leading cause of cancer death in men. In the United States alone, well over 30,000 men die annually of this disease—second only to lung cancer. Despite the magnitude of these figures, there is still no effective treatment for metastatic prostate cancer. Surgical prostatectomy, radiation therapy, hormone ablation therapy, surgical castration and chemotherapy continue to be the main treatment modalities. Unfortunately, these treatments are ineffective for many and are often associated with undesirable consequences.

[0007] On the diagnostic front, the lack of a prostate tumor marker that can accurately detect early-stage, localized tumors remains a significant limitation in the diagnosis and management of this disease. Although the serum prostate specific antigen (PSA) assay has been a very useful tool, however its specificity and general utility is widely regarded as lacking in several important respects.

[0008] Progress in identifying additional specific markers for prostate cancer has been improved by the generation of prostate cancer xenografts that can recapitulate different stages of the disease in mice. The LAPC (Los Angeles Prostate Cancer) xenografts are prostate cancer xenografts that have survived passage in severe combined immune deficient (SCID) mice and have exhibited the capacity to mimic the transition from androgen dependence to androgen independence (Klein et al., 1997, Nat. Med. 3:402). More recently identified prostate cancer markers include PCTA-1 (Su et al., 1996, Proc. Natl. Acad. Sci. USA 93: 7252), prostate-specific membrane (PSM) antigen (Pinto et al., Clin Cancer Res 1996 Sep. 2 (9): 1445-51), STEAP (Hubert, et al., Proc Natl Acad Sci U S A. 1999 Dec. 7; 96(25): 14523-8) and prostate stem cell antigen (PSCA) (Reiter et al., 1998, Proc. Natl. Acad. Sci. USA 95: 1735).

[0009] While previously identified markers such as PSA, PSM, PCTA and PSCA have facilitated efforts to diagnose and treat prostate cancer, there is need for the identification of additional markers and therapeutic targets for prostate and related cancers in order to further improve diagnosis and therapy.

[0010] Renal cell carcinoma (RCC) accounts for approximately 3 percent of adult malignancies. Once adenomas reach a diameter of 2 to 3 cm, malignant potential exists. In the adult, the two principal malignant renal tumors are renal cell adenocarcinoma and transitional cell carcinoma of the renal pelvis or ureter. The incidence of renal cell adenocarcinoma is estimated at more than 29,000 cases in the United States, and more than 11,600 patients died of this disease in 1998. Transitional cell carcinoma is less frequent, with an incidence of approximately 500 cases per year in the United States.

[0011] Surgery has been the primary therapy for renal cell adenocarcinoma for many decades. Until recently, metastatic disease has been refractory to any systemic therapy. With recent developments in systemic therapies, particularly immunotherapies, metastatic renal cell carcinoma may be approached aggressively in appropriate patients with a possibility of durable responses. Nevertheless, there is a remaining need for effective therapies for these patients.

[0012] Of all new cases of cancer in the United States, bladder cancer represents approximately 5 percent in men (fifth most common neoplasm) and 3 percent in women (eighth most common neoplasm). The incidence is increasing slowly, concurrent with an increasing older population. In 1998, there was an estimated 54,500 cases, including 39,500 in men and 15,000 in women. The age-adjusted incidence in the United States is 32 per 100,000 for men and eight per 100,000 in women. The historic male/female ratio of 3:1 may be decreasing related to smoking patterns in women. There were an estimated 11,000 deaths from bladder cancer in 1998 (7,800 in men and 3,900 in women). Bladder cancer incidence and mortality strongly increase with age and will be an increasing problem as the population becomes more elderly.

[0013] Most bladder cancers recur in the bladder. Bladder cancer is managed with a combination of transurethral resection of the bladder (TUR) and intravesical chemotherapy or immunotherapy. The multifocal and recurrent nature of bladder cancer points out the limitations of TUR. Most muscle-invasive cancers are not cured by TUR alone. Radical cystectomy and urinary diversion is the most effective means to eliminate the cancer but carry an undeniable impact on urinary and sexual function. There continues to be a significant need for treatment modalities that are beneficial for bladder cancer patients.

[0014] An estimated 130,200 cases of colorectal cancer occurred in 2000 in the United States, including 93,800 cases of colon cancer and 36,400 of rectal cancer. Colorectal cancers are the third most common cancers in men and women. Incidence rates declined significantly during 1992-1996 (−2.1% per year). Research suggests that these declines have been due to increased screening and polyp removal, preventing progression of polyps to invasive cancers. There were an estimated 56,300 deaths (47,700 from colon cancer, 8,600 from rectal cancer) in 2000, accounting for about 11% of all U.S. cancer deaths.

[0015] At present, surgery is the most common form of therapy for colorectal cancer, and for cancers that have not spread, it is frequently curative. Chemotherapy, or chemotherapy plus radiation, is given before or after surgery to most patients whose cancer has deeply perforated the bowel wall or has spread to the lymph nodes. A permanent colostomy (creation of an abdominal opening for elimination of body wastes) is occasionally needed for colon cancer and is infrequently required for rectal cancer. There continues to be a need for effective diagnostic and treatment modalities for colorectal cancer.

[0016] There were an estimated 164,100 new cases of lung and bronchial cancer in 2000, accounting for 14% of all U.S. cancer diagnoses. The incidence rate of lung and bronchial cancer is declining significantly in men, from a high of 86.5 per 100,000 in 1984 to 70.0 in 1996. In the 1990s, the rate of increase among women began to slow. In 1996, the incidence rate in women was 42.3 per 100,000.

[0017] Lung and bronchial cancer caused an estimated 156,900 deaths in 2000, accounting for 28% of all cancer deaths. During 1992-1996, mortality from lung cancer declined significantly among men (−1.7% per year) while rates for women were still significantly increasing (0.9% per year). Since 1987, more women have died each year of lung cancer than breast cancer, which, for over 40 years, was the major cause of cancer death in women. Decreasing lung cancer incidence and mortality rates most likely resulted from decreased smoking rates over the previous 30 years; however, decreasing smoking patterns among women lag behind those of men. Of concern, although the declines in adult tobacco use have slowed, tobacco use in youth is increasing again.

[0018] Treatment options for lung and bronchial cancer are determined by the type and stage of the cancer and include surgery, radiation therapy, and chemotherapy. For many localized cancers, surgery is usually the treatment of choice. Because the disease has usually spread by the time it is discovered, radiation therapy and chemotherapy are often needed in combination with surgery. Chemotherapy alone or combined with radiation is the treatment of choice for small cell lung cancer; on this regimen, a large percentage of patients experience remission, which in some cases is long lasting. There is however, an ongoing need for effective treatment and diagnostic approaches for lung and bronchial cancers.

[0019] An estimated 182,800 new invasive cases of breast cancer were expected to occur among women in the United States during 2000. Additionally, about 1,400 new cases of breast cancer were expected to be diagnosed in men in 2000. After increasing about 4% per year in the 1980s, breast cancer incidence rates in women have leveled off in the 1990s to about 110.6 cases per 100,000.

[0020] In the U.S. alone, there were an estimated 41,200 deaths (40,800 women, 400 men) in 2000 due to breast cancer. Breast cancer ranks second among cancer deaths in women. According to the most recent data, mortality rates declined significantly during 1992-1996 with the largest decreases in younger women, both white and black. These decreases were probably the result of earlier detection and improved treatment.

[0021] Taking into account the medical circumstances and the patient's preferences, treatment of breast cancer may involve lumpectomy (local removal of the tumor) and removal of the lymph nodes under the arm; mastectomy (surgical removal of the breast) and removal of the lymph nodes under the arm; radiation therapy; chemotherapy; or hormone therapy. Often, two or more methods are used in combination. Numerous studies have shown that, for early stage disease, long-term survival rates after lumpectomy plus radiotherapy are similar to survival rates after modified radical mastectomy. Significant advances in reconstruction techniques provide several options for breast reconstruction after mastectomy. Recently, such reconstruction has been done at the same time as the mastectomy.

[0022] Local excision of ductal carcinoma in situ (DCIS) with adequate amounts of surrounding normal breast tissue may prevent the local recurrence of the DCIS. Radiation to the breast and/or tamoxifen may reduce the chance of DCIS occurring in the remaining breast tissue. This is important because DCIS, if left untreated, may develop into invasive breast cancer. Nevertheless, there are serious side effects or sequelae to these treatments. There is, therefore, a need for efficacious breast cancer treatments.

[0023] There were an estimated 23,100 new cases of ovarian cancer in the United States in 2000. It accounts for 4% of all cancers among women and ranks second among gynecologic cancers. During 1992-1996, ovarian cancer incidence rates were significantly declining. Consequent to ovarian cancer, there were an estimated 14,000 deaths in 2000. Ovarian cancer causes more deaths than any other cancer of the female reproductive system.

[0024] Surgery, radiation therapy, and chemotherapy are treatment options for ovarian cancer. Surgery usually includes the removal of one or both ovaries, the fallopian tubes (salpingo-oophorectomy), and the uterus (hysterectomy). In some very early tumors, only the involved ovary will be removed, especially in young women who wish to have children. In advanced disease, an attempt is made to remove all intra-abdominal disease to enhance the effect of chemotherapy. There continues to be an important need for effective treatment options for ovarian cancer.

[0025] There were an estimated 28,300 new cases of pancreatic cancer in the United States in 2000. Over the past 20 years, rates of pancreatic cancer have declined in men. Rates among women have remained approximately constant but may be beginning to decline. Pancreatic cancer caused an estimated 28,200 deaths in 2000 in the United States. Over the past 20 years, there has been a slight but significant decrease in mortality rates among men (about —0.9% per year) while rates have increased slightly among women.

[0026] Surgery, radiation therapy, and chemotherapy are treatment options for pancreatic cancer. These treatment options can extend survival and/or relieve symptoms in many patients but are not likely to produce a cure for most. There is a significant need for additional therapeutic and diagnostic options for pancreatic cancer.

SUMMARY OF THE INVENTION

[0027] The present invention relates to a gene, designated 191P4D12(b), that has now been found to be over-expressed in the cancer(s) listed in Table I. Northern blot expression analysis of 191P4D12(b) gene expression in normal tissues shows a restricted expression pattern in adult tissues. The nucleotide (FIG. 2) and amino acid (FIG. 2, and FIG. 3) sequences of 191P4D12(b) are provided. The tissue-related profile of 191P4D12(b) in normal adult tissues, combined with the over-expression observed in the tissues listed in Table I, shows that 191P4D12(b) is aberrantly over-expressed in at least some cancers, and thus serves as a useful diagnostic, prophylactic, prognostic, and/or therapeutic target for cancers of the tissue(s) such as those listed in Table I.

[0028] The invention provides polynucleotides corresponding or complementary to all or part of the 191P4D12(b) genes, mRNAs, and/or coding sequences, preferably in isolated form, including polynucleotides encoding 191P4D12(b)-related proteins and fragments of 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 contiguous amino acids; at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 85, 90, 95, 100 or more than 100 contiguous amino acids of a 191P4D12(b)-related protein, as well as the peptides/proteins themselves; DNA, RNA, DNA/RNA hybrids, and related molecules, polynucleotides or oligonucleotides complementary or having at least a 90% homology to the 191P4D12(b) genes or mRNA sequences or parts thereof, and polynucleotides or oligonucleotides that hybridize to the 191P4D12(b) genes, mRNAs, or to 191P4D12(b)-encoding polynucleotides. Also provided are means for isolating cDNAs and the genes encoding 191P4D12(b). Recombinant DNA molecules containing 191P4D12(b) polynucleotides, cells transformed or transduced with such molecules, and host-vector systems for the expression of 191P4D12(b) gene products are also provided. The invention further provides antibodies that bind to 191P4D12(b) proteins and polypeptide fragments thereof, including polyclonal and monoclonal antibodies, murine and other mammalian antibodies, chimeric antibodies, humanized and fully human antibodies, and antibodies labeled with a detectable marker or therapeutic agent. In certain embodiments, there is a proviso that the entire nucleic acid sequence of FIG. 2 is not encoded and/or the entire amino acid sequence of FIG. 2 is not prepared. In certain embodiments, the entire nucleic acid sequence of FIG. 2 is encoded and/or the entire amino acid sequence of FIG. 2 is prepared, either of which are in respective human unit dose forms.

[0029] The invention further provides methods for detecting the presence and status of 191P4D12(b) polynucleotides and proteins in various biological samples, as well as methods for identifying cells that express 191P4D12(b). A typical embodiment of this invention provides methods for monitoring 191P4D12(b) gene products in a tissue or hematology sample having or suspected of having some form of growth dysregulation such as cancer.

[0030] The invention further provides various immunogenic or therapeutic compositions and strategies for treating cancers that express 191P4D12(b) such as cancers of tissues listed in Table I, including therapies aimed at inhibiting the transcription, translation, processing or function of 191P4D12(b) as well as cancer vaccines. In one aspect, the invention provides compositions, and methods comprising them, for treating a cancer that expresses 191P4D12(b) in a human subject wherein the composition comprises a carrier suitable for human use and a human unit dose of one or more than one agent that inhibits the production or function of 191P4D12(b). Preferably, the carrier is a uniquely human carrier. In another aspect of the invention, the agent is a moiety that is immunoreactive with 191P4D12(b) protein. Non-limiting examples of such moieties include, but are not limited to, antibodies (such as single chain, monoclonal, polyclonal, humanized, chimeric, or human antibodies), functional equivalents thereof (whether naturally occurring or synthetic), and combinations thereof. The antibodies can be conjugated to a diagnostic or therapeutic moiety. In another aspect, the agent is a small molecule as defined herein.

[0031] In another aspect, the agent comprises one or more than one peptide which comprises a cytotoxic T lymphocyte (CTL) epitope that binds an HLA class I molecule in a human to elicit a CTL response to 191P4D12(b) and/or one or more than one peptide which comprises a helper T lymphocyte (HTL) epitope which binds an HLA class II molecule in a human to elicit an HTL response. The peptides of the invention may be on the same or on one or more separate polypeptide molecules. In a further aspect of the invention, the agent comprises one or more than one nucleic acid molecule that expresses one or more than one of the CTL or HTL response stimulating peptides as described above. In yet another aspect of the invention, the one or more than one nucleic acid molecule may express a moiety that is immunologically reactive with 191P4D12(b) as described above. The one or more than one nucleic acid molecule may also be, or encodes, a molecule that inhibits production of 191P4D12(b). Non-limiting examples of such molecules include, but are not limited to, those complementary to a nucleotide sequence essential for production of 191P4D12(b) (e.g. antisense sequences or molecules that form a triple helix with a nucleotide double helix essential for 191P4D12(b) production) or a ribozyme effective to lyse 191P4D12(b) mRNA.

[0032] Note that to determine the starting position of any peptide set forth in Tables VIII-XXI and XXII to XLIX (collectively HLA Peptide Tables) respective to its parental protein, e.g., variant 1, variant 2, etc., reference is made to three factors: the particular variant, the length of the peptide in an HLA Peptide Table, and the Search Peptides in Table VII. Generally, a unique Search Peptide is used to obtain HLA peptides of a particular for a particular variant. The position of each Search Peptide relative to its respective parent molecule is listed in Table VII. Accordingly, if a Search Peptide begins at position “X”, one must add the value “X−1” to each position in Tables VIII-XXI and XXII to XLIX to obtain the actual position of the HLA peptides in their parental molecule. For example, if a particular Search Peptide begins at position 150 of its parental molecule, one must add 150−1, i.e., 149 to each HLA peptide amino acid position to calculate the position of that amino acid in the parent molecule.

[0033] One embodiment of the invention comprises an HLA peptide, that occurs at least twice in Tables VIII-XXI and XXII to XLIX collectively, or an oligonucleotide that encodes the HLA peptide. Another embodiment of the invention comprises an HLA peptide that occurs at least once in Tables VIII-XXI and at least once in tables XXII to XLIX, or an oligonucleotide that encodes the HLA peptide.

[0034] Another embodiment of the invention is antibody epitopes, which comprise a peptide regions, or an oligonucleotide encoding the peptide region, that has one two, three, four, or five of the following characteristics:

[0035] i) a peptide region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Hydrophilicity profile of FIG. 5;

[0036] ii) a peptide region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or less than 0.5, 0.4, 0.3, 0.2, 0.1, or having a value equal to 0.0, in the Hydropathicity profile of FIG. 6;

[0037] iii) a peptide region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Percent Accessible Residues profile of FIG. 7;

[0038] iv) a peptide region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Average Flexibility profile of FIG. 8; or

[0039] v) a peptide region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Beta-turn profile of FIG. 9.

BRIEF DESCRIPTION OF THE FIGURES

[0040] FIG. 1. The 191P4D12(b) SSH sequence of 223 nucleotides.

[0041] FIG. 2. A) The cDNA and amino acid sequence of 191P4D12(b) variant 1 (also called “191P4D12(b) v.1” or “191P4D12(b) variant 1”) is shown in FIG. 2A. The start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0042] B) The cDNA and amino acid sequence of 191P4D12(b) variant 2 (also called “191P4D12(b) v.2”) is shown in FIG. 2B. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0043] C) The cDNA and amino acid sequence of 191P4D12(b) variant 3 (also called “191P4D12(b) v.3”) is shown in FIG. 2C. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0044] D) The cDNA and amino acid sequence of 191P4D12(b) variant 4 (also called “191P4D12(b) v.4”) is shown in FIG. 2D. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0045] E) The cDNA and amino acid sequence of 191P4D12(b) variant 5 (also called “191P4D12(b) v.5”) is shown in FIG. 2E. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0046] F) The cDNA and amino acid sequence of 191P4D12(b) variant 6 (also called “191P4D12(b) v.6”) is shown in FIG. 2F. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 789-1676 including the stop codon.

[0047] G) The cDNA and amino acid sequence of 191P4D12(b) variant 7 (also called “191P4D12(b) v.7”) is shown in FIG. 2G. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1721 including the stop codon.

[0048] H) The cDNA and amino acid sequence of 191P4D12(b) variant 8 (also called “191P4D12(b) v.8”) is shown in FIG. 2H. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0049] I) The cDNA and amino acid sequence of 191P4D12(b) variant 9 (also called “191P4D12(b) v.9”) is shown in FIG. 21. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 708-1121 including the stop codon.

[0050] J) The cDNA and amino acid sequence of 191P4D12(b) variant 10 (also called “191P4D12(b) v.10”) is shown in FIG. 2J. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0051] K) The cDNA and amino acid sequence of 191P4D12(b) variant 11 (also called “191P4D12(b) v.11”) is shown in FIG. 2K. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0052] L) The cDNA and amino acid sequence of 191P4D12(b) variant 12 (also called “191P4D12(b) v.12”) is shown in FIG. 2L. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1796 including the stop codon.

[0053] M) The cDNA and amino acid sequence of 191P4D12(b) variant 13 (also called “191P4D12(b) v.13”) is shown in FIG. 2M. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 264-1799 including the stop codon.

[0054] N) The cDNA and amino acid sequence of 191P4D12(b) variant 14 (also called “191P4D12(b) v.14”) is shown in FIG. 2N. The codon for the start methionine is underlined. The open reading frame extends from nucleic acid 708-1121 including the stop codon.

[0055] FIG. 3.

[0056] A) The amino acid sequence of 191P4D12(b) v.1 is shown in FIG. 3A; it has 510 amino acids.

[0057] B) The amino acid sequence of 191P4D12(b) v.2 is shown in FIG. 3B; it has 510 amino acids.

[0058] C) The amino acid sequence of 191P4D12(b) v.6 is shown in FIG. 3C; it has 295 amino acids.

[0059] D) The amino acid sequence of 191P4D12(b) v.7 is shown in FIG. 3D; it has 485 amino acids.

[0060] E) The amino acid sequence of 191P4D12(b) v.10 is shown in FIG. 3E; it has 510 amino acids.

[0061] F) The amino acid sequence of 191P4D12(b) v.11 is shown in FIG. 3F; it has 510 amino acids.

[0062] G) The amino acid sequence of 191P4D12(b) v.12 is shown in FIG. 3G; it has 510 amino acids.

[0063] H) The amino acid sequence of 191P4D12(b) v.13 is shown in FIG. 3H; it has 511 amino acids.

[0064] I) The amino acid sequence of 191P4D12(b) v.9 is shown in FIG. 31; it has 137 amino acids.

[0065] J) The amino acid sequence of 191P4D12(b) v.14 is shown in FIG. 3J; it has 137 amino acids.

[0066] As used herein, a reference to 191P4D12(b) includes all variants thereof, including those shown in FIGS. 2, 3, 10, and 11, unless the context clearly indicates otherwise.

[0067] FIG. 4. Alignment of 191P4D12(b) with known homologs. FIG. 4(A) Alignment of 191P4D12(b) with human Ig superfamily receptor LNIR (gi 14714574). FIG. 4(B) Alignment of 191P4D12(b) with mouse nectin 4 (gi 18874521).

[0068] FIG. 5. Hydrophilicity amino acid profile of 191P4D12(b)v.1, v.7, and v.9 determined by computer algorithm sequence analysis using the method of Hopp and Woods (Hopp T. P., Woods K. R., 1981. Proc. Natl. Acad. Sci. U.S.A. 78:3824-3828) accessed on the Protscale website located on the World Wide Web at (expasy.ch/cgi-bin/protscale.pl) through the ExPasy molecular biology server.

[0069] FIG. 6. Hydropathicity amino acid profile of 191P4D12(b)v.1, v.7, and v.9 determined by computer algorithm sequence analysis using the method of Kyte and Doolittle (Kyte J., Doolittle R. F., 1982. J. Mol. Biol. 157:105-132) accessed on the ProtScale website located on the World Wide Web at (.expasy.ch/cgi-bin/protscale.pl) through the ExPasy molecular biology server.

[0070] FIG. 7. Percent accessible residues amino acid profile of 191P4D12(b)v.1, v.7, and v.9 determined by computer algorithm sequence analysis using the method of Janin (Janin J., 1979 Nature 277:491-492) accessed on the ProtScale website located on the World Wide Web at (.expasy.ch/cgi-bin/protscale.pl) through the ExPasy molecular biology server.

[0071] FIG. 8. Average flexibility amino acid profile of 191P4D12(b)v.1, v.7, and v.9 determined by computer algorithm sequence analysis using the method of Bhaskaran and Ponnuswamy (Bhaskaran R., and Ponnuswamy P. K., 1988. Int. J. Pept. Protein Res. 32:242-255) accessed on the ProtScale website located on the World Wide Web at (.expasy.ch/cgi-bin/protscale.pl) through the ExPasy molecular biology server.

[0072] FIG. 9. Beta-turn amino acid profile of 191P4D12(b)v.1, v.7, and v.9 determined by computer algorithm sequence analysis using the method of Deleage and Roux (Deleage, G., Roux B. 1987 Protein Engineering 1:289-294) accessed on the ProtScale website located on the World Wide Web at (.expasy.ch/cgi-bin/protscale.pl) through the ExPasy molecular biology server.

[0073] FIG. 10. Schematic alignment of SNP variants of 191P4D12(b). Variants 191P4D12(b) v.2 through v.5 and v.10 through v.12 are variants with single nucleotide differences. Compared with v.1, v.13 had an insertion of three bases (GCA) between 1262 and 1263 and added one amino acid “A” to the protein. Variant v.14 was a SNP variant of transcript variant v.9, corresponding to the SNP at 2688 of v.1. Though these SNP variants were shown separately, they could also occur in any combinations and in any transcript variants, as shown in FIG. 12, that contained the base pairs. Numbers correspond to those of 191P4D12(b) v.1. Black box shows the same sequence as 191P4D12(b) v.1. SNPs are indicated above the box.

[0074] FIG. 11. Schematic alignment of protein variants of 191P4D12(b). Protein variants correspond to nucleotide variants. Nucleotide variants 191P4D12(b) v.3, v.4, v.5 and v.8 coded for the same protein as v.1. Nucleotide variants 191P4D12(b) v.6, v.7, v.8 and v.9 were splice variants of v.1, as shown in FIG. 12. Variant v.9 translated to a totally different protein than other variants, with two isoforms that different from each other by one amino acid at 64: A or D. Variant v.13 had an insertion of one amino acid “A” at 334. Single amino acid differences were indicated above the boxes. Black boxes represent the same sequence as 191P4D12(b) v.1. Numbers underneath the box correspond to 191P4D12(b) v.1.

[0075] FIG. 12. Exon compositions of transcript variants of 191P4D12(b). Variant 191P4D12(b) v.6, v.7, v.8 and v.9 are transcript variants of v.1. Variants v.6, v.7 and v.8 spliced out 202-321, 1497-1571 and 2951-3013 of v.1, respectively. Variant v.9 was part of the last exon of v.1. The order of the potential exons on the human genome is shown at the bottom. Poly A tails were not shown in the figure. Ends of exons are shown above the boxes. Numbers in “()” underneath the boxes correspond to those of 191P4D12(b) v.1. Lengths of introns and exons are not proportional.

[0076] FIG. 13. Secondary structure and transmembrane domains prediction for 191P4D12(b) protein variants. The secondary structure of 191P4D12(b) protein variants 1 (SEQ ID NO: 127), v6 (SEQ ID NO: 128), v7 (SEQ ID NO: 129), and v9 (SEQ ID NO: 130) (FIGS. 13A-D respectively) were predicted using the HNN—Hierarchical Neural Network method (Guermeur, 1997, http://pbil.ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_nn.html), accessed from the ExPasy molecular biology server located on the World Wide Web at (.expasy.ch/tools/). This method predicts the presence and location of alpha helices, extended strands, and random coils from the primary protein sequence.

[0077] The percent of the protein in a given secondary structure is also listed. FIGS. 13E, 13G, 13I, 13K: Schematic representations of the probability of existence of transmembrane regions and orientation of 191P4D12(b) variants 1, 6, 7, and 9, respectively, based on the TMpred algorithm of Hofmann and Stoffel which utilizes TMBASE (K. Hofmann, W. Stoffel. TMBASE—A database of membrane spanning protein segments Biol. Chem. Hoppe-Seyler 374:166, 1993). FIGS. 13F, 13H, 13J, 13L. Schematic representations of the probability of the existence of transmembrane regions and the extracellular and intracellular orientation of 191P4D12(b) variants 1, 6, 7, and 9, respectively, based on the TMHMM algorithm of Sonnhammer, von Heijne, and Krogh (Erik L. L. Sonnhammer, Gunnar von Heijne, and Anders Krogh: A hidden Markov model for predicting transmembrane helices in protein sequences. In Proc. of Sixth Int. Conf. on Intelligent Systems for Molecular Biology, p 175-182 Ed J. Glasgow, T. Littlejohn, F. Major, R. Lathrop, D. Sankoff, and C. Sensen Menlo Park, Calif.: AAAI Press, 1998). The TMpred and TMHMM algorithms are accessed from the ExPasy molecular biology server located on the World Wide Web at (.expasy.ch/tools/).

[0078] FIG. 14. 191P4D12(b) Expression by RT-PCR. First strand cDNA was prepared from (A) vital pool 1 (liver, lung and kidney), vital pool 2 (pancreas, colon and stomach), normal kidney, prostate cancer pool, bladder cancer pool, colon cancer pool, lung cancer pool, breast cancer pool and cancer metastasis pool; (B) prostate cancer metastasis to lymph node, prostate cancer pool, bladder cancer pool, kidney cancer pool, colon cancer pool, lung cancer pool, ovary cancer pool, breast cancer pool, cancer metastasis pool, pancreas cancer pool, and LAPC prostate xenograft pool. Normalization was performed by PCR using primers to actin and GAPDH. Semi-quantitative PCR, using primers to 191P4D12(b), was performed at 26 and 30 cycles of amplification. In (A) results show strong expression of 191P4D12(b) in bladder cancer pool. Expression of 191P4D12(b) was also detected in prostate cancer pool, colon cancer pool, lung cancer pool, breast cancer pool and cancer metastasis pool but very weakly in vital pool 1 and vital pool 2. In (B) results show strong expression of 191P4D12(b) in prostate, bladder, kidney, colon, lung, ovary, breast, cancer metastasis, and pancreas cancer specimens.

[0079] FIG. 15. Expression of 191P4D12(b) in normal tissues. Two multiple tissue northern blots (Clontech) both with 2 ug of mRNA/lane were probed with the 191P4D12(b) sequence. Size standards in kilobases (kb) are indicated on the side. Results show expression of an approximately 4 kb transcript in placenta and very weakly in prostate but not in any other normal tissue tested. A smaller 191P4D12(b) transcript of approximately 2.5 kb was detected in heart and skeletal muscle.

[0080] FIG. 16. Expression of 191P4D12(b) in Patient Cancer Specimens and Normal Tissues. RNA was extracted from a pool of 3 bladder cancer patient specimens, as well as from normal prostate (NP), normal bladder (NB), normal kidney (NK), normal colon (NC), normal lung (NL), normal breast (NBr), normal ovary (NO), and normal pancreas (NPa). Northern blot with 10 ug of total RNA/lane was probed with 191P4D12(b) SSH sequence. Size standards in kilobases (kb) are indicated on the side. The 191P4D12(b) transcript was detected in the bladder cancer specimens, but not in the normal tissues tested.

[0081] FIG. 17. Expression of 191P4D12(b) in Bladder Cancer Patient Specimens. RNA was extracted from bladder cancer cell lines (CL), normal bladder (N), and bladder cancer patient tumors (T). Northern blots with 10 ug of total RNA were probed with the 191P4D12(b) SSH fragment. Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in the bladder tumor tissues but not in normal bladder. A smaller transcript was detected in the HT1197 cell line but not in the other cancer cell lines tested.

[0082] FIG. 18. Expression of 191P4D12(b) in Prostate Cancer Xenografts. RNA was extracted from normal prostate, and from the prostate cancer xenografts LAPC-4AD, LAPC-4AI, LAPC-9AD, and LAPC-9AI. Northern blots with 10 ug of total RNA were probed with the 191P4D12(b) SSH fragment. Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in all the LAPC xenograft tissues but not in normal prostate.

[0083] FIG. 19. Expression of 191P4D12(b) in Cervical Cancer Patient Specimens. RNA was extracted from normal cervix, Hela cancer cell line, and 3 cervix cancer patient tumors (T). Northern blots with 10 ug of total RNA were probed with the 191P4D12(b) SSH fragment. Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in 2 out of 3 cervix tumors but not in normal cervix nor in the Hela cell line.

[0084] FIG. 20. Expression of 191P4D12(b) in Lung Cancer Patient Specimens. RNA was extracted from lung cancer cell lines (CL), normal lung (N), bladder cancer patient tumors (T), and normal adjacent tissue (Nat). Northern blots with 10 ug of total RNA were probed with the 191P4D12(b). Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in the lung tumor tissues but not in normal lung nor in the cell lines tested.

[0085] FIG. 21. FIG. 21A. 191P4D12(b) Expression in Lung Cancer. First strand cDNA was prepared from a panel of lung cancer specimens. Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected; 1=weak expression, 2=moderate expression; 3=strong expression. Results show expression of 191P4D12(b) in 97% of the 31 lung cancer patient specimens tested. FIG. 21B. 191P4D12(b) Expression in Bladder Cancer. First strand cDNA was prepared from a panel of bladder cancer specimens. Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected, 1=weak expression, 2=moderate expression; 3=strong expression. Results show expression of 191P4D12(b) in 94% of the 18 bladder cancer patient specimens tested. FIG. 21C. 191P4D12(b) Expression in Prostate Cancer. First strand cDNA was prepared from a panel of prostate cancer specimens, and four LAPC prostate cancer xenografts. Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected; 1=weak expression, 2=moderate expression, 3=strong expression. Results show expression of 191P4D12(b) in 100% of the 20 prostate cancer patient specimens tested, and in all 4 prostate cancer xenografts. FIG. 21D. 191P4D12(b) Expression in Colon Cancer. First strand cDNA was prepared from a panel of colon cancer specimens. Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected; 1=weak expression, 2=moderate expression; 3=strong expression. Results show expression of 191P4D12(b) in 100% of the 22 colon cancer patient specimens tested. FIG. 21E. 191P4D12(b) Expression in Uterus Cancer. First strand cDNA was prepared from a panel of uterus cancer specimens. Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected; 1=weak expression, 2=moderate expression; 3=strong expression. Results show expression of 191P4D12(b) in 100% of the 12 uterus cancer patient specimens tested. FIG. 21F. 191P4D12(b) Expression in Cervical Cancer. First strand cDNA was prepared from a panel of cervix cancer specimens. Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected; 1=weak expression, 2=moderate expression; 3=strong expression. Results show expression of 191P4D12(b) in 100% of the 14 cervix cancer patient specimens tested.

[0086] FIG. 22. Transient Expression of 191P4D12(b) in Transfected 293T Cells. 293T cells were transfected with either 191P4D12(b).pTag5, 191P4D12(b).pcDNA3.1/mychis or pcDNA3.1/mychis vector control. Forty hours later, cell lysates and supernatant were collected. Samples were run on an SDS-PAGE acrylamide gel, blotted and stained with anti-his antibody. The blot was developed using the ECL chemiluminescence kit and visualized by autoradiography. Results show expression from 191P4D12(b).pTag5 plasmid of 191P4D12(b) extracellular domain in the lysate (Lane 2) and secretion in the culture supernatant (Lane 1). Also, expression of 191P4D12(b) was detected from in the lysates of 191P4D12(b).pcDNA3.1/mychis transfected cells (Lane 3), but not from the control pcDNA3.1/mychis (Lane 4).

[0087] FIG. 23. Expression of 191P4D12(b) in Transduced Cells Following Retroviral Gene Transfer. 3T3 cells were transduced with the pSRa retroviral vector encoding the 191P4D12(b) gene. Following selection with neomycin, the cells were expanded and RNA was extracted. Northern blot with 10 ug of total RNA/lane was probed with the 191P4D12(b) SSH sequence. Size standards in kilobases (kb) are indicated on the side. Results show expression of the 191P4D12(b) transcript driven from the retroviral LTR, which migrates slower than the endogenous 4 kb 191P4D12(b) transcript detected in the positive control LAPC-4AD.

DETAILED DESCRIPTION OF THE INVENTION Outline of Sections

[0088] I.) Definitions

[0089] II.) 191P4D12(b) Polynucleotides

[0090] II.A.) Uses of 191P4D12(b) Polynucleotides

[0091] II.A.1.) Monitoring of Genetic Abnormalities

[0092] II.A.2.) Antisense Embodiments

[0093] II.A.3.) Primers and Primer Pairs

[0094] II.A.4.) Isolation of 191P4D12(b)-Encoding Nucleic Acid Molecules

[0095] II.A.5.) Recombinant Nucleic Acid Molecules and Host-Vector Systems

[0096] III.) 191P4D12(b)-related Proteins

[0097] III.A.) Motif-bearing Protein Embodiments

[0098] III.B.) Expression of 191P4D12(b)-related Proteins

[0099] III.C.) Modifications of 191P4D12(b)-related Proteins

[0100] III.D.) Uses of 191P4D12(b)-related Proteins

[0101] IV.) 191P4D12(b) Antibodies

[0102] V.) 191P4D12(b) Cellular Immune Responses

[0103] VI.) 191P4D12(b) Transgenic Animals

[0104] VIl.) Methods for the Detection of 191P4D12(b)

[0105] VIII.) Methods for Monitoring the Status of 191P4D12(b)-related Genes and Their Products

[0106] IX.) Identification of Molecules That Interact With 191P4D12(b)

[0107] X.) Therapeutic Methods and Compositions

[0108] X.A.) Anti-Cancer Vaccines

[0109] X.B.) 191P4D12(b) as a Target for Antibody-Based Therapy

[0110] X.C.) 191P4D12(b) as a Target for Cellular Immune Responses

[0111] X.C.1. Minigene Vaccines

[0112] X.C.2. Combinations of CTL Peptides with Helper Peptides

[0113] X.C.3. Combinations of CTL Peptides with T Cell Priming Agents

[0114] X.C.4. Vaccine Compositions Comprising DC Pulsed with CTL and/or HTL Peptides

[0115] X.D.) Adoptive Immunotherapy

[0116] X.E.) Administration of Vaccines for Therapeutic or Prophylactic Purposes

[0117] XI.) Diagnostic and Prognostic Embodiments of 191P4D12(b).

[0118] XII.) Inhibition of 191P4D12(b) Protein Function

[0119] XII.A.) Inhibition of 191P4D12(b) With Intracellular Antibodies

[0120] XII.B.) Inhibition of 191P4D12(b) with Recombinant Proteins

[0121] XII.C.) Inhibition of 191P4D12(b) Transcription or Translation

[0122] XII.D.) General Considerations for Therapeutic Strategies

[0123] XIII.) Identification, Characterization and Use of Modulators of 191P4D12(b)

[0124] XIV.) KITS/Articles of Manufacture

[0125] I.) Definitions:

[0126] Unless otherwise defined, all terms of art, notations and other scientific terms or terminology used herein are intended to have the meanings commonly understood by those of skill in the art to which this invention pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art. Many of the techniques and procedures described or referenced herein are well understood and commonly employed using conventional methodology by those skilled in the art, such as, for example, the widely utilized molecular cloning methodologies described in Sambrook et al., Molecular Cloning: A Laboratory Manual 2nd. edition (1989) Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. As appropriate, procedures involving the use of commercially available kits and reagents are generally carried out in accordance with manufacturer defined protocols and/or parameters unless otherwise noted.

[0127] The terms “advanced prostate cancer”, “locally advanced prostate cancer”, “advanced disease” and “locally advanced disease” mean prostate cancers that have extended through the prostate capsule, and are meant to include stage C disease under the American Urological Association (AUA) system, stage C1-C2 disease under the Whitmore-Jewett system, and stage T3-T4 and N+ disease under the TNM (tumor, node, metastasis) system. In general, surgery is not recommended for patients with locally advanced disease, and these patients have substantially less favorable outcomes compared to patients having clinically localized (organ-confined) prostate cancer. Locally advanced disease is clinically identified by palpable evidence of induration beyond the lateral border of the prostate, or asymmetry or induration above the prostate base. Locally advanced prostate cancer is presently diagnosed pathologically following radical prostatectomy if the tumor invades or penetrates the prostatic capsule, extends into the surgical margin, or invades the seminal vesicles.

[0128] “Altering the native glycosylation pattern” is intended for purposes herein to mean deleting one or more carbohydrate moieties found in native sequence 191P4D12(b) (either by removing the underlying glycosylation site or by deleting the glycosylation by chemical and/or enzymatic means), and/or adding one or more glycosylation sites that are not present in the native sequence 191P4D12(b). In addition, the phrase includes qualitative changes in the glycosylation of the native proteins, involving a change in the nature and proportions of the various carbohydrate moieties present.

[0129] The term “analog” refers to a molecule which is structurally similar or shares similar or corresponding attributes with another molecule (e.g. a 191P4D12(b)-related protein). For example, an analog of a 191P4D12(b) protein can be specifically bound by an antibody or T cell that specifically binds to 191P4D12(b).

[0130] The term “antibody” is used in the broadest sense. Therefore, an “antibody” can be naturally occurring or man-made such as monoclonal antibodies produced by conventional hybridoma technology. Anti-191P4D12(b) antibodies comprise monoclonal and polyclonal antibodies as well as fragments containing the antigen-binding domain and/or one or more complementarity determining regions of these antibodies.

[0131] An “antibody fragment” is defined as at least a portion of the variable region of the immunoglobulin molecule that binds to its target, i.e., the antigen-binding region. In one embodiment it specifically covers single anti-191P4D12(b) antibodies and clones thereof (including agonist, antagonist and neutralizing antibodies) and anti-191P4D12(b) antibody compositions with polyepitopic specificity.

[0132] The term “codon optimized sequences” refers to nucleotide sequences that have been optimized for a particular host species by replacing any codons having a usage frequency of less than about 20%. Nucleotide sequences that have been optimized for expression in a given host species by elimination of spurious polyadenylation sequences, elimination of exon/intron splicing signals, elimination of transposon-like repeats and/or optimization of GC content in addition to codon optimization are referred to herein as an “expression enhanced sequences.”

[0133] A “combinatorial library” is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical “building blocks” such as reagents. For example, a linear combinatorial chemical library, such as a polypeptide (e.g., mutein) library, is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length (i.e., the number of amino acids in a polypeptide compound). Numerous chemical compounds are synthesized through such combinatorial mixing of chemical building blocks (Gallop et al., J. Med. Chem. 37(9): 1233-1251 (1994)).

[0134] Preparation and screening of combinatorial libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Pat. No. 5,010,175, Furka, Pept. Prot. Res. 37:487-493 (1991), Houghton et al., Nature, 354:84-88 (1991)), peptoids (PCT Publication No WO 91/19735), encoded peptides (PCT Publication WO 93/20242), random bio-oligomers (PCT Publication WO 92/00091), benzodiazepines (U.S. Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al., Proc. Nat. Acad. Sci. USA 90:6909-6913 (1993)), vinylogous polypeptides (Hagihara et al., J. Amer. Chem. Soc. 114:6568 (1992)), nonpeptidal peptidomimetics with a Beta-D-Glucose scaffolding (Hirschmann et al., J. Amer. Chem. Soc. 114:9217-9218 (1992)), analogous organic syntheses of small compound libraries (Chen et al., J. Amer. Chem. Soc. 116:2661 (1994)), oligocarbarnates (Cho, et al., Science 261:1303 (1993)), and/or peptidyl phosphonates (Campbell et al., J. Org. Chem. 59:658 (1994)). See, generally, Gordon et al., J. Med. Chem. 37:1385 (1994), nucleic acid libraries (see, e.g., Stratagene, Corp.), peptide nucleic acid libraries (see, e.g., U.S. Pat. No. 5,539,083), antibody libraries (see, e.g., Vaughn et al., Nature Biotechnology 14(3): 309-314 (1996), and PCT/US96/10287), carbohydrate libraries (see, e.g., Liang et al., Science 274:1520-1522 (1996), and U.S. Pat. No. 5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum, C&EN, Jan 18, page 33 (1993); isoprenoids, U.S. Pat. No. 5,569,588; thiazolidinones and metathiazanones, U.S. Pat. No. 5,549,974; pyrrolidines, U.S. Pat. Nos. 5,525,735 and 5,519,134; morpholino compounds, U.S. Pat. No. 5,506,337; benzodiazepines, U.S. Pat. No. 5,288,514; and the like).

[0135] Devices for the preparation of combinatorial libraries are commercially available (see, e.g., 357 NIPS, 390 NIPS, Advanced Chem Tech, Louisville Ky.; Symphony, Rainin, Woburn, Mass.; 433A, Applied Biosystems, Foster City, Calif.; 9050, Plus, Millipore, Bedford, NIA). A number of well-known robotic systems have also been developed for solution phase chemistries. These systems include automated workstations such as the automated synthesis apparatus developed by Takeda Chemical Industries, LTD. (Osaka, Japan) and many robotic systems utilizing robotic arms (Zymate H, Zymark Corporation, Hopkinton, Mass.; Orca, Hewlett-Packard, Palo Alto, Calif.), which mimic the manual synthetic operations performed by a chemist. Any of the above devices are suitable for use with the present invention. The nature and implementation of modifications to these devices (if any) so that they can operate as discussed herein will be apparent to persons skilled in the relevant art. In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, N.J.; Asinex, Moscow, RU; Tripos, Inc., St. Louis, Mo.; ChemStar, Ltd, Moscow, RU; 3D Pharmaceuticals, Exton, Pa.; Martek Biosciences, Columbia, Md.; etc.).

[0136] The term “cytotoxic agent” refers to a substance that inhibits or prevents the expression activity of cells, function of cells and/or causes destruction of cells. The term is intended to include radioactive isotopes chemotherapeutic agents, and toxins such as small molecule toxins or enzymatically active toxins of bacterial, fungal, plant or animal origin, including fragments and/or variants thereof. Examples of cytotoxic agents include, but are not limited to auristatins, auromycins, maytansinoids, yttrium, bismuth, ricin, ricin A-chain, combrestatin, duocarmycins, dolostatins, doxorubicin, daunorubicin, taxol, cisplatin, cc1065, ethidium bromide, mitomycin, etoposide, tenoposide, vincristine, vinblastine, colchicine, dihydroxy anthracin dione, actinomycin, diphtheria toxin, Pseudomonas exotoxin (PE) A, PE40, abrin, abrin A chain, modeccin A chain, alpha-sarcin, gelonin, mitogellin, retstrictocin, phenomycin, enomycin, curicin, crotin, calicheamicin, Sapaonaria officinalis inhibitor, and glucocorticoid and other chemotherapeutic agents, as well as radioisotopes such as At211, I131, I125,Y90, Re186, Re188, Sm153, Bi212 or 213, P32 and radioactive isotopes of Lu including Lu177. Antibodies may also be conjugated to an anti-cancer pro-drug activating enzyme capable of converting the pro-drug to its active form.

[0137] The “gene product” is sometimes referred to herein as a protein or mRNA. For example, a “gene product of the invention” is sometimes referred to herein as a “cancer amino acid sequence”, “cancer protein”, “protein of a cancer listed in Table I”, a “cancer mRNA”, “mRNA of a cancer listed in Table I”, etc. In one embodiment, the cancer protein is encoded by a nucleic acid of FIG. 2. The cancer protein can be a fragment, or alternatively, be the full-length protein to the fragment encoded by the nucleic acids of FIG. 2. In one embodiment, a cancer amino acid sequence is used to determine sequence identity or similarity. In another embodiment, the sequences are naturally occurring allelic variants of a protein encoded by a nucleic acid of FIG. 2. In another embodiment, the sequences are sequence variants as further described herein.

[0138] “High throughput screening” assays for the presence, absence, quantification, or other properties of particular nucleic acids or protein products are well known to those of skill in the art. Similarly, binding assays and reporter gene assays are similarly well known. Thus, e.g., U.S. Pat. No. 5,559,410 discloses high throughput screening methods for proteins; U.S. Pat. No. 5,585,639 discloses high throughput screening methods for nucleic acid binding (i.e., in arrays); while U.S. Pat. Nos. 5,576,220 and 5,541,061 disclose high throughput methods of screening for ligand/antibody binding.

[0139] In addition, high throughput screening systems are commercially available (see, e.g., Amersham Biosciences, Piscataway, N.J.; Zymark Corp., Hopkinton, Mass.; Air Technical Industries, Mentor, Ohio; Beckman Instruments, Inc. Fullerton, Calif.; Precision Systems, Inc., Natick, Mass.; etc.). These systems typically automate entire procedures, including all sample and reagent pipetting, liquid dispensing, timed incubations, and final readings of the microplate in detector(s) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization. The manufacturers of such systems provide detailed protocols for various high throughput systems. Thus, e.g., Zymark Corp. provides technical bulletins describing screening systems for detecting the modulation of gene transcription, ligand binding, and the like.

[0140] The term “homolog” refers to a molecule which exhibits homology to another molecule, by for example, having sequences of chemical residues that are the same or similar at corresponding positions.

[0141] “Human Leukocyte Antigen” or “HLA” is a human class I or class II Major Histocompatibility Complex (MHC) protein (see, e.g., Stites, et al., IMMUNOLOGY, 8TH ED., Lange Publishing, Los Altos, Calif. (1994).

[0142] The terms “hybridize”, “hybridizing”, “hybridizes” and the like, used in the context of polynucleotides, are meant to refer to conventional hybridization conditions, preferably such as hybridization in 50% formamide/6×SSC/0.1% SDS/100 &mgr;g/ml ssDNA, in which temperatures for hybridization are above 37 degrees C. and temperatures for washing in 0.1×SSC/0.1% SDS are above 55 degrees C.

[0143] The phrases “isolated” or “biologically pure” refer to material which is substantially or essentially free from components which normally accompany the material as it is found in its native state. Thus, isolated peptides in accordance with the invention preferably do not contain materials normally associated with the peptides in their in situ environment. For example, a polynucleotide is said to be “isolated” when it is substantially separated from contaminant polynucleotides that correspond or are complementary to genes other than the 191P4D12(b) genes or that encode polypeptides other than 191P4D12(b) gene product or fragments thereof. A skilled artisan can readily employ nucleic acid isolation procedures to obtain an isolated 191P4D12(b) polynucleotide. A protein is said to be “isolated,” for example, when physical, mechanical or chemical methods are employed to remove the 191P4D12(b) proteins from cellular constituents that are normally associated with the protein. A skilled artisan can readily employ standard purification methods to obtain an isolated 191P4D12(b) protein. Alternatively, an isolated protein can be prepared by chemical means.

[0144] The term “mammal” refers to any organism classified as a mammal, including mice, rats, rabbits, dogs, cats, cows, horses and humans. In one embodiment of the invention, the mammal is a mouse. In another embodiment of the invention, the mammal is a human.

[0145] The terms “metastatic prostate cancer” and “metastatic disease” mean prostate cancers that have spread to regional lymph nodes or to distant sites, and are meant to include stage D disease under the AUA system and stage T×N×M+ under the TNM system. As is the case with locally advanced prostate cancer, surgery is generally not indicated for patients with metastatic disease, and hormonal (androgen ablation) therapy is a preferred treatment modality. Patients with metastatic prostate cancer eventually develop an androgen-refractory state within 12 to 18 months of treatment initiation. Approximately half of these androgen-refractory patients die within 6 months after developing that status. The most common site for prostate cancer metastasis is bone. Prostate cancer bone metastases are often osteoblastic rather than osteolytic (i.e., resulting in net bone formation). Bone metastases are found most frequently in the spine, followed by the femur, pelvis, rib cage, skull and humerus. Other common sites for metastasis include lymph nodes, lung, liver and brain. Metastatic prostate cancer is typically diagnosed by open or laparoscopic pelvic lymphadenectomy, whole body radionuclide scans, skeletal radiography, and/or bone lesion biopsy.

[0146] The term “modulator” or “test compound” or “drug candidate” or grammatical equivalents as used herein describe any molecule, e.g., protein, oligopeptide, small organic molecule, polysaccharide, polynucleotide, etc., to be tested for the capacity to directly or indirectly alter the cancer phenotype or the expression of a cancer sequence, e.g., a nucleic acid or protein sequences, or effects of cancer sequences (e.g., signaling, gene expression, protein interaction, etc.) In one aspect, a modulator will neutralize the effect of a cancer protein of the invention. By “neutralize” is meant that an activity of a protein is inhibited or blocked, along with the consequent effect on the cell. In another aspect, a modulator will neutralize the effect of a gene, and its corresponding protein, of the invention by normalizing levels of said protein. In preferred embodiments, modulators alter expression profiles, or expression profile nucleic acids or proteins provided herein, or downstream effector pathways. In one embodiment, the modulator suppresses a cancer phenotype, e.g. to a normal tissue fingerprint. In another embodiment, a modulator induced a cancer phenotype. Generally, a plurality of assay mixtures is run in parallel with different agent concentrations to obtain a differential response to the various concentrations. Typically, one of these concentrations serves as a negative control, i.e., at zero concentration or below the level of detection.

[0147] Modulators, drug candidates or test compounds encompass numerous chemical classes, though typically they are organic molecules, preferably small organic compounds having a molecular weight of more than 100 and less than about 2,500 Daltons. Preferred small molecules are less than 2000, or less than 1500 or less than 1000 or less than 500 D. Candidate agents comprise functional groups necessary for structural interaction with proteins, particularly hydrogen bonding, and typically include at least an amine, carbonyl, hydroxyl or carboxyl group, preferably at least two of the functional chemical groups. The candidate agents often comprise cyclical carbon or heterocyclic structures and/or aromatic or polyaromatic structures substituted with one or more of the above functional groups. Modulators also comprise biomolecules such as peptides, saccharides, fatty acids, steroids, purines, pyrimidines, derivatives, structural analogs or combinations thereof. Particularly preferred are peptides. One class of modulators are peptides, for example of from about five to about 35 amino acids, with from about five to about 20 amino acids being preferred, and from about 7 to about 15 being particularly preferred. Preferably, the cancer modulatory protein is soluble, includes a non-transmembrane region, and/or, has an N-terminal Cys to aid in solubility. In one embodiment, the C-terminus of the fragment is kept as a free acid and the N-terminus is a free amine to aid in coupling, i.e., to cysteine. In one embodiment, a cancer protein of the invention is conjugated to an immunogenic agent as discussed herein. In one embodiment, the cancer protein is conjugated to BSA. The peptides of the invention, e.g., of preferred lengths, can be linked to each other or to other amino acids to create a longer peptide/protein. The modulatory peptides can be digests of naturally occurring proteins as is outlined above, random peptides, or “biased” random peptides. In a preferred embodiment, peptide/protein-based modulators are antibodies, and fragments thereof, as defined herein.

[0148] Modulators of cancer can also be nucleic acids. Nucleic acid modulating agents can be naturally occurring nucleic acids, random nucleic acids, or “biased” random nucleic acids. For example, digests of prokaryotic or eukaryotic genomes can be used in an approach analogous to that outlined above for proteins.

[0149] The term “monoclonal antibody” refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the antibodies comprising the population are identical except for possible naturally occurring mutations that are present in minor amounts.

[0150] A “motif”, as in biological motif of a 191P4D12(b)-related protein, refers to any pattern of amino acids forming part of the primary sequence of a protein, that is associated with a particular function (e.g. protein-protein interaction, protein-DNA interaction, etc) or modification (e.g. that is phosphorylated, glycosylated or amidated), or localization (e.g. secretory sequence, nuclear localization sequence, etc.) or a sequence that is correlated with being immunogenic, either humorally or cellularly. A motif can be either contiguous or capable of being aligned to certain positions that are generally correlated with a certain function or property. In the context of HLA motifs, “motif” refers to the pattern of residues in a peptide of defined length, usually a peptide of from about 8 to about 13 amino acids for a class I HLA motif and from about 6 to about 25 amino acids for a class II HLA motif, which is recognized by a particular HLA molecule. Peptide motifs for HLA binding are typically different for each protein encoded by each human HLA allele and differ in the pattern of the primary and secondary anchor residues.

[0151] A “pharmaceutical excipient” comprises a material such as an adjuvant, a carrier, pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservative, and the like.

[0152] “Pharmaceutically acceptable” refers to a non-toxic, inert, and/or composition that is physiologically compatible with humans or other mammals.

[0153] The term “polynucleotide” means a polymeric form of nucleotides of at least 10 bases or base pairs in length, either ribonucleotides or deoxynucleotides or a modified form of either type of nucleotide, and is meant to include single and double stranded forms of DNA and/or RNA. In the art, this term if often used interchangeably with “oligonucleotide”. A polynucleotide can comprise a nucleotide sequence disclosed herein wherein thymidine (T), as shown for example in FIG. 2, can also be uracil (U); this definition pertains to the differences between the chemical structures of DNA and RNA, in particular the observation that one of the four major bases in RNA is uracil (U) instead of thymidine (T).

[0154] The term “polypeptide” means a polymer of at least about 4, 5, 6, 7, or 8 amino acids. Throughout the specification, standard three letter or single letter designations for amino acids are used. In the art, this term is often used interchangeably with “peptide” or “protein”.

[0155] An HLA “primary anchor residue” is an amino acid at a specific position along a peptide sequence which is understood to provide a contact point between the immunogenic peptide and the HLA molecule. One to three, usually two, primary anchor residues within a peptide of defined length generally defines a “motif” for an immunogenic peptide. These residues are understood to fit in close contact with peptide binding groove of an HLA molecule, with their side chains buried in specific pockets of the binding groove. In one embodiment, for example, the primary anchor residues for an HLA class I molecule are located at position 2 (from the amino terminal position) and at the carboxyl terminal position of a 8, 9, 10, 11, or 12 residue peptide epitope in accordance with the invention. Alternatively, in another embodiment, the primary anchor residues of a peptide binds an HLA class II molecule are spaced relative to each other, rather than to the termini of a peptide, where the peptide is generally of at least 9 amino acids in length. The primary anchor positions for each motif and supermotif are set forth in Table IV. For example, analog peptides can be created by altering the presence or absence of particular residues in the primary and/or secondary anchor positions shown in Table IV. Such analogs are used to modulate the binding affinity and/or population coverage of a peptide comprising a particular HLA motif or supermotif.

[0156] “Radioisotopes” include, but are not limited to the following (non-limiting exemplary uses are also set forth):

Examples of Medical Isotopes:

[0157] 1 Isotope Description of use Actinium-225 See Thorium-229 (Th-229) (AC-225) Actinium-227 Parent of Radium-223 (Ra-223) which is an alpha (AC-227) emitter used to treat metastases in the skeleton resulting from cancer (i.e., breast and prostate cancers), and cancer radioimmunotherapy Bismuth-212 See Thorium-228 (Th-228) (Bi-212) Bismuth-213 See Thorium-229 (Th-229) (Bi-213) Cadmium-109 Cancer detection (Cd-109) Cobalt-60 Radiation source for radiotherapy of cancer, for food (Co-60) irradiators, and for sterilization of medical supplies Copper-64 A positron emitter used for cancer therapy and (Cu-64) SPECT imaging Copper-67 Beta/gamma emitter used in cancer radio- (Cu-67) immunotherapy and diagnostic studies (i.e., breast and colon cancers, and lymphoma) Dysprosium-166 Cancer radioimmunotherapy (Dy-166) Erbium-169 Rheumatoid arthritis treatment, particularly for (Er-169) the small joints associated with fingers and toes Europium-152 Radiation source for food irradiation and for (Eu-152) sterilization of medical supplies Europium-154 Radiation source for food irradiation and for (Eu-154) sterilization of medical supplies Gadolinium-153 Osteoporosis detection and nuclear (Gd-153) medical quality assurance devices Gold-198 Implant and intracavity therapy of ovarian, (Au-198) prostate, and brain cancers Holmium-166 Multiple myeloma treatment in targeted skeletal (Ho-166) therapy, cancer radioimmunotherapy, bone marrow ablation, and rheumatoid arthritis treatment Iodine-125 Osteoporosis detection, diagnostic imaging, tracer (1-125) drugs, brain cancer treatment, radiolabeling, tumor imaging, mapping of receptors in the brain, interstitial radiation therapy, brachytherapy for treatment of prostate cancer, determination of glomerular filtration rate (GFR), determination of plasma volume, detection of deep vein thrombosis of the legs Iodine-131 Thyroid function evaluation, thyroid disease detection, (1-131) treatment of thyroid cancer as well as other non- malignant thyroid diseases (i.e., Graves disease, goiters, and hyperthyroidism), treatment of leukemia, lymphoma, and other forms of cancer (e.g., breast cancer) using radioimmunotherapy Iridium-192 Brachytherapy, brain and spinal cord tumor treatment, (Ir-192) treatment of blocked arteries (i.e., arteriosclerosis and restenosis), and implants for breast and prostate tumors Lutetium-177 Cancer radioimmunotherapy and treatment of blocked (Lu-177) arteries (i.e., arteriosclerosis and restenosis) Molybdenum-99 Parent of Technetium-99m (Tc-99m) which is used for (Mo-99) imaging the brain, liver, lungs, heart, and other organs. Currently, Tc-99m is the most widely used radioisotope used for diagnostic imaging of various cancers and diseases involving the brain, heart, liver, lungs; also used in detection of deep vein thrombosis of the legs Osmium-194 Cancer radioimmunotherapy (Os-194) Palladium-103 Prostate cancer treatment (Pd-103) Platinum-195m Studies on biodistribution and metabolism of (Pt-195m) cisplatin, a chemotherapeutic drug Phosphorus-32 Polycythemia rubra vera (blood cell disease) and (P-32) leukemia treatment, bone cancer diagnosis/treatment; colon, pancreatic, and liver cancer treatment; radiolabeling nucleic acids for in vitro research, diagnosis of superficial tumors, treatment of blocked arteries (i.e., arteriosclerosis and restenosis), and intracavity therapy Phosphorus-33 Leukemia treatment, bone disease diagnosis/ (P-33) treatment, radiolabeling, and treatment of blocked arteries (i.e., arteriosclerosis and restenosis) Radium-223 See Actinium-227 (Ac-227) (Ra-223) Rhenium-186 Bone cancer pain relief, rheumatoid arthritis treatment, (Re-186) and diagnosis and treatment of lymphoma and bone, breast, colon, and liver cancers using radioimmunotherapy Rhenium-188 Cancer diagnosis and treatment using radio- (Re-188) immunotherapy, bone cancer pain relief, treatment of rheumatoid arthritis, and treatment of prostate cancer Rhodium-105 Cancer radioimmunotherapy (Rh-105) Samarium-145 Ocular cancer treatment (Sm-145) Samarium-153 Cancer radioimmunotherapy and bone (Sm-153) cancer pain relief Scandium-47 Cancer radioimmunotherapy and bone (Sc-47) cancer pain relief Selenium-75 Radiotracer used in brain studies, imaging of adrenal (Se-75) cortex by gamma-scintigraphy, lateral locations of steroid secreting tumors, pancreatic scanning, detection of hyperactive parathyroid glands, measure rate of bile acid loss from the endogenous pool Strontium-85 Bone cancer detection and brain scans (Sr-85) Strontium-89 Bone cancer pain relief, multiple myeloma (Sr-89) treatment, and osteoblastic therapy Technetium-99m See Molybdenum-99 (Mo-99) (Tc-99m) Thorium-228 Parent of Bismuth-212 (Bi-212) which is an alpha (Th-228) emitter used in cancer radioimmunotherapy Thorium-229 Parent of Actinium-225 (Ac-225) and grandparent (Th-229) of Bismuth-213 (Bi-213) which are alpha emitters used in cancer radioimmunotherapy Thulium-170 Gamma source for blood irradiators, energy (Tm-170) source for implanted medical devices Tin-117m Cancer immunotherapy and bone cancer pain relief (Sn-117m) Tungsten-188 Parent for Rhenium-188 (Re-188) which is used for (W-188) cancer diagnostics/treatment, bone cancer pain relief, rheumatoid arthritis treatment, and treatment of blocked arteries (i.e., arteriosclerosis and restenosis) Xenon-127 Neuroimaging of brain disorders, high resolution (Xe-127) SPECT studies, pulmonary function tests, and cerebral blood flow studies Ytterbium-175 Cancer radioimmunotherapy (Yb-175) Yttrium-90 Microseeds obtained from irradiating (Y-90) Yttrium-89 (Y-89) for liver cancer treatment Yttrium-91 A gamma-emitting label for Yttrium-90 (Y-90) which (Y-91) is used for cancer radioimmunotherapy (i.e., cancers) breast, colon, kidney, lung, ovarian, prostate, pancreatic, and inoperable liver cancers)

[0158] By “randomized” or grammatical equivalents as herein applied to nucleic acids and proteins is meant that each nucleic acid and peptide consists of essentially random nucleotides and amino acids, respectively. These random peptides (or nucleic acids, discussed herein) can incorporate any nucleotide or amino acid at any position. The synthetic process can be designed to generate randomized proteins or nucleic acids, to allow the formation of all or most of the possible combinations over the length of the sequence, thus forming a library of randomized candidate bioactive proteinaceous agents.

[0159] In one embodiment, a library is “fully randomized,” with no sequence preferences or constants at any position. In another embodiment, the library is a “biased random” library. That is, some positions within the sequence either are held constant, or are selected from a limited number of possibilities. For example, the nucleotides or amino acid residues are randomized within a defined class, e.g., of hydrophobic amino acids, hydrophilic residues, sterically biased (either small or large) residues, towards the creation of nucleic acid binding domains, the creation of cysteines, for cross-linking, prolines for SH-3 domains, serines, threonines, tyrosines or histidines for phosphorylation sites, etc., or to purines, etc.

[0160] A “recombinant” DNA or RNA molecule is a DNA or RNA molecule that has been subjected to molecular manipulation in vitro.

[0161] Non-limiting examples of small molecules include compounds that bind or interact with 191P4D12(b), ligands including hormones, neuropeptides, chemokines, odorants, phospholipids, and functional equivalents thereof that bind and preferably inhibit 191P4D12(b) protein function. Such non-limiting small molecules preferably have a molecular weight of less than about 10 kDa, more preferably below about 9, about 8, about 7, about 6, about 5 or about 4 kDa. In certain embodiments, small molecules physically associate with, or bind, 191P4D12(b) protein; are not found in naturally occurring metabolic pathways; and/or are more soluble in aqueous than non-aqueous solutions

[0162] “Stringency” of hybridization reactions is readily determinable by one of ordinary skill in the art, and generally is an empirical calculation dependent upon probe length, washing temperature, and salt concentration. In general, longer probes require higher temperatures for proper annealing, while shorter probes need lower temperatures. Hybridization generally depends on the ability of denatured nucleic acid sequences to reanneal when complementary strands are present in an environment below their melting temperature. The higher the degree of desired homology between the probe and hybridizable sequence, the higher the relative temperature that can be used. As a result, it follows that higher relative temperatures would tend to make the reaction conditions more stringent, while lower temperatures less so. For additional details and explanation of stringency of hybridization reactions, see Ausubel et al., Current Protocols in Molecular Biology, Wiley Interscience Publishers, (1995).

[0163] “Stringent conditions” or “high stringency conditions”, as defined herein, are identified by, but not limited to, those that: (1) employ low ionic strength and high temperature for washing, for example 0.015 M sodium chloride/0.0015 M sodium citrate/0.1% sodium dodecyl sulfate at 50° C.; (2) employ during hybridization a denaturing agent, such as formamide, for example, 50% (v/v) formamide with 0.1% bovine serum albumin/0.1% Ficoll/0.1% polyvinylpyrrolidone/50 mM sodium phosphate buffer at pH 6.5 with 750 mM sodium chloride, 75 mM sodium citrate at 42° C.; or (3) employ 50% formamide, 5×SSC (0.75 M NaCl, 0.075 M sodium citrate), 50 mM sodium phosphate (pH 6.8), 0.1% sodium pyrophosphate, 5× Denhardt's solution, sonicated salmon sperm DNA (50 &mgr;g/ml), 0.1% SDS, and 10% dextran sulfate at 42° C., with washes at 42° C. in 0.2×SSC (sodium chloride/sodium. citrate) and 50% formamide at 55° C., followed by a high-stringency wash consisting of 0.1×SSC containing EDTA at 55° C. “Moderately stringent conditions” are described by, but not limited to, those in Sambrook et al., Molecular Cloning: A Laboratory Manual, New York: Cold Spring Harbor Press, 1989, and include the use of washing solution and hybridization conditions (e.g., temperature, ionic strength and %SDS) less stringent than those described above. An example of moderately stringent conditions is overnight incubation at 37° C. in a solution comprising: 20% formamide, 5×SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5× Denhardt's solution, 10% dextran sulfate, and 20 mg/mL denatured sheared salmon sperm DNA, followed by washing the filters in 1×SSC at about 37-50° C. The skilled artisan will recognize how to adjust the temperature, ionic strength, etc. as necessary to accommodate factors such as probe length and the like.

[0164] An HLA “supermotif” is a peptide binding specificity shared by HLA molecules encoded by two or more HLA alleles. Overall phenotypic frequencies of HLA-supertypes in different ethnic populations are set forth in Table IV (F). The non-limiting constituents of various supetypes are as follows.

[0165] A2: A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*6802, A*6901, A*0207

[0166] A3: A3, A11, A31, A*3301, A*6801, A*0301, A*1101, A*3101

[0167] B7: B7, B*3501-03, B*51, B*5301, B*5401, B*5501, B*5502, B*5601, B*6701, B*7801, B*0702, B*5101, B*5602

[0168] B44: B*3701, B*4402, B*4403, B*60 (B*4001), B61 (B*4006)

[0169] A1: A*0102, A*2604, A*3601, A*4301, A*8001

[0170] A24: A*24, A*30, A*2403, A*2404, A*3002, A*3003

[0171] B27: B*1401-02, B*1503, B*1509, B*1510, B*1518, B*3801-02, B*3901, B*3902, B*3903-04, B*4801-02, B*7301, B*2701 -08

[0172] B58: B*1516, B*1517, B*5701, B*5702, B58

[0173] B62: B*4601, B52, B*1501 (B62), B*1502 (B75), B*1513 (B77)

[0174] Calculated population coverage afforded by different HLA-supertype combinations are set forth in Table IV (G).

[0175] As used herein “to treat” or “therapeutic” and grammatically related terms, refer to any improvement of any consequence of disease, such as prolonged survival, less morbidity, and/or a lessening of side effects which are the byproducts of an alternative therapeutic modality; full eradication of disease is not required.

[0176] A “transgenic animal” (e.g., a mouse or rat) is an animal having cells that contain a transgene, which transgene was introduced into the animal or an ancestor of the animal at a prenatal, e.g., an embryonic stage. A “transgene” is a DNA that is integrated into the genome of a cell from which a transgenic animal develops.

[0177] As used herein, an HLA or cellular immune response “vaccine” is a composition that contains or encodes one or more peptides of the invention. There are numerous embodiments of such vaccines, such as a cocktail of one or more individual peptides; one or more peptides of the invention comprised by a polyepitopic peptide; or nucleic acids that encode such individual peptides or polypeptides, e.g., a minigene that encodes a polyepitopic peptide. The “one or more peptides” can include any whole unit integer from 1-150 or more, e.g., at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, or 150 or more peptides of the invention. The peptides or polypeptides can optionally be modified, such as by lipidation, addition of targeting or other sequences. HLA class I peptides of the invention can be admixed with, or linked to, HLA class II peptides, to facilitate activation of both cytotoxic T lymphocytes and helper T lymphocytes. HLA vaccines can also comprise peptide-pulsed antigen presenting cells, e.g., dendritic cells.

[0178] The term “variant” refers to a molecule that exhibits a variation from a described type or norm, such as a protein that has one or more different amino acid residues in the corresponding position(s) of a specifically described protein (e.g. the 191P4D12(b) protein shown in FIG. 2 or FIG. 3. An analog is an example of a variant protein. Splice isoforms and single nucleotides polymorphisms (SNPs) are further examples of variants.

[0179] The “191P4D12(b)-related proteins” of the invention include those specifically identified herein, as well as allelic variants, conservative substitution variants, analogs and homologs that can be isolated/generated and characterized without undue experimentation following the methods outlined herein or readily available in the art. Fusion proteins that combine parts of different 191P4D12(b) proteins or fragments thereof, as well as fusion proteins of a 191P4D12(b) protein and a heterologous polypeptide are also included. Such 191P4D12(b) proteins are collecfively referred to as the 191P4D12(b)-related proteins, the proteins of the invention, or 191P4D12(b). The term “191P4D12(b)-related protein” refers to a polypeptide fragment or a 191P4D12(b) protein sequence of 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, or more than 25 amino acids; or, at least 30, 35, 40, 45, 50, 55, 60, 65, 70, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 525, 550, 575, or 576 or more amino acids.

[0180] II.) 191P4D12(b) Polynucleotides

[0181] One aspect of the invention provides polynucleotides corresponding or complementary to all or part of a 191P4D12(b) gene, mRNA, and/or coding sequence, preferably in isolated form, including polynucleotides encoding a 191P4D12(b)-related protein and fragments thereof, DNA, RNA, DNA/RNA hybrid, and related molecules, polynucleotides or oligonucleotides complementary to a 191P4D12(b) gene or mRNA sequence or a part thereof, and polynucleotides or oligonucleotides that hybridize to a 191P4D12(b) gene, mRNA, or to a 191P4D12(b) encoding polynucleotide (collectively, “191P4D12(b) polynucleotides”). In all instances when referred to in this section, T can also be U in FIG. 2.

[0182] Embodiments of a 191P4D12(b) polynucleotide include: a 191P4D12(b) polynucleotide having the sequence shown in FIG. 2, the nucleotide sequence of 191P4D12(b) as shown in FIG. 2 wherein T is U; at least 10 contiguous nucleotides of a polynucleotide having the sequence as shown in FIG. 2; or, at least 10 contiguous nucleotides of a polynucleotide having the sequence as shown in FIG. 2 where T is U. For example, embodiments of 191P4D12(b) nucleotides comprise, without limitation:

[0183] (I) a polynucleotide comprising, consisting essentially of, or consisting of a sequence as shown in FIG. 2, wherein T can also be U;

[0184] (II) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2A, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;

[0185] (III) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2B, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;

[0186] (IV) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2C, from nucleotide residue number 264 through nucleotide residue number 1796, including the a stop codon, wherein T can also be U;

[0187] (V) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2D, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;.

[0188] (VI) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2E, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;,

[0189] (VII) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2F, from nucleotide residue number 789 through nucleotide residue number 1676, including the stop codon, wherein T can also be U;

[0190] (VIII) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2G, from nucleotide residue number 264 through nucleotide residue number 1721, including the stop codon, wherein T can also be U;

[0191] (IX) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2H, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;

[0192] (X) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2I, from nucleotide residue number 708 through nucleotide residue number 1121, including the stop codon, wherein T can also be U;

[0193] (XI) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2J, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;

[0194] (XII) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2K, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;

[0195] (XIII) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2L, from nucleotide residue number 264 through nucleotide residue number 1796, including the stop codon, wherein T can also be U;

[0196] (XIV) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2M, from nucleotide residue number 264 through nucleotide residue number 1799, including the stop codon, wherein T can also be U;

[0197] (XV) a polynucleotide comprising, consisting essentially of, or consisting of the sequence as shown in FIG. 2N, from nucleotide residue number 708 through nucleotide residue number 1121, including the stop codon, wherein T can also be U;

[0198] (XVI) a polynucleotide that encodes a 191P4D12(b)-related protein that is at least 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% homologous to an entire amino acid sequence shown in FIGS. 2A-N;

[0199] (XVII) a polynucleotide that encodes a 191P4D12(b)-related protein that is at least 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identical to an entire amino acid sequence shown in FIGS. 2A-N;

[0200] (XVIII) a polynucleotide that encodes at least one peptide set forth in Tables VIII-XXI and XXII-XLIX;

[0201] (XIX) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3A-B and 3E-G in any whole number increment up to 510 that includes at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0202] (XX) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3A-B and 3E-G in any whole number increment up to 510 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0203] (XXI) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3A-B and 3E-G in any whole number increment up to 510 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0204] (XXII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3A-B and 3E-G in any whole number increment up to 510 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0205] (XXIII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3A-B and 3E-G in any whole number increment up to 510 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9;

[0206] (XXIV) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3C in any whole number increment up to 295 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0207] (XXV) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3C in any whole number increment up to 295 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0208] (XXVI) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3C in any whole number increment up to 295 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0209] (XXVII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3C in any whole number increment up to 295 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0210] (XXVIII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3C in any whole number increment up to 295 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9

[0211] (XXIX) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3D in any whole number increment up to 485 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0212] (XXX) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3D in any whole number increment up to 485 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0213] (XXXI) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3D in any whole number increment up to 485 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0214] (XXXII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3D in any whole number increment up to 485 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0215] (XXXIII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3D in any whole number incrementup to 485 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9

[0216] (XXXIV) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3H in any whole number increment up to 511 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0217] (XXXV) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3H in any whole number increment up to 511 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0218] (XXXVI) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3H in any whole number increment up to 511 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0219] (XXXVII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3H in any whole number increment up to 511 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0220] (XXXVIII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIG. 3H in any whole number increment up to 511 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9

[0221] (XXXIX) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3I-J in any whole number increment up to 137 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0222] (XL) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3I-J in any whole number increment up to 137 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0223] (XLI) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3I-J in any whole number increment up to 137 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0224] (XLII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3I-J in any whole number increment up to 137 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0225] (XLIII) a polynucleotide that encodes a peptide region of at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a peptide of FIGS. 3I-J in any whole number increment up to 137 that includes 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9

[0226] (XLIV) a polynucleotide that is fully complementary to a polynucleotide of any one of (I)-(XLIII).

[0227] (XLV) a peptide that is encoded by any of (I) to (XLIV); and

[0228] (XLVI) a composition comprising a polynucleotide of any of (I)-(XLIII) or peptide of (XLV) together with a pharmaceutical excipient and/or in a human unit dose form.

[0229] (XLVII) a method of using a polynucleotide of any (I)-(XLIV) or peptide of (XLV) or a composition of (XLVI) in a method to modulate a cell expressing 191P4D12(b),

[0230] (XLVIII) a method of using a polynucleotide of any (I)-(XLIV) or peptide of (XLV) or a composition of (XLVI) in a method to diagnose, prophylax, prognose, or treat an individual who bears a cell expressing 191P4D12(b)

[0231] (XLIX) a method of using a polynucleotide of any (I)-(XLIV) or peptide of (XLV) or a composition of (XLVI) in a method to diagnose, prophylax, prognose, or treat an individual who bears a cell expressing 191P4D12(b), said cell from a cancer of a tissue listed in Table I;

[0232] (L) a method of using a polynucleotide of any (I)-(XLIV) or peptide of (XLV) or a composition of (XLVI) in a method to diagnose, prophylax, prognoses or treat a a cancer,

[0233] (LI) a method of using a polynucleotide of any (I)-(XLIV) or peptide of (XLV) or a composition of (XLVI) in a method to diagnose, prophylax, prognose, or treat a a cancer of a tissue listed in Table I; and,

[0234] (LII) a method of using a polynucleotide of any (I)-(XLIV) or peptide of (XLV) or a composition of (XLVI) in a method to identify or characterize a modulator of a cell expressing 191P4D12(b).

[0235] As used herein, a range is understood to disclose specifically all whole unit positions thereof.

[0236] Typical embodiments of the invention disclosed herein include 191P4D12(b) polynucleotides that encode specific portions of 191P4D12(b) mRNA sequences (and those which are complementary to such sequences) such as those that encode the proteins and/or fragments thereof, for example:

[0237] (a) 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 505 or 510 more contiguous amino acids of 191P4D12(b) variant 1; the maximal lengths relevant for other variants are: variant 2, 510 amino acids; variant 6, 295 amino acids, variant 7, 485 amino acids, variant 10, 510 amino acids, variant 11, 510 amoni acids, variant 12, 510 amoni acids, variant 13, 511 amino acids, variant 9, 137 amino acids, and variant 14, 137 amino acids.

[0238] For example, representative embodiments of the invention disclosed herein include: polynucleotides and their encoded peptides themselves encoding about amino acid 1 to about amino acid 10 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 10 to about amino acid 20 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 20 to about amino acid 30 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 30 to about amino acid 40 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 40 to about amino acid 50 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 50 to about amino acid 60 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 60 to about amino acid 70 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 70 to about amino acid 80 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 80 to about amino acid 90 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polynucleotides encoding about amino acid 90 to about amino acid 100 of the 191P4D12(b) protein shown in FIG. 2 or FIG. 3, in increments of about 10 amino acids, ending at the carboxyl terminal amino acid set forth in FIG. 2 or FIG. 3. Accordingly, polynucleotides encoding portions of the amino acid sequence (of about 10 amino acids), of amino acids, 100 through the carboxyl terminal amino acid of the 191P4D12(b) protein are embodiments of the invention. Wherein it is understood that each particular amino acid position discloses that position plus or minus five amino acid residues.

[0239] Polynucleotides encoding relatively long portions of a 191P4D12(b) protein are also within the scope of the invention. For example, polynucleotides encoding from about amino acid 1 (or 20 or 30 or 40 etc.) to about amino acid 20, (or 30, or 40 or 50 etc.) of the 191P4D12(b) protein “or variant” shown in FIG. 2 or FIG. 3 can be generated by a variety of techniques well known in the art. These polynucleotide fragments can include any portion of the 191P4D12(b) sequence as shown in FIG. 2.

[0240] Additional illustrative embodiments of the invention disclosed herein include 191P4D12(b) polynucleotide fragments encoding one or more of the biological motifs contained within a 191P4D12(b) protein “or variant” sequence, including one or more of the motif-bearing subsequences of a 191P4D12(b) protein “or variant” set forth in Tables VIII-XXI and XXII-XLIX. In another embodiment, typical polynucleotide fragments of the invention encode one or more of the regions of 191P4D12(b) protein or variant that exhibit homology to a known molecule. In another embodiment of the invention, typical polynucleotide fragments can encode one or more of the 191P4D12(b) protein or variant N-glycosylation sites, cAMP and cGMP-dependent protein kinase phosphorylation sites, casein kinase II phosphorylation sites or N-myristoylation site and amidation sites.

[0241] Note that to determine the starting position of any peptide set forth in Tables VIII-XXI and Tables XXII to XLIX (collectively HLA Peptide Tables) respective to its parental protein, e.g., variant 1, variant 2, etc., reference is made to three factors: the particular variant, the length of the peptide in an HLA Peptide Table, and the Search Peptides listed in Table VII. Generally, a unique Search Peptide is used to obtain HLA peptides for a particular variant. The position of each Search Peptide relative to its respective parent molecule is listed in Table VII. Accordingly, if a Search Peptide begins at position “X”, one must add the value “X minus 1” to each position in Tables VIII-XXI and Tables XXII-IL to obtain the actual position of the HLA peptides in their parental molecule. For example if a particular Search Peptide begins at position 150 of its parental molecule, one must add 150−1, i.e., 149 to each HLA peptide amino acid position to calculate the position of that amino acid in the parent molecule.

[0242] II.A.) Uses of 191P4D12(b) Polynucleotides

[0243] II.A.1.) Monitoring of Genetic Abnormalities

[0244] The polynucleotides of the preceding paragraphs have a number of different specific uses. The human 191P4D12(b) gene maps to the chromosomal location set forth in the Example entitled “Chromosomal Mapping of 191P4D12(b).” For example, because the 191P4D12(b) gene maps to this chromosome, polynucleotides that encode different regions of the 191P4D12(b) proteins are used to characterize cytogenetic abnormalities of this chromosomal locale, such as abnormalities that are identified as being associated with various cancers. In certain genes, a variety of chromosomal abnormalities including rearrangements have been identified as frequent cytogenetic abnormalities in a number of different cancers (see e.g. Krajinovic et al., Mutat. Res. 382(3-4): 81-83 (1998); Johansson et al., Blood 86(10): 3905-3914 (1995) and Finger et al., P.N.A.S. 85(23): 9158-9162 (1988)). Thus, polynucleotides encoding specific regions of the 191P4D12(b) proteins provide new tools that can be used to delineate, with greater precision than previously possible, cytogenetic abnormalities in the chromosomal region that encodes 191P4D12(b) that may contribute to the malignant phenotype. In this context, these polynucleotides satisfy a need in the art for expanding the sensitivity of chromosomal screening in order to identify more subtle and less common chromosomal abnormalities (see e.g. Evans et al., Am. J. Obstet. Gynecol 171(4): 1055-1057 (1994)).

[0245] Furthermore, as 191P4D12(b) was shown to be highly expressed in prostate and other cancers, 191P4D12(b) polynucleotides are used in methods assessing the status of 191P4D12(b) gene products in normal versus cancerous tissues. Typically, polynucleotides that encode specific regions of the 191P4D12(b) proteins are used to assess the presence of perturbations (such as deletions, insertions, point mutations, or alterations resulting in a loss of an antigen etc.) in specific regions of the 191P4D12(b) gene, such as regions containing one or more motifs. Exemplary assays include both RT-PCR assays as well as single-strand conformation polymorphism (SSCP) analysis (see, e.g., Marrogi et al., J. Cutan. Pathol. 26(8): 369-378 (1999), both of which utilize polynucleotides encoding specific regions of a protein to examine these regions within the protein.

[0246] II.A.2.) Antisense Embodiments

[0247] Other specifically contemplated nucleic acid related embodiments of the invention disclosed herein are genomic DNA, cDNAs, ribozymes, and antisense molecules, as well as nucleic acid molecules based on an alternative backbone, or including alternative bases, whether derived from natural sources or synthesized, and include molecules capable of inhibiting the RNA or protein expression of 191P4D12(b). For example, antisense molecules can be RNAs or other molecules, including peptide nucleic acids (PNAs) or non-nucleic acid molecules such as phosphorothioate derivatives that specifically bind DNA or RNA in a base pair-dependent manner. A skilled artisan can readily obtain these classes of nucleic acid molecules using the 191P4D12(b) polynucleotides and polynucleotide sequences disclosed herein.

[0248] Antisense technology entails the administration of exogenous oligonucleotides that bind to a target polynucleotide located within the cells. The term “antisense” refers to the fact that such oligonucleotides are complementary to their intracellular targets, e.g., 191P4D12(b). See for example, Jack Cohen, Oligodeoxynucleotides, Antisense Inhibitors of Gene Expression, CRC Press, 1989; and Synthesis 1:1-5 (1988). The 191P4D12(b) antisense oligonucleotides of the present invention include derivatives such as S-oligonucleotides (phosphorothioate derivatives or S-oligos, see, Jack Cohen, supra), which exhibit enhanced cancer cell growth inhibitory action. S-oligos (nucleoside phosphorothioates) are isoelectronic analogs of an oligonucleotide (O-oligo) in which a non bridging oxygen atom of the phosphate group is replaced by a sulfur atom. The S-oligos of the present invention can be prepared by treatment of the corresponding O-oligos with 3H-1,2-benzodithiol-3-one-1,1-dioxide, which is a sulfur transfer reagent. See, e.g., Iyer, R. P. et al., J. Org. Chem. 55:4693-4698 (1990); and Iyer, R. P. et al., J. Am. Chem. Soc. 112:1253-1254 (1990). Additional 191P4D12(b) antisense oligonucleotides of the present invention include morpholino antisense oligonucleotides known in the art (see; e.g., Partridge et al., 1996, Antisense & Nucleic Acid Drug Development 6: 169-175).

[0249] The 191P4D12(b) antisense oligonucleotides of the present invention typically can be RNA or DNA that is complementary to and stably hybridizes with the first 100 5′ codons or last 100 3′ codons of a 191P4D12(b) genomic sequence or the corresponding mRNA. Absolute complementarity is not required, although high degrees of complementarity are preferred. Use of an oligonucleotide complementary to this region allows for the selective hybridization to 191P4D12(b) mRNA and not to mRNA specifying other regulatory subunits of protein kinase. In one embodiment, 191P4D12(b) antisense oligonucleotides of the present invention are 15 to 30-mer fragments of the antisense DNA molecule that have a sequence that hybridizes to 191P4D12(b) mRNA. Optionally, 191P4D12(b) antisense oligonucleotide is a 30-mer oligonucleotide that is complementary to a region in the first 10 5′ codons or last 10 3′ codons of 191P4D12(b). Alternatively, the antisense molecules are modified to employ ribozymes in the inhibition of 191P4D12(b) expression, see, e.g., L. A. Couture & D. T. Stinchcomb; Trends Genet 12: 510-515 (1996).

[0250] II.A.3.) Primers and Primer Pairs

[0251] Further specific embodiments of these nucleotides of the invention include primers and primer pairs, which allow the specific amplification of polynucleotides of the invention or of any specific parts thereof, and probes that selectively or specifically hybridize to nucleic acid molecules of the invention or to any part thereof. Probes can be labeled with a detectable marker, such as, for example, a radioisotope, fluorescent compound, bioluminescent compound, a chemiluminescent compound, metal chelator or enzyme. Such probes and primers are used to detect the presence of a 191P4D12(b) polynucleotide in a sample and as a means for detecting a cell expressing a 191P4D12(b) protein.

[0252] Examples of such probes include polypeptides comprising all or part of the human 191P4D12(b) cDNA sequence shown in FIG. 2. Examples of pnmer pairs capable of specifically amplifying 191P4D12(b) mRNAs are also described in the Examples. As will be understood by the skilled artisan, a great many different primers and probes can be prepared based on the sequences provided herein and used effectively to amplify and/or detect a 191P4D12(b) mRNA.

[0253] The 191P4D12(b) polynucleotides of the invention are useful for a variety of purposes, including but not limited to their use as probes and primers for the amplification and/or detection of the 191P4D12(b) gene(s), mRNA(s), or fragments thereof; as reagents for the diagnosis and/or prognosis of prostate cancer and other cancers; as coding sequences capable of directing the expression of 191P4D12(b) polypeptides; as tools for modulating or inhibiting the expression of the 191P4D12(b) gene(s) and/or translation of the 191P4D12(b) transcript(s); and as therapeutic agents.

[0254] The present invention includes the use of any probe as described herein to identify and isolate a 191P4D12(b) or 191P4D12(b) related nucleic acid sequence from a naturally occurring source, such as humans or other mammals, as well as the isolated nucleic acid sequence per se, which would comprise all or most of the sequences found in the probe used.

[0255] II.A.4.) Isolation of 191P4D12(b)-Encoding Nucleic Acid Molecules

[0256] The 191P4D12(b) cDNA sequences described herein enable the isolation of other polynucleotides encoding 191P4D12(b) gene product(s), as well as the isolation of polynucleotides encoding 191P4D12(b) gene product homologs, alternatively spliced isoforms, allelic variants, and mutant forms of a 191P4D12(b) gene product as well as polynucleotides that encode analogs of 191P4D12(b)-related proteins. Various molecular cloning methods that can be employed to isolate full length cDNAs encoding a 191P4D12(b) gene are well known (see, for example, Sambrook, J. et al., Molecular Cloning: A Laboratory Manual, 2d edition, Cold Spring Harbor Press, New York, 1989; Current Protocols in Molecular Biology. Ausubel et al., Eds., Wiley and Sons, 1995). For example, lambda phage cloning methodologies can be conveniently employed, using commercially available cloning systems (e.g., Lambda ZAP Express, Stratagene). Phage clones containing 191P4D12(b) gene cDNAs can be identified by probing with a labeled 191P4D12(b) cDNA or a fragment thereof. For example, in one embodiment, a 191P4D12(b) cDNA (e.g., FIG. 2) or a portion thereof can be synthesized and used as a probe to retrieve overlapping and full-length cDNAs corresponding to a 191P4D12(b) gene. A 191P4D12(b) gene itself can be isolated by screening genomic DNA libraries, bacterial artificial chromosome libraries (BACs), yeast artificial chromosome libraries (YACs), and the like, with 191P4D12(b) DNA probes or primers.

[0257] II.A.5.) Recombinant Nucleic Acid Molecules and Host-Vector Systems

[0258] The invention also provides recombinant DNA or RNA molecules containing a 191P4D12(b) polynucleotide, a fragment, analog or homologue thereof, including but not limited to phages, plasmids, phagemids, cosmids, YACs, BACs, as well as various viral and non-viral vectors well known in the art, and cells transformed or transfected with such recombinant DNA or RNA molecules. Methods for generating such molecules are well known (see, for example, Sambrook et al., 1989, supra).

[0259] The invention further provides a host-vector system comprising a recombinant DNA molecule containing a 191P4D12(b) polynucleotide, fragment, analog or homologue thereof within a suitable prokaryotic or eukaryotic host cell. Examples of suitable eukaryotic host cells include a yeast cell, a plant cell, or an animal cell, such as a mammalian cell or an insect cell (e.g., a baculovirus-infectible cell such as an Sf9 or HighFive cell). Examples of suitable mammalian cells include various prostate cancer cell lines such as DU145 and TsuPr1, other transfectable or transducible prostate cancer cell lines, primary cells (PrEC), as well as a number of mammalian cells routinely used for the expression of recombinant proteins (e.g., COS, CHO, 293, 293T cells). More particularly, a polynucleotide comprising the coding sequence of 191P4D12(b) or a fragment, analog or homolog thereof can be used to generate 191P4D12(b) proteins or fragments thereof using any number of host-vector systems routinely used and widely known in the art.

[0260] A wide range of host-vector systems suitable for the expression of 191P4D12(b) proteins or fragments thereof are available, see for example, Sambrook et al., 1989, supra; Current Protocols in Molecular Biology, 1995, supra). Preferred vectors for mammalian expression include but are not limited to pcDNA 3.1 myc-Histag (Invitrogen) and the retroviral vector pSR&agr;tkneo (Muller et al., 1991, MCB 11:1785). Using these expression vectors, 191P4D12(b) can be expressed in several prostate cancer and non-prostate cell lines, including for example 293, 293T, rat-1, NIH 3T3 and TsuPr1. The host-vector systems of the invention are useful for the production of a 191P4D12(b) protein or fragment thereof. Such host-vector systems can be employed to study the functional properties of 191P4D12(b) and 191P4D12(b) mutations or analogs.

[0261] Recombinant human 191P4D12(b) protein or an analog or homolog or fragment thereof can be produced by mammalian cells transfected with a construct encoding a 191P4D12(b)-related nucleotide. For example, 293T cells can be transfected with an expression plasmid encoding 191P4D12(b) or fragment, analog or homolog thereof, a 191P4D12(b)-related protein is expressed in the 293T cells, and the recombinant 191P4D12(b) protein is isolated using standard purification methods (e.g., affinity purification using anti-191P4D12(b) antibodies). In another embodiment, a 191P4D12(b) coding sequence is subcloned into the retroviral vector pSR&agr;MSVtkneo and used to infect various mammalian cell lines, such as NIH 3T3, TsuPr1, 293 and rat-1 in order to establish 191P4D12(b) expressing cell lines. Various other expression systems well known in the art can also be employed. Expression constructs encoding a leader peptide joined in frame to a 191P4D12(b) coding sequence can be used for the generation of a secreted form of recombinant 191P4D12(b) protein.

[0262] As discussed herein, redundancy in the genetic code permits variation in 191P4D12(b) gene sequences. In particular, it is known in the art that specific host species often have specific codon preferences, and thus one can adapt the disclosed sequence as preferred for a desired host. For example, preferred analog codon sequences typically have rare codons (i.e., codons having a usage frequency of less than about 20% in known sequences of the desired host) replaced with higher frequency codons. Codon preferences for a specific species are calculated, for example, by utilizing codon usage tables available on the INTERNET such as at URL dna.affrc.go.jp/˜nakamura/codon.html.

[0263] Additional sequence modifications are known to enhance protein expression in a cellular host. These include elimination of sequences encoding spurious polyadenylation signals, exon/intron splice site signals, transposon-like repeats, and/or other such well-characterized sequences that are deleterious to gene expression. The GC content of the sequence is adjusted to levels average for a given cellular host, as calculated by reference to known genes expressed in the host cell. Where possible, the sequence is modified to avoid predicted hairpin secondary mRNA structures. Other useful modifications include the addition of a translational initiation consensus sequence at the start of the open reading frame, as described in Kozak, Mol. Cell Biol., 9:5073-5080 (1989). Skilled artisans understand that the general rule that eukaryotic ribosomes initiate translation exclusively at the 5′ proximal AUG codon is abrogated only under rare conditions (see, e.g., Kozak PNAS 92(7): 2662-2666, (1995) and Kozak NAR 15(20): 8125-8148 (1987)).

[0264] III.) 191P4D12(b)-related Proteins

[0265] Another aspect of the present invention provides 191P4D12(b)-related proteins. Specific embodiments of 191P4D12(b) proteins comprise a polypeptide having all or part of the amino acid sequence of human 191P4D12(b) as shown in FIG. 2 or FIG. 3. Alternatively, embodiments of 191P4D12(b) proteins comprise variant, homolog or analog polypeptides that have alterations in the amino acid sequence of 191P4D12(b) shown in FIG. 2 or FIG. 3.

[0266] Embodiments of a 191P4D12(b) polypeptide include: a 191P4D12(b) polypeptide having a sequence shown in FIG. 2, a peptide sequence of a 191P4D12(b) as shown in FIG. 2 wherein T is U; at least 10 contiguous nucleotides of a polypeptide having the sequence as shown in FIG. 2; or, at least 10 contiguous peptides of a polypeptide having the sequence as shown in FIG. 2 where T is U. For example, embodiments of 191P4D12(b) peptides comprise, without limitation:

[0267] (I) a protein comprising, consisting essentially of, or consisting of an amino acid sequence as shown in FIGS. 2A-N or FIGS. 3A-J;

[0268] (II) a 191P4D12(b)-related protein that is at least 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% homologous to an entire amino acid sequence shown in FIGS. 2A-N or 3A-J;

[0269] (III) a 191P4D12(b)-related protein that is at least 90, 91, 92, 93, 94, 95, 96, 97, 98, 99 or 100% identical to an entire amino acid sequence shown in FIGS. 2A-N or 3A-J;

[0270] (IV) a protein that comprises at least one peptide set forth in Tables VIII to XLIX, optionally with a proviso that it is not an entire protein of FIG. 2;

[0271] (V) a protein that comprises at least one peptide set forth in Tables VIII-XXI, collectively, which peptide is also set forth in Tables XXII to XLIX, collectively, optionally with a proviso that it is not an entire protein of FIG. 2;

[0272] (VI) a protein that comprises at least two peptides selected from the peptides set forth in Tables VIII-XLIX, optionally with a proviso that it is not an entire protein of FIG. 2;

[0273] (VIl) a protein that comprises at least two peptides selected from the peptides set forth in Tables VIII to XLIX collectively, with a proviso that the protein is not a contiguous sequence from an amino acid sequence of FIG. 2;

[0274] (VIII) a protein that comprises at least one peptide selected from the peptides set forth in Tables VIII-XXI; and at least one peptide selected from the peptides set forth in Tables XXII to XLIX, with a proviso that the protein is not a contiguous sequence from an amino acid sequence of FIG. 2;

[0275] (IX) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3A-B or 3E-G, in any whole number increment up to 510 respectively that includes at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0276] (X) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3A-B or 3E-G, in any whole number increment up to 510 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0277] (XI) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3A-B or 3E-G, in any whole number increment up to 510 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0278] (XII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3A-B or 3E-G, in any whole number increment up to 510 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0279] (XIII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, amino acids of a protein of FIGS. 3A-B or 3E-G in any whole number increment up to 510 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9;

[0280] (XIV) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3C, in any whole number increment up to 295 respectively that includes at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0281] (XV) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3C, in any whole number increment up to 295 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0282] (XVI) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3C, in any whole number increment up to 295 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0283] (XVII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3C, in any whole number increment up to 295 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0284] (XVIII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, amino acids of a protein of FIG. 3C in any whole number increment up to 295 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9;

[0285] (XIX) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3D, in any whole number increment up to 485 respectively that includes at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0286] (XX) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3D, in any whole number increment up to 485 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0287] (XXI) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3D, in any whole number increment up to 485 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0288] (XXII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3D, in any whole number increment up to 485 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0289] (XXIII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, amino acids of a protein of FIG. 3D in any whole number increment up to 485 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9;

[0290] (XXIV) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3H, in any whole number increment up to 511 respectively that includes at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0291] (XXV) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3H, in any whole number increment up to 511 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0292] (XXVI) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3H, in any whole number increment up to 511 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0293] (XXVII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIG. 3H, in any whole number increment up to 511 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0294] (XXVIII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, amino acids of a protein of FIG. 3H in any whole number increment up to 511 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9;

[0295] (XXIX) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3I-J, in any whole number increment up to 137 respectively that includes at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5;

[0296] (XXX) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3I-J, in any whole number increment up to 137 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value less than 0.5 in the Hydropathicity profile of FIG. 6;

[0297] (XXXI) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3I-J, in any whole number increment up to 137 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;

[0298] (XXXII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acids of a protein of FIGS. 3I-J, in any whole number increment up to 137 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;

[0299] (XXXIII) a polypeptide comprising at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, amino acids of a protein of FIGS. 3I-J in any whole number increment up to 137 respectively that includes at least at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35 amino acid position(s) having a value greater than 0.5 in the Beta-turn profile of FIG. 9;

[0300] (XXXIV) a peptide that occurs at least twice in Tables VIII-XXI and XXII to XLIX, collectively;

[0301] (XXXV) a peptide that occurs at least three times in Tables VIII-XXI and XXII to XLIX, collectively;

[0302] (XXXVI) a peptide that occurs at least four times in Tables VIII-XXI and XXII to XLIX, collectively;

[0303] (XXXVII) a peptide that occurs at least five times in Tables VIII-XXI and XXII to XLIX, collectively;

[0304] (XXXVIII) a peptide that occurs at least once in Tables VIII-XXI, and at least once in tables XXII to XLIX;

[0305] (XXXIX) a peptide that occurs at least once in Tables VIII-XXI, and at least twice in tables XXII to XLIX;

[0306] (XL) a peptide that occurs at least twice in Tables VIII-XXI, and at least once in tables XXII to XLIX;

[0307] (XLI) a peptide that occurs at least twice in Tables VIII-XXI, and at least twice in tables XXII to XLIX;

[0308] (XLII) a peptide which comprises one two, three, four, or five of the following characteristics, or an oligonucleotide encoding such peptide:

[0309] i) a region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Hydrophilicity profile of FIG. 5;

[0310] ii) a region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or less than 0.5, 0.4, 0.3, 0.2, 0.1, or having a value equal to 0.0, in the Hydropathicity profile of FIG. 6;

[0311] iii) a region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Percent Accessible Residues profile of FIG. 7;

[0312] iv) a region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Average Flexibility profile of FIG. 8; or,

[0313] v) a region of at least 5 amino acids of a particular peptide of FIG. 3, in any whole number increment up to the full length of that protein in FIG. 3, that includes an amino acid position having a value equal to or greater than 0.5, 0.6, 0.7, 0.8, 0.9, or having a value equal to 1.0, in the Beta-turn profile of FIG. 9;

[0314] (XLIII) a composition comprising a peptide of (I)-(XLII) or an antibody or binding region thereof together with a pharmaceutical excipient and/or in a human unit dose form.

[0315] (XLIV) a method of using a peptide of (I)-(XLII), or an antibody or binding region thereof or a composition of (XLIII) in a method to modulate a cell expressing 191P4D12(b),

[0316] (XLV) a method of using a peptide of (I)-(XLII) or an antibody or binding region thereof or a composition of (XLIII) in a method to diagnose, prophylax, prognose, or treat an individual who bears a cell expressing 191P4D12(b)

[0317] (XLVI) a method of using a peptide of (I)-(XLII) or an antibody or binding region thereof or a composition (XIIII) in a method to diagnose, prophylax, prognose, or treat an individual who bears a cell expressing 191P4D12(b), said cell from a cancer of a tissue listed in Table I;

[0318] (XLVII) a method of using a peptide of (I)-(XLII) or an antibody or binding region thereof or a composition of (XLIII) in a method to diagnose, prophylax, prognose, or treat a a cancer;

[0319] (XLVIII) a method of using a peptide of (I)-(XLII) or an antibody or binding region thereof or a composition of (XLIII) in a method to diagnose, prophylax, prognose, or treat a a cancer of a tissue listed in Table I; and,

[0320] (XLIX) a method of using a a peptide of (I)-(XLII) or an antibody or binding region thereof or a composition (XLIII) in a method to identify or characterize a modulator of a cell expressing 191P4D12(b).

[0321] As used herein, a range is understood to specifically disclose all whole unit positions thereof.

[0322] Typical embodiments of the invention disclosed herein include 191P4D12(b) polynucleotides that encode specific portions of 191P4D12(b) mRNA sequences (and those which are complementary to such sequences) such as those that encode the proteins and/or fragments thereof, for example:

[0323] (a) 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195, 200, 225, 250, 275, 300, 325, 350, 375, 400, 425, 450, 475, 500, 505, or 510 or more contiguous amino acids of 191P4D12(b) variant 1; the maximal lengths relevant for other variants are: variant 2, 510 amino acids; variant 6, 295 amino acids, variant 7, 485 amino acids, variant 10, 510 amino acids, variant 11, 510 amino acids, variant 12, 510 amino acids, variant 13, 511 amino acids, variant 9, 137 amino acids, and variant 14, 137 amino acids.

[0324] In general, naturally occurring allelic variants of human 191P4D12(b) share a high degree of structural identity and homology (e.g., 90% or more homology). Typically, allelic variants of a 191P4D12(b) protein contain conservative amino acid substitutions within the 191P4D12(b) sequences described herein or contain a substitution of an amino acid from a corresponding position in a homologue of 191P4D12(b). One class of 191P4D12(b) allelic variants are proteins that share a high degree of homology with at least a small region of a particular 191P4D12(b) amino acid sequence, but further contain a radical departure from the sequence, such as a non-conservative substitution, truncation, insertion or frame shift. In comparisons of protein sequences, the terms, similarity, identity, and homology each have a distinct meaning as appreciated in the field of genetics. Moreover, orthology and paralogy can be important concepts describing the relationship of members of a given protein family in one organism to the members of the same family in other organisms.

[0325] Amino acid abbreviations are provided in Table II. Conservative amino acid substitutions can frequently be made in a protein without altering either the conformation or the function of the protein. Proteins of the invention can comprise 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 conservative substitutions. Such changes include substituting any of isoleucine (I), valine (V), and leucine (L) for any other of these hydrophobic amino acids; aspartic acid (D) for glutamic acid (E) and vice versa; glutamine (Q) for asparagine (N) and vice versa; and serine (S) for threonine (T) and vice versa. Other substitutions can also be considered conservative, depending on the environment of the particular amino acid and its role in the three-dimensional structure of the protein. For example, glycine (G) and alanine (A) can frequently be interchangeable, as can alanine (A) and valine (V). Methionine (M), which is relatively hydrophobic, can frequently be interchanged with leucine and isoleucine, and sometimes with valine. Lysine (K) and arginine (R) are frequently interchangeable in locations in which the significant feature of the amino acid residue is its charge and the differing pK's of these two amino acid residues are not significant. Still other changes can be considered “conservative” in particular environments (see, e.g. Table III herein; pages 13-15 “Biochemistry” 2nd ED. Lubert Stryer ed (Stanford University); Henikoff et al., PNAS 1992 Vol 89 10915-10919; Lei et al., J Biol Chem 1995 May 19; 270(20):11882-6).

[0326] Embodiments of the invention disclosed herein include a wide variety of art-accepted variants or analogs of 191P4D12(b) proteins such as polypeptides having amino acid insertions, deletions and substitutions. 191P4D12(b) variants can be made using methods known in the art such as site-directed mutagenesis, alanine scanning, and PCR mutagenesis. Site-directed mutagenesis (Carter et al., Nucl. Acids Res., 13:4331 (1986); Zoller et al., Nucl. Acids Res., 10:6487 (1987)), cassette mutagenesis (Wells et al., Gene, 34:315 (1985)), restriction selection mutagenesis (Wells et al., Philos. Trans. R. Soc. London SerA, 317:415 (1986)) or other known techniques can be performed on the cloned DNA to produce the 191P4D12(b) variant DNA.

[0327] Scanning amino acid analysis can also be employed to identify one or more amino acids along a contiguous sequence that is involved in a specific biological activity such as a protein-protein interaction. Among the preferred scanning amino acids are relatively small, neutral amino acids. Such amino acids include alanine, glycine, serine, and cysteine. Alanine is typically a preferred scanning amino acid among this group because it eliminates the side-chain beyond the beta-carbon and is less likely to alter the main-chain conformation of the variant. Alanine is also typically preferred because it is the most common amino acid. Further, it is frequently found in both buried and exposed positions (Creighton, The Proteins, (W.H. Freeman & Co., N.Y.); Chothia, J. Mol. Biol., 150:1 (1976)). If alanine substitution does not yield adequate amounts of variant, an isosteric amino acid can be used.

[0328] As defined herein, 191P4D12(b) variants, analogs or homologs, have the distinguishing attribute of having at least one epitope that is “cross reactive” with a 191P4D12(b) protein having an amino acid sequence of FIG. 3. As used in this sentence, “cross reactive” means that an antibody or T cell that specifically binds to a 191P4D12(b) variant also specifically binds to a 191P4D12(b) protein having an amino acid sequence set forth in FIG. 3. A polypeptide ceases to be a variant of a protein shown in FIG. 3, when it no longer contains any epitope capable of being recognized by an antibody or T cell that specifically binds to the starting 191P4D12(b) protein. Those skilled in the art understand that antibodies that recognize proteins bind to epitopes of varying size, and a grouping of the order of about four or five amino acids, contiguous or not, is regarded as a typical number of amino acids in a minimal epitope. See, e.g., Nair et al., J. Immunol 2000 165(12): 6949-6955. Hebbes et al., Mol Immunol (1989) 26(9):865-73; Schwartz et al., J Immunol (1985) 135(4);2598-608.

[0329] Other classes of 191P4D12(b)-related protein variants share 70%, 75%, 80%, 85% or 90% or more similarity with an amino acid sequence of FIG. 3, or a fragment thereof. Another specific class of 191P4D12(b) protein variants or analogs comprises one or more of the 191P4D12(b) biological motifs described herein or presently known in the art. Thus, encompassed by the present invention are analogs of 191P4D12(b) fragments (nucleic or amino acid) that have altered functional (e.g. immunogenic) properties relative to the starting fragment. It is to be appreciated that motifs now or which become part of the art are to be applied to the nucleic or amino acid sequences of FIG. 2 or FIG. 3.

[0330] As discussed herein, embodiments of the claimed invention include polypeptides containing less than the full amino acid sequence of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3. For example, representative embodiments of the invention comprise peptides/proteins having any 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15 or more contiguous amino acids of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3.

[0331] Moreover, representative embodiments of the invention disclosed herein include polypeptides consisting of about amino acid 1 to about amino acid 10 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 10 to about amino acid 20 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 20 to about amino acid 30 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 30 to about amino acid 40 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 40 to about amino acid 50 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 50 to about amino acid 60 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 60 to about amino acid 70 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 70 to about amino acid 80 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 80 to about amino acid 90 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, polypeptides consisting of about amino acid 90 to about amino acid 100 of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3, etc. throughout the entirety of a 191P4D12(b) amino acid sequence. Moreover, polypeptides consisting of about amino acid 1 (or 20 or 30 or 40 etc.) to about amino acid 20, (or 130, or 140 or 150 etc.) of a 191P4D12(b) protein shown in FIG. 2 or FIG. 3 are embodiments of the invention. It is to be appreciated that the starting and stopping positions in this paragraph refer to the specified position as well as that position plus or minus 5 residues.

[0332] 191P4D12(b)-related proteins are generated using standard peptide synthesis technology or using chemical cleavage methods well known in the art. Alternatvely, recombinant methods can be used to generate nucleic acid molecules that encode a 191P4D12(b)-related protein. In one embodiment, nucleic acid molecules provide a means to generate defined fragments of a 191P4D12(b) protein (or variants, homologs or analogs thereof).

[0333] III.A.) Motif-bearing Protein Embodiments

[0334] Additional illustrative embodiments of the invention disclosed herein include 191P4D12(b) polypeptides comprising the amino acid residues of one or more of the biological motifs contained within a 191P4D12(b) polypeptide sequence set forth in FIG. 2 or FIG. 3. Various motifs are known in the art, and a protein can be evaluated for the presence of such motifs by a number of publicly available Internet sites (see, e.g., URL addresses: pfam.wustl.edu/; searchlauncher.bcm.tmc.edu/seq-search/struc-predict.html; psort.ims.u-tokyo.ac.jp/; cbs.dtu.dk/; ebi.ac.uk/interpro/scan.html; expasy.ch/tools/scnpsit1.html; Epimatrix™ and Epimer™, Brown University, brown.edu/Research/TB-HIV_Lab/epimatrix/epimatrix.html; and BIMAS, bimas.dcrt.nih.gov/.).

[0335] Motif bearing subsequences of all 191P4D12(b) variant proteins are set forth and identified in Tables VIII-XXI and XXII-XLIX.

[0336] Table V sets forth several frequently occurring motifs based on pfam searches (see URL address pfam.wustl.edu/). The columns of Table V list (1) motif name abbreviation, (2) percent identity found amongst the different member of the motif family, (3) motif name or description and (4) most common function; location information is included if the motif is relevant for location.

[0337] Polypeptides comprising one or more of the 191P4D12(b) motifs discussed above are useful in elucidating the specific characteristics of a malignant phenotype in view of the observation that the 191P4D12(b) motifs discussed above are associated with growth dysregulation and because 191P4D12(b) is overexpressed in certain cancers (See, e.g., Table I). Casein kinase II, cAMP and camp-dependent protein kinase, and Protein Kinase C, for example, are enzymes known to be associated with the development of the malignant phenotype (see e.g. Chen et al., Lab Invest., 78(2): 165-174 (1998); Gaiddon et al., Endocrinology 136(10): 4331-4338 (1995); Hall et al., Nucleic Acids Research 24(6): 1119-1126 (1996); Peterziel et al., Oncogene 18(46): 6322-6329 (1999) and O'Brian, Oncol. Rep. 5(2): 305-309 (1998)). Moreover, both glycosylation and myristoylation are protein modifications also associated with cancer and cancer progression (see e.g. Dennis et al., Biochem. Biophys. Acta 1473(1):21-34 (1999); Raju et aL, Exp. Cell Res. 235(1): 145-154 (1997)). Amidation is another protein modification also associated with cancer and cancer progression (see e.g. Treston et al., J. Natl. Cancer Inst. Monogr. (13): 169-175 (1992)).

[0338] In another embodiment, proteins of the invention comprise one or more of the immunoreactive epitopes identified in accordance with art-accepted methods, such as the peptides set forth in Tables VIII-XXI and XXII-XLIX. CTL epitopes can be determined using specific algorithms to identify peptides within a 191P4D12(b) protein that are capable of optimally binding to specified HLA alleles (e.g., Table IV; Epimatrix™ and Epimer™, Brown University, URL brown.edu/Research/TB-HIV_Lab/epimatrix/epimatrix.html; and BIMAS, URL bimas.dcrt.nih.gov/.) Moreover, processes for identifying peptides that have sufficient binding affinity for HLA molecules and which are correlated with being immunogenic epitopes, are well known in the art, and are carried out without undue experimentation. In addition, processes for identifying peptides that are immunogenic epitopes, are well known in the art, and are carried out without undue experimentation either in vitro or in vivo.

[0339] Also known in the art are principles for creating analogs of such epitopes in order to modulate immunogenicity. For example, one begins with an epitope that bears a CTL or HTL motif (see, e.g., the HLA Class I and HLA Class II motifs/supermotifs of Table IV). The epitope is analoged by substituting out an amino acid at one of the specified positions, and replacing it with another amino acid specified for that position. For example, on the basis of residues defined in Table IV, one can substitute out a deleterious residue in favor of any other residue, such as a preferred residue; substitute a less-preferred residue with a preferred residue; or substitute an originally-occurring preferred residue with another preferred residue. Substitutions can occur at primary anchor positions or at other positions in a peptide; see, e.g., Table IV.

[0340] A variety of references reflect the art regarding the identification and generation of epitopes in a protein of interest as well as analogs thereof. See, for example, WO 97/33602 to Chesnut et al.; Sette, Immunogenetics 1999 50(3-4): 201-212; Sette et al., J. Immunol. 2001 166(2): 1389-1397; Sidney et al., Hum. Immunol. 1997 58(1): 12-20; Kondo et al., Immunogenetics 1997 45(4): 249-258; Sidney et al., J. Immunol. 1996 157(8): 3480-90; and Falk et al., Nature 351: 290-6 (1991); Hunt et al., Science 255:1261-3 (1992); Parker et al., J. Immunol. 149:3580-7 (1992); Parker et al., J. Immunol. 152:163-75 (1994)); Kast et al., 1994 152(8): 3904-12; Borras-Cuesta et al., Hum. Immunol. 2000 61(3): 266-278; Alexander et al., J. Immunol. 2000 164(3); 164(3): 1625-1633; Alexander et al., PMID: 7895164, UI: 95202582; O'Sullivan et al., J. Immunol. 1991 147(8): 2663-2669; Alexander et al., Immunity 1994 1(9): 751-761 and Alexander et al., Immunol. Res. 1998 18(2): 79-92.

[0341] Related embodiments of the invention include polypeptides comprising combinations of the different motifs set forth in Table VI, and/or, one or more of the predicted CTL epitopes of Tables VIII-XXI and XXII-XLIX, and/or, one or more of the predicted HTL epitopes of Tables XLVI-XLIX, and/or, one or more of the T cell binding motifs known in the art. Preferred embodiments contain no insertions, deletions or substitutions either within the motifs or within the intervening sequences of the polypeptides. In addition, embodiments which include a number of either N-terminal and/or C-terminal amino acid residues on either side of these motifs may be desirable (to, for example, include a greater portion of the polypeptide architecture in which the motif is located). Typically, the number of N-terminal and/or C-terminal amino acid residues on either side of a motif is between about 1 to about 100 amino acid residues, preferably 5 to about 50 amino acid residues.

[0342] 191P4D12(b)-related proteins are embodied in many forms, preferably in isolated form. A purified 191P4D12(b) protein molecule will be substantially free of other proteins or molecules that impair the binding of 191P4D12(b) to antibody, T cell or other ligand. The nature and degree of isolation and purification will depend on the intended use. Embodiments of a 191P4D12(b)-related proteins include purified 191P4D12(b)-related proteins and functional, soluble 191P4D12(b)-related proteins. In one embodiment, a functional, soluble 191P4D12(b) protein or fragment thereof retains the ability to be bound by antibody, T cell or other ligand.

[0343] The invention also provides 191P4D12(b) proteins comprising biologically active fragments of a 191P4D12(b) amino acid sequence shown in FIG. 2 or FIG. 3. Such proteins exhibit properties of the starting 191P4D12(b) protein, such as the ability to elicit the generation of antibodies that specifically bind an epitope associated with the starting 191P4D12(b) protein; to be bound by such antibodies; to elicit the activation of HTL or CTL; and/or, to be recognized by HTL or CTL that also specifically bind to the starting protein.

[0344] 191P4D12(b)-related polypeptides that contain particularly interesting structures can be predicted and/or identified using various analytical techniques well known in the art, including, for example, the methods of Chou-Fasman, Garnier-Robson, Kyte-Doolittle, Eisenberg, Karplus-Schultz or Jameson-Wolf analysis, or based on immunogenicity. Fragments that contain such structures are particularly useful in generating subunit-specific anti-191P4D12(b) antibodies or T cells or in identifying cellular factors that bind to 191P4D12(b). For example, hydrophilicity profiles can be generated, and immunogenic peptide fragments identified, using the method of Hopp, T. P. and Woods, K. R., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:3824-3828. Hydropathicity profiles can be generated, and immunogenic peptide fragments identified, using the method of Kyte, J. and Doolittle, R. F., 1982, J. Mol. Biol. 157:105-132. Percent (%) Accessible Residues profiles can be generated, and immunogenic peptide fragments identified, using the method of Janin J., 1979, Nature 277:491-492. Average Flexibility profiles can be generated, and immunogenic peptide fragments identified, using the method of Bhaskaran R., Ponnuswamy P. K., 1988, Int. J. Pept. Protein Res. 32:242-255. Beta-turn profiles can be generated, and immunogenic peptide fragments identified, using the method of Deleage, G., Roux B., 1987, Protein Engineering 1:289-294.

[0345] CTL epitopes can be determined using specific algorithms to identfy peptides within a 191P4D12(b) protein that are capable of optimally binding to specified HLA alleles (e.g., by using the SYFPEITHI site at World Wide Web URL syfpeithi.bmi-heidelberg.com/; the listings in Table IV(A)-(E); Epimatrix™ and Epimer™, Brown University, URL (brown.edu/Research/TB-HIV_Lab/epimatrix/epimatrix.html); and BIMAS, URL bimas.dcrt.nih.gov/). Illustrating this, peptide epitopes from 191P4D12(b) that are presented in the context of human MHC Class I molecules, e.g., HLA-A1, A2, A3, A11, A24, B7 and B35 were predicted (see, e.g., Tables VIII-XXI, XXII-XLIX). Specifically, the complete amino acid sequence of the 191P4D12(b) protein and relevant portions of other variants, i.e., for HLA Class I predictions 9 flanking residues on either side of a point mutation or exon juction, and for HLA Class II predictions 14 flanking residues on either side of appoint mutation or exon junction corresponding to that variant, were entered into the HLA Peptide Motif Search algorithm found in the Bioinformatics and Molecular Analysis Section (BIMAS) web site listed above; in addition to the site SYFPEITHI, at URL syfpeithi.bmi-heidelberg.com/.

[0346] The HLA peptide motif search algorithm was developed by Dr. Ken Parker based on binding of specific peptide sequences in the groove of HLA Class I molecules, in particular HLA-A2 (see, e.g., Falk et al., Nature 351: 290-6 (1991); Hunt et al., Science 255:1261-3 (1992); Parker et al., J. Immunol. 149:3580-7 (1992); Parker et al., J. Immunol. 152:163-75 (1994)). This algorithm allows location and ranking of 8-mer, 9-mer, and 10-mer peptides from a complete protein sequence for predicted binding to HLA-A2 as well as numerous other HLA Class I molecules. Many HLA class I binding peptides are 8-, 9-, 10 or 11-mers. For example, for Class I HLA-A2, the epitopes preferably contain a leucine (L) or methionine (M) at position 2 and a valine (V) or leucine (L) at the C-terminus (see, e.g., Parker et al., J. Immunol. 149:3580-7 (1992)). Selected results of 191P4D12(b) predicted binding peptides are shown in Tables VIII-XXI and XXII-XLIX herein. In Tables VIII-XXI and XXII-XLVII, selected candidates, 9-mers and 10-mers, for each family member are shown along with their location, the amino acid sequence of each specific peptide, and an estimated binding score. In Tables XLVI-XLIX, selected candidates, 15-mers, for each family member are shown along with their location, the amino acid sequence of each specific peptide, and an estimated binding score. The binding score corresponds to the estimated half time of dissociation of complexes containing the peptide at 37° C. at pH 6.5. Peptides with the highest binding score are predicted to be the most tightly bound to HLA Class I on the cell surface for the greatest period of time and thus represent the best immunogenic targets for T-cell recognition.

[0347] Actual binding of peptides to an HLA allele can be evaluated by stabilization of HLA expression on the antigen-processing defective cell line T2 (see, e.g., Xue et al., Prostate 30:73-8 (1997) and Peshwa et aL, Prostate 36:129-38 (1998)). Immunogenicity of specific peptides can be evaluated in vitro by stimulation of CD8+ cytotoxic T lymphocytes (CTL) in the presence of antigen presenting cells such as dendritic cells.

[0348] It is to be appreciated that every epitope predicted by the BIMAS site, Epimer™ and Epimatrix™ sites, or specified by the HLA class I or class II motifs available in the art or which become part of the art such as set forth in Table IV (or determined using World Wide Web site URL syfpeithi.bmi-heidelberg.com/, or BIMAS, bimas.dcrt.nih.gov/) are to be “applied” to a 191P4D12(b) protein in accordance with the invention. As used in this context “applied” means that a 191P4D12(b) protein is evaluated, e.g., visually or by computer-based patterns finding methods, as appreciated by those of skill in the relevant art. Every subsequence of a 191P4D12(b) protein of 8, 9, 10, or 11 amino acid residues that bears an HLA Class I motif, or a subsequence of 9 or more amino acid residues that bear an HLA Class II motif are within the scope of the invention.

[0349] III.B.) Expression of 191P4D12(b)-related Proteins

[0350] In an embodiment described in the examples that follow, 191P4D12(b) can be conveniently expressed in cells (such as 293T cells) transfected with a commercially available expression vector such as a CMV-driven expression vector encoding 191P4D12(b) with a C-terminal 6XHis and MYC tag (pcDNA3.1/mycHIS, Invitrogen or Tag5, GenHunter Corporation, Nashville Tenn.). The Tag5 vector provides an IgGK secretion signal that can be used to facilitate the production of a secreted 191P4D12(b) protein in transfected cells. The secreted HIS-tagged 191P4D12(b) in the culture media can be purified, e.g., using a nickel column using standard techniques.

[0351] III.C.) Modifications of 191P4D12(b)-related Proteins

[0352] Modifications of 191P4D12(b)-related proteins such as covalent modifications are included within the scope of this invention. One type of covalent modification includes reacting targeted amino acid residues of a 191P4D12(b) polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N- or C- terminal residues of a 191P4D12(b) protein. Another type of covalent modification of a 191P4D12(b) polypeptide included within the scope of this invention comprises altering the native glycosylation pattern of a protein of the invention. Another type of covalent modification of 191P4D12(b) comprises linking a 191P4D12(b) polypeptide to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol (PEG), polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Pat. Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.

[0353] The 191P4D12(b)-related proteins of the present invention can also be modified to form a chimeric molecule comprising 191P4D12(b) fused to another, heterologous polypeptide or amino acid sequence. Such a chimeric molecule can be synthesized chemically or recombinantly. A chimeric molecule can have a protein of the invention fused to another tumor-associated antigen or fragment thereof. Alternatively, a protein in accordance with the invention can comprise a fusion of fragments of a 191P4D12(b) sequence (amino or nucleic acid) such that a molecule is created that is not, through its length, directly homologous to the amino or nucleic acid sequences shown in FIG. 2 or FIG. 3. Such a chimeric molecule can comprise multiples of the same subsequence of 191P4D12(b). A chimeric molecule can comprise a fusion of a 191P4D12(b)-related protein with a polyhistidine epitope tag, which provides an epitope to which immobilized nickel can selectively bind, with cytokines or with growth factors. The epitope tag is generally placed at the amino- or carboxyl-terminus of a 191P4D12(b) protein. In an alternative embodiment, the chimeric molecule can comprise a fusion of a 191P4D12(b)-related protein with an immunoglobulin or a particular region of an immunoglobulin. For a bivalent form of the chimeric molecule (also referred to as an “immunoadhesin”), such a fusion could be to the Fc region of an IgG molecule. The Ig fusions preferably include the substitution of a soluble (transmembrane domain deleted or inactivated) form of a 191P4D12(b) polypeptide in place of at least one variable region within an Ig molecule. In a preferred embodiment, the immunoglobulin fusion includes the hinge, CH2 and CH3, or the hinge, CHI, CH2 and CH3 regions of an IgGl molecule. For the production of immunoglobulin fusions see, e.g., U.S. Pat. No. 5,428,130 issued Jun. 27, 1995.

[0354] III.D.) Uses of 191P4D12(b)-related Proteins

[0355] The proteins of the invention have a number of different specific uses. As 191P4D12(b) is highly expressed in prostate and other cancers, 191P4D12(b)-related proteins are used in methods that assess the status of 191P4D12(b) gene products in normal versus cancerous tissues, thereby elucidating the malignant phenotype. Typically, polypeptides from specific regions of a 191P4D12(b) protein are used to assess the presence of perturbations (such as deletions, insertions, point mutations etc.) in those regions (such as regions containing one or more motifs). Exemplary assays utilize antibodies or T cells targeting 191P4D12(b)-related proteins comprising the amino acid residues of one or more of the biological motifs contained within a 191P4D12(b) polypeptide sequence in order to evaluate the characteristics of this region in normal versus cancerous tissues or to elicit an immune response to the epitope. Alternatively, 191P4D12(b)-related proteins that contain the amino acid residues of one or more of the biological motifs in a 191P4D12(b) protein are used to screen for factors that interact with that region of 191P4D12(b).

[0356] 191P4D12(b) protein fragments/subsequences are particularly useful in generating and characterizing domain-specific antibodies (e.g., antibodies recognizing an extracellular or intracellular epitope of a 191P4D12(b) protein), for identifying agents or cellular factors that bind to 191P4D12(b) or a particular structural domain thereof, and in various therapeutic and diagnostic contexts, including but not limited to diagnostic assays, cancer vaccines and methods of preparing such vaccines.

[0357] Proteins encoded by the 191P4D12(b) genes, or by analogs, homologs or fragments thereof, have a variety of uses, including but not limited to generating antibodies and in methods for identifying ligands and other agents and cellular constituents that bind to a 191P4D12(b) gene product. Antibodies raised against a 191P4D12(b) protein or fragment thereof are useful in diagnostic and prognostic assays, and imaging methodologies in the management of human cancers characterized by expression of 191P4D12(b) protein, such as those listed in Table I. Such antibodies can be expressed intracellularly and used in methods of treating patients with such cancers. 191P4D12(b)-related nucleic acids or proteins are also used in generating HTL or CTL responses.

[0358] Various immunological assays useful for the detection of 191P4D12(b) proteins are used, including but not limited to various types of radioimmunoassays, enzyme-linked immunosorbent assays (ELISA), enzyme-linked immunofluorescent assays (ELIFA), immunocytochemical methods, and the like. Antibodies can be labeled and used as immunological imaging reagents capable of detecting 191P4D12(b)-expressing cells (e.g., in radioscintigraphic imaging methods). 191P4D12(b) proteins are also particularly useful in generating cancer vaccines, as further described herein.

[0359] IV.) 191P4D12(b) Antibodies

[0360] Another aspect of the invention provides antibodies that bind to 191P4D12(b)-related proteins. Preferred antibodies specifically bind to a 191P4D12(b)-related protein and do not bind (or bind weakly) to peptides or proteins that are not 191P4D12(b)-related proteins under physiological conditions. In this context, examples of physiological conditions include: 1) phosphate buffered saline; 2) Tris-buffered saline containing 25 mM Tris and 150 mM NaCl; or normal saline (0.9% NaCl); 4) animal serum such as human serum; or, 5) a combination of any of 1) through 4); these reactions preferably taking place at pH 7.5, alternatively in a range of pH 7.0 to 8.0, or alternatively in a range of pH 6.5 to 8.5; also, these reactions taking place at a temperature between 4° C. to 37° C. For example, antibodies that bind 191P4D12(b) can bind 191P4D12(b)-related proteins such as the homologs or analogs thereof.

[0361] 191P4D12(b) antibodies of the invention are particularly useful in cancer (see, e.g., Table I) diagnostic and prognostic assays, and imaging methodologies. Similarly, such antibodies are useful in the treatment, diagnosis, and/or prognosis of other cancers, to the extent 191P4D12(b) is also expressed or overexpressed in these other cancers. Moreover, intracellularly expressed antibodies (e.g., single chain antibodies) are therapeutically useful in treating cancers in which the expression of 191P4D12(b) is involved, such as advanced or metastatic prostate cancers.

[0362] The invention also provides various immunological assays useful for the detection and quantification of 191P4D12(b) and mutant 191P4D12(b)-related proteins. Such assays can comprise one or more 191P4D12(b) antibodies capable of recognizing and binding a 191P4D12(b)-related protein, as appropriate. These assays are performed within various immunological assay formats well known in the art, including but not limited to various types of radioimmunoassays, enzyme-linked immunosorbent assays (ELISA), enzyme-linked immunofluorescent assays (ELIFA), and the like.

[0363] Immunological non-antibody assays of the invention also comprise T cell immunogenicity assays (inhibitory or stimulatory) as well as major histocompatibility complex (MHC) binding assays.

[0364] In addition, immunological imaging methods capable of detecting prostate cancer and other cancers expressing 191P4D12(b) are also provided by the invention, including but not limited to radioscintigraphic imaging methods using labeled 191P4D12(b) antibodies. Such assays are clinically useful in the detection, monitoring, and prognosis of 191P4D12(b) expressing cancers such as prostate cancer.

[0365] 191P4D12(b) antibodies are also used in methods for purifying a 191P4D12(b)-related protein and for isolating 191P4D12(b) homologues and related molecules. For example, a method of purifying a 191P4D12(b)-related protein comprises incubating a 191P4D12(b) antibody, which has been coupled to a solid matrix, with a lysate or other solution containing a 191P4D12(b)-related protein under conditions that permit the 191P4D12(b) antibody to bind to the 191P4D12(b)-related protein; washing the solid matrix to eliminate impurities; and eluting the 191P4D12(b)-related protein from the coupled antibody. Other uses of 191P4D12(b) antibodies in accordance with the invention include generating anti-idiotypic antibodies that mimic a 191P4D12(b) protein.

[0366] Various methods for the preparation of antibodies are well known in the art. For example, antibodies can be prepared by immunizing a suitable mammalian host using a 191P4D12(b)-related protein, peptide, or fragment, in isolated or immunoconjugated form (Antibodies: A Laboratory Manual, CSH Press, Eds., Harlow, and Lane (1988); Harlow, Antibodies, Cold Spring Harbor Press, NY (1989)). In addition, fusion proteins of 191P4D12(b) can also be used, such as a 191P4D12(b) GST-fusion protein. In a particular embodiment, a GST fusion protein comprising all or most of the amino acid sequence of FIG. 2 or FIG. 3 is produced, then used as an immunogen to generate appropriate antibodies. In another embodiment, a 191P4D12(b)-related protein is synthesized and used as an immunogen.

[0367] In addition, naked DNA immunization techniques known in the art are used (with or without purified 191P4D12(b)-related protein or 191P4D12(b) expressing cells) to generate an immune response to the encoded immunogen (for review, see Donnelly et al., 1997, Ann. Rev. Immunol. 15: 617-648).

[0368] The amino acid sequence of a 191P4D12(b) protein as shown in FIG. 2 or FIG. 3 can be analyzed to select specific regions of the 191P4D12(b) protein for generating antibodies. For example, hydrophobicity and hydrophilicity analyses of a 191P4D12(b) amino acid sequence are used to identify hydrophilic regions in the 191P4D12(b) structure. Regions of a 191P4D12(b) protein that show immunogenic structure, as well as other regions and domains, can readily be identified using various other methods known in the art, such as Chou-Fasman, Garnier-Robson, Kyte-Doolittle, Eisenberg, Karplus-Schultz or Jameson-Wolf analysis. Hydrophilicity profiles can be generated using the method of Hopp, T. P. and Woods, K. R., 1981, Proc. Natl. Acad. Sci. U.S.A. 78:3824-3828. Hydropathicity profiles can be generated using the method of Kyte, J. and Doolittle, R. F., 1982, J. Mol. Biol. 157:105-132. Percent (%) Accessible Residues profiles can be generated using the method of Janin J., 1979, Nature 277:491-492. Average Flexibility profiles can be generated using the method of Bhaskaran R., Ponnuswamy P. K., 1988, Int. J. Pept. Protein Res. 32:242-255. Beta-turn profiles can be generated using the method of Deleage, G., Roux B., 1987, Protein Engineering 1:289-294. Thus, each region identified by any of these programs or methods is within the scope of the present invention. Methods for the generation of 191P4D12(b) antibodies are further illustrated by way of the examples provided herein. Methods for preparing a protein or polypeptide for use as an immunogen are well known in the art. Also well known in the art are methods for preparing immunogenic conjugates of a protein with a carrier, such as BSA, KLH or other carrier protein. In some circumstances, direct conjugation using, for example, carbodiimide reagents are used; in other instances linking reagents such as those supplied by Pierce Chemical Co., Rockford, Ill., are effective. Administration of a 191P4D12(b) immunogen is often conducted by injection over a suitable time period and with use of a suitable adjuvant, as is understood in the art. During the immunization schedule, titers of antibodies can be taken to determine adequacy of antibody formation.

[0369] 191P4D12(b) monoclonal antbodies can be produced by various means well known in the art. For example, immortalized cell lines that secrete a desired monoclonal antibody are prepared using the standard hybridoma technology of Kohler and Milstein or modificabons that immortalize antibody-producing B cells, as is generally known. Immortalized cell lines that secrete the desired antibodies are screened by immunoassay in which the antigen is a 191P4D12(b)-related protein. When the appropriate immortalized cell culture is identified, the cells can be expanded and antibodies produced either from in vitro cultures or from ascites fluid.

[0370] The antibodies or fragments of the invention can also be produced, by recombinant means. Regions that bind specifically to the desired regions of a 191P4D12(b) protein can also be produced in the context of chimeric or complementarity-determining region (CDR) grafted antibodies of multiple species origin. Humanized or human 191P4D12(b) antibodies can also be produced, and are preferred for use in therapeutic contexts. Methods for humanizing murine and other non-human antibodies, by substituting one or more of the non-human antibody CDRs for corresponding human antibody sequences, are well known (see for example, Jones et al., 1986, Nature 321: 522-525; Riechmann et al., 1988, Nature 332: 323-327; Verhoeyen et al., 1988, Science 239: 1534-1536). See also, Carter et al., 1993, Proc. Natl. Acad. Sci. USA 89: 4285 and Sims et al, 1993, J. Immunol. 151: 2296.

[0371] Methods for producing fully human monoclonal antibodies include phage display and transgenic methods (for review, see Vaughan et al., 1998, Nature Biotechnology 16: 535-539). Fully human 191P4D12(b) monoclonal antibodies can be generated using cloning technologies employing large human Ig gene combinatorial libraries (i.e., phage display) (Griffiths and Hoogenboom, Building an in vitro immune system: human antibodies from phage display libraries. In: Protein Engineering of Antibody Molecules for Prophylactic and Therapeutic Applications in Man, Clark, M. (Ed.), Nottingham Academic, pp 45-64 (1993); Burton and Barbas, Human Antibodies from combinatorial libraries. Id., pp 65-82). Fully human 191P4D12(b) monoclonal antibodies can also be produced using transgenic mice engineered to contain human immunoglobulin gene loci as described in PCT Patent Application WO98/24893, Kucherlapati and Jakobovits et al., published Dec. 3, 1997 (see also, Jakobovits, 1998, Exp. Opin. Invest. Drugs 7(4): 607-614; U.S. Pat. Nos. 6,162,963 issued 19 Dec. 2000; 6,150,584 issued 12 Nov. 2000; and, 6,114,598 issued 5 Sep. 2000). This method avoids the in vitro manipulation required with phage display technology and efficiently produces high affinity authentic human antibodies.

[0372] Reactivity of 191P4D12(b) antibodies with a 191P4D12(b)-related protein can be established by a number of well known means, including Western blot, immunoprecipitation, ELISA, and FACS analyses using, as appropriate, 191P4D12(b)-related proteins, 191P4D12(b)-expressing cells or extracts thereof. A 191P4D12(b) antibody or fragment thereof can be labeled with a detectable marker or conjugated to a second molecule. Suitable detectable markers include, but are not limited to, a radioisotope, a fluorescent compound, a bioluminescent compound, chemiluminescent compound, a metal chelator or an enzyme. Further, bi-specific antibodies specific for two or more 191P4D12(b) epitopes are generated using methods generally known in the art. Homodimeric antibodies can also be generated by cross-linking techniques known in the art (e.g., Wolff et al., Cancer Res. 53: 2560-2565).

[0373] V.) 191P4D12(b) Cellular Immune Responses

[0374] The mechanism by which T cells recognize antigens has been delineated. Efficacious peptide epitope vaccine compositions of the invention induce a therapeutic or prophylactic immune responses in very broad segments of the world-wide population. For an understanding of the value and efficacy of compositions of the invention that induce cellular immune responses, a brief review of immunology-related technology is provided.

[0375] A complex of an HLA molecule and a peptidic antigen acts as the ligand recognized by HLA-restricted T cells (Buus, S. et al., Cell 47:1071, 1986; Babbitt, B. P. et al., Nature 317:359, 1985; Townsend, A. and Bodmer, H., Annu. Rev. Immunol. 7:601, 1989; Germain, R. N., Annu. Rev. Immunol. 11:403, 1993). Through the study of single amino acid substituted antigen analogs and the sequencing of endogenously bound, naturally processed peptides, critical residues that correspond to motifs required for specific binding to HLA antigen molecules have been identified and are set forth in Table IV (see also, e.g., Southwood, et al., J. Immunol. 160:3363, 1998; Rammensee, et al., Immunogenetics 41:178, 1995; Rammensee et al., SYFPEITHI, access via World Wide Web at URL (134.2.96.221/scripts.hlaserver.dll/home.htm); Sette, A. and Sidney, J. Curr. Opin. Immunol. 10:478,1998; Engelhard, V. H., Curr. Opin. Immunol. 6:13, 1994; Sette, A. and Grey, H. M., Curr. Opin. Immunol. 4:79, 1992; Sinigaglia, F. and Hammer, J. Curr. Biol. 6:52, 1994; Ruppert et al., Cell 74:929-937, 1993; Kondo et al., J. Immunol. 155:4307-4312, 1995; Sidney et al., J. Immunol. 157:3480-3490, 1996; Sidney et al., Human Immunol. 45:79-93, 1996; Sette, A. and Sidney, J. Immunogenetics 1999 Nov; 50(3-4):201-12, Review).

[0376] Furthermore, x-ray crystallographic analyses of HLA-peptide complexes have revealed pockets within the peptide binding cleft/groove of HLA molecules which accommodate, in an allele-specific mode, residues borne by peptide ligands; these residues in turn determine the HLA binding capacity of the peptides in which they are present. (See, e.g., Madden, D. R. Annu. Rev. Immunol. 13:587, 1995; Smith, et al., Immunity 4:203, 1996; Fremont et al., Immunity 8:305, 1998; Stern et al., Structure 2:245, 1994; Jones, E. Y. Curr. Opin. Immunol. 9:75, 1997; Brown, J. H. et al., Nature 364:33, 1993; Guo, H. C. et al., Proc. Natl. Acad. Sci. USA 90:8053, 1993; Guo, H. C. et al., Nature 360:364, 1992; Silver, M. L. et al., Nature 360:367, 1992; Matsumura, M. et al., Science 257:927, 1992; Madden et al., Cell 70:1035, 1992; Fremont, D. H. et al., Science 257:919,1992; Saper, M. A., Bjorkman, P. J. and Wiley, D. C., J. Mol. Biol. 219:277,1991.)

[0377] Accordingly, the definition of class I and class II allele-specific HLA binding motifs, or class I or class II supermotifs allows identification of regions within a protein that are correlated with binding to particular HLA antigen(s).

[0378] Thus, by a process of HLA motif identification, candidates for epitope-based vaccines have been identified; such candidates can be further evaluated by HLA-peptide binding assays to determine binding affinity and/or the time period of association of the epitope and its corresponding HLA molecule. Additional confirmatory work can be performed to select, amongst these vaccine candidates, epitopes with preferred characteristics in terms of population coverage, and/or immunogenicity.

[0379] Various strategies can be utilized to evaluate cellular immunogenicity, including:

[0380] 1) Evaluation of primary T cell cultures from normal individuals (see, e.g., Wentworth, P. A. et al., Mol. Immunol. 32:603, 1995; Celis, E. et al., Proc. Natl. Acad. Sci. USA 91:2105, 1994; Tsai, V. et al., J. Immunol. 158:1796, 1997; Kawashima, I. et al., Human Immunol. 59:1, 1998). This procedure involves the stimulation of peripheral blood lymphocytes (PBL) from normal subjects with a test peptide in the presence of antigen presenting cells in vitro over a period of several weeks. T cells specific for the peptide become activated during this time and are detected using, e.g., a lymphokine- or 51Cr-release assay involving peptide sensitized target cells.

[0381] 2) Immunization of HLA transgenic mice (see, e.g., Wentworth, P. A. et al., J. Immunol. 26:97, 1996; Wentworth, P. A. et al., Int. Immunol. 8:651, 1996; Alexander, J. et al., J. Immunol. 159:4753, 19,97). For example, in such methods peptides in incomplete Freund's adjuvant are administered subcutaneously to HLA transgenic mice. Several weeks following immunization, splenocytes are removed and cultured in vitro in the presence of test peptide for approximately one week. Peptide-specific T cells are detected using, e.g., a 51Cr-release assay involving peptide sensitized target cells and target cells expressing endogenously generated antigen.

[0382] 3) Demonstration of recall T cell responses from immune individuals who have been either effectively vaccinated and/or from chronically ill patients (see, e.g., Rehermann, B. et al., J. Exp. Med. 181:1047, 1995; Doolan, D. L. et al., Immunity 7:97, 1997; Bertoni, R. et al., J. Clin. Invest. 100:503, 1997; Threlkeld, S. C. et al., J. Immunol. 159:1648, 1997; Diepolder, H. M. et al., J. Virol. 71:6011, 1997). Accordingly, recall responses are detected by culturing PBL from subjects that have been exposed to the antigen due to disease and thus have generated an immune response “naturally”, or from patients who were vaccinated against the antigen. PBL from subjects are cultured in vitro for 1-2 weeks in the presence of test peptide plus antigen presenting cells (APC) to allow activation of “memory” T cells, as compared to “naive” T cells. At the end of the culture period, T cell activity is detected using assays including 51Cr release involving peptide-sensitized targets, T cell proliferation, or lymphokine release.

[0383] VI.) 191P4D12(b) Transgenic Animals

[0384] Nucleic acids that encode a 191P4D12(b)-related protein can also be used to generate either transgenic animals or “knock out” animals that, in turn, are useful in the development and screening of therapeutically useful reagents. In accordance with established techniques, cDNA encoding 191P4D12(b) can be used to clone genomic DNA that encodes 191P4D12(b). The cloned genomic sequences can then be used to generate transgenic animals containing cells that express DNA that encode 191P4D12(b). Methods for generating transgenic animals, particularly animals such as mice or rats, have become conventional in the art and are described, for example, in U.S. Pat. Nos. 4,736,866 issued 12 Apr. 1988, and 4,870,009 issued 26 Sep. 1989. Typically, particular cells would be targeted for 191P4D12(b) transgene incorporation with tissue-specific enhancers.

[0385] Transgenic animals that include a copy of a transgene encoding 191P4D12(b) can be used to examine the effect of increased expression of DNA that encodes 191P4D12(b). Such animals can be used as tester animals for reagents thought to confer protection from, for example, pathological conditions associated with its overexpression. In accordance with this aspect of the invention, an animal is treated with a reagent and a reduced incidence of a pathological condition, compared to untreated animals that bear the transgene, would indicate a potential therapeutic intervention for the pathological condition.

[0386] Alternatively, non-human homologues of 191P4D12(b) can be used to construct a 191P4D12(b) “knock out” animal that has a defective or altered gene encoding 191P4D12(b) as a result of homologous recombination between the endogenous gene encoding 191P4D12(b) and altered genomic DNA encoding 191P4D12(b) introduced into an embryonic cell of the animal. For example, cDNA that encodes 191P4D12(b) can be used to clone genomic DNA encoding 191P4D12(b) in accordance with established techniques. A portion of the genomic DNA encoding 191P4D12(b) can be deleted or replaced with another gene, such as a gene encoding a selectable marker that can be used to monitor integration. Typically, several kilobases of unaltered flanking DNA (both at the 5′ and 3′ ends) are included in the vector (see, e.g., Thomas and Capecchi, Cell, 51:503 (1987) for a description of homologous recombination vectors). The vector is introduced into an embryonic stem cell line (e.g., by electroporation) and cells in which the introduced DNA has homologously recombined with the endogenous DNA are selected (see, e.g., Li et al., Cell, 69:915 (1992)). The selected cells are then injected into a blastocyst of an animal (e.g., a mouse or rat) to form aggregation chimeras (see, e.g., Bradley, in Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, E. J. Robertson, ed. (IRL, Oxford, 1987), pp. 113-152). A chimeric embryo can then be implanted into a suitable pseudopregnant female foster animal, and the embryo brought to term to create a “knock out” animal. Progeny harboring the homologously recombined DNA in their germ cells can be identified by standard techniques and used to breed animals in which all cells of the animal contain the homologously recombined DNA. Knock out animals can be characterized, for example, for their ability to defend against certain pathological conditions or for their development of pathological conditions due to absence of a 191P4D12(b) polypeptide.

[0387] VII.) Methods for the Detection of 191P4D12(b)

[0388] Another aspect of the present invention relates to methods for detecting 191P4D12(b) polynucleotides and 191P4D12(b)-related proteins, as well as methods for identifying a cell that expresses 191P4D12(b). The expression profile of 191P4D12(b) makes it a diagnostic marker for metastasized disease. Accordingly, the status of 191P4D12(b) gene products provides information useful for predicting a variety of factors including susceptibility to advanced stage disease, rate of progression, and/or tumor aggressiveness. As discussed in detail herein, the status of 191P4D12(b) gene products in patient samples can be analyzed by a variety protocols that are well known in the art including immunohistochemical analysis, the variety of Northern blotting techniques including in situ hybridization, RT-PCR analysis (for example on laser capture micro-dissected samples), Western blot analysis and tissue array analysis.

[0389] More particularly, the invention provides assays for the detection of 191P4D12(b) polynucleotides in a biological sample, such as serum, bone, prostate, and other tissues, urine, semen, cell preparations, and the like. Detectable 191P4D12(b) polynucleotides include, for example, a 191P4D12(b) gene or fragment thereof, 191P4D12(b) mRNA, alternative splice variant 191P4D12(b) mRNAs, and recombinant DNA or RNA molecules that contain a 191P4D12(b) polynucleotide. A number of methods for amplifying and/or detecting the presence of 191P4D12(b) polynucleotides are well known in the art and can be employed in the practice of this aspect of the invention.

[0390] In one embodiment, a method for detecting a 191P4D12(b) mRNA in a biological sample comprises producing cDNA from the sample by reverse transcription using at least one primer; amplifying the cDNA so produced using a 191P4D12(b) polynucleotides as sense and antisense primers to amplify 191P4D12(b) cDNAs therein; and detecting the presence of the amplified 191P4D12(b) cDNA. Optionally, the sequence of the amplified 191P4D12(b) cDNA can be determined.

[0391] In another embodiment, a method of detecting a 191P4D12(b) gene in a biological sample comprises first isolating genomic DNA from the sample; amplifying the isolated genomic DNA using 191P4D12(b) polynucleotides as sense and antisense primers; and detecting the presence of the amplified 191P4D12(b) gene. Any number of appropriate sense and antisense probe combinations can be designed from a 191P4D12(b) nucleotide sequence (see, e.g., FIG. 2) and used for this purpose.

[0392] The invention also provides assays for detecting the presence of a 191P4D12(b) protein in a tissue or other biological sample such as serum, semen, bone, prostate, urine, cell preparations, and the like. Methods for detecting a 191P4D12(b)-related protein are also well known and include, for example, immunoprecipitation, immunohistochemical analysis, Western blot analysis, molecular binding assays, ELISA, ELIFA and the like. For example, a method of detecting the presence of a 191P4D12(b)-related protein in a biological sample comprises first contacting the sample with a 191P4D12(b) antibody, a 191P4D12(b)-reactive fragment thereof, or a recombinant protein containing an antigen-binding region of a 191P4D12(b) antibody; and then detecting the binding of 191P4D12(b)-related protein in the sample.

[0393] Methods for identifying a cell that expresses 191P4D12(b) are also within the scope of the invention. In one embodiment, an assay for identifying a cell that expresses a 191P4D12(b) gene comprises detecting the presence of 191P4D12(b) mRNA in the cell. Methods for the detection of particular mRNAs in cells are well known and include, for example, hybridization assays using complementary DNA probes (such as in situ hybridization using labeled 191P4D12(b) riboprobes, Northern blot and related techniques) and various nucleic acid amplification assays (such as RT-PCR using complementary primers specific for 191P4D12(b), and other amplification type detection methods, such as, for example, branched DNA, SISBA, TMA and the like). Alternatively, an assay for identifying a cell that expresses a 191P4D12(b) gene comprises detecting the presence of 191P4D12(b)-related protein in the cell or secreted by the cell. Various methods for the detection of proteins are well known in the art and are employed for the detection of 191P4D12(b)-related proteins and cells that express 191P4D12(b)-related proteins.

[0394] 191P4D12(b) expression analysis is also useful as a tool for identifying and evaluating agents that modulate 191P4D12(b) gene expression. For example, 191P4D12(b) expression is significantly upregulated in prostate cancer, and is expressed in cancers of the tissues listed in Table I. Identification of a molecule or biological agent that inhibits 191P4D12(b) expression or over-expression in cancer cells is of therapeutic value. For example, such an agent can be identified by using a screen that quantifies 191P4D12(b) expression by RT-PCR, nucleic acid hybridization or antibody binding.

[0395] VIII.) Methods for Monitoring the Status of 191P4D12(b)-related Genes and Their Products

[0396] Oncogenesis is known to be a multistep process where cellular growth becomes progressively dysregulated and cells progress from a normal physiological state to precancerous and then cancerous states (see, e.g., Alers et al., Lab Invest. 77(5): 437-438 (1997) and Isaacs et al., Cancer Surv. 23: 19-32 (1995)). In this context, examining a biological sample for evidence of dysregulated cell growth (such as aberrant 191P4D12(b) expression in cancers) allows for early detection of such aberrant physiology, before a pathologic state such as cancer has progressed to a stage that therapeutic options are more limited and or the prognosis is worse. In such examinations, the status of 191P4D12(b) in a biological sample of interest can be compared, for example, to the status of 191P4D12(b) in a corresponding normal sample (e.g. a sample from that individual or alternatively another individual that is not affected by a pathology). An alteration in the status of 191P4D12(b) in the biological sample (as compared to the normal sample) provides evidence of dysregulated cellular growth. In addition to using a biological sample that is not affected by a pathology as a normal sample, one can also use a predetermined normative value such as a predetermined normal level of mRNA expression (see, e.g., Grever et al., J. Comp. Neurol. 1996 Dec 9; 376(2): 306-14 and U.S. Pat. No. 5,837,501) to compare 191P4D12(b) status in a sample.

[0397] The term “status” in this context is used according to its art accepted meaning and refers to the condition or state of a gene and its products. Typically, skilled artisans use a number of parameters to evaluate the condition or state of a gene and its products. These include, but are not limited to the location of expressed gene products (including the location of 191P4D12(b) expressing cells) as well as the level, and biological activity of expressed gene products (such as 191P4D12(b) mRNA, polynucleotides and polypeptides). Typically, an alteration in the status of 191P4D12(b) comprises a change in the location of 191P4D12(b) and/or 191P4D12(b) expressing cells and/or an increase in 191P4D12(b) mRNA and/or protein expression.

[0398] 191P4D12(b) status in a sample can be analyzed by a number of means well known in the art, including without limitation, immunohistochemical analysis, in situ hybridization, RT-PCR analysis on laser capture micro-dissected samples, Western blot analysis, and tissue array analysis. Typical protocols for evaluating the status of a 191P4D12(b) gene and gene products are found, for example in Ausubel et al. eds., 1995, Current Protocols In Molecular Biology, Units 2 (Northern Blotting), 4 (Southern Blotting), 15 (Immunoblotting) and 18 (PCR Analysis). Thus, the status of 191P4D12(b) in a biological sample is evaluated by various methods utilized by skilled artisans including, but not limited to genomic Southern analysis (to examine, for example perturbations in a 191P4D12(b) gene), Northern analysis and/or PCR analysis of 191P4D12(b) mRNA (to examine, for example alterations in the polynucleotide sequences or expression levels of 191P4D12(b) mRNAs), and, Western and/or immunohistochemical analysis (to examine, for example alterations in polypeptide sequences, alterations in polypeptide localization within a sample, alterations in expression levels of 191P4D12(b) proteins and/or associations of 191P4D12(b) proteins with polypeptide binding partners). Detectable 191P4D12(b) polynucleotides include, for example, a 191P4D12(b) gene or fragment thereof, 191P4D12(b) mRNA, alternative splice vaniants, 191P4D12(b) mRNAs, and recombinant DNA or RNA molecules containing a 191P4D12(b) polynucleotide.

[0399] The expression profile of 191P4D12(b) makes it a diagnostic marker for local and/or metastasized disease, and provides information on the growth or oncogenic potential of a biological sample. In particular, the status of 191P4D12(b) provides information useful for predicting susceptibility to particular disease stages, progression, and/or tumor aggressiveness. The invention provides methods and assays for determining 191P4D12(b) status and diagnosing cancers that express 191P4D12(b), such as cancers of the tissues listed in Table I. For example, because 191P4D12(b) mRNA is so highly expressed in prostate and other cancers relative to normal prostate tissue, assays that evaluate the levels of 191P4D12(b) mRNA transcripts or proteins in a biological sample can be used to diagnose a disease associated with 191P4D12(b) dysregulation, and can provide prognostic information useful in defining appropriate therapeutic options.

[0400] The expression status of 191P4D12(b) provides information including the presence, stage and location of dysplastic, precancerous and cancerous cells, predicting susceptibility to various stages of disease, and/or for gauging tumor aggressiveness. Moreover, the expression profile makes it useful as an imaging reagent for metastasized disease. Consequently, an aspect of the invention is directed to the various molecular prognostic and diagnostic methods for examining the status of 191P4D12(b) in biological samples such as those from individuals suffering from, or suspected of suffering from a pathology characterized by dysregulated cellular growth, such as cancer.

[0401] As described above, the status of 191P4D12(b) in a biological sample can be examined by a number of well-known procedures in the art. For example, the status of 191P4D12(b) in a biological sample taken from a specific location in the body can be examined by evaluating the sample for the presence or absence of 191P4D12(b) expressing cells (e.g. those that express 191P4D12(b) mRNAs or proteins). This examination can provide evidence of dysregulated cellular growth, for example, when 191P4D12(b)-expressing cells are found in a biological sample that does not normally contain such cells (such as a lymph node), because such alterations in the status of 191P4D12(b) in a biological sample are often associated with dysregulated cellular growth. Specifically, one indicator of dysregulated cellular growth is the metastases of cancer cells from an organ of origin (such as the prostate) to a different area of the body (such as a lymph node). In this context, evidence of dysregulated cellular growth is important for example because occult lymph node metastases can be detected in a substantial proportion of patients with prostate cancer, and such metastases are associated with known predictors of disease progression (see, e.g., Murphy et al., Prostate 42(4): 315-317 (2000);Su et al., Semin. Surg. Oncol. 18(1): 17-28 (2000) and Freeman et al., J Urol 1995 Aug 154(2 Pt 1):474-8).

[0402] In one aspect, the invention provides methods for monitoring 191P4D12(b) gene products by determining the status of 191P4D12(b) gene products expressed by cells from an individual suspected of having a disease associated with dysregulated cell growth (such as hyperplasia or cancer) and then comparing the status so determined to the status of 191P4D12(b) gene products in a corresponding normal sample. The presence of aberrant 191P4D12(b) gene products in the test sample relative to the normal sample provides an indication of the presence of dysregulated cell growth within the cells of the individual.

[0403] In another aspect, the invention provides assays useful in determining the presence of cancer in an individual, comprising detecting a significant increase in 191P4D12(b) mRNA or protein expression in a test cell or tissue sample relative to expression levels in the corresponding normal cell or tissue. The presence of 191P4D12(b) mRNA can, for example, be evaluated in tissues including but not limited to those listed in Table I. The presence of significant 191P4D12(b) expression in any of these tissues is useful to indicate the emergence, presence and/or severity of a cancer, since the corresponding normal tissues do not express 191P4D12(b) mRNA or express it at lower levels.

[0404] In a related embodiment, 191P4D12(b) status is determined at the protein level rather than at the nucleic acid level. For example, such a method comprises determining the level of 191P4D12(b) protein expressed by cells in a test tissue sample and comparing the level so determined to the level of 191P4D12(b) expressed in a corresponding normal sample. In one embodiment, the presence of 191P4D12(b) protein is evaluated, for example, using immunohistochemical methods. 191P4D12(b) antibodies or binding partners capable of detecting 191P4D12(b) protein expression are used in a variety of assay formats well known in the art for this purpose.

[0405] In a further embodiment, one can evaluate the status of 191P4D12(b) nucleotide and amino acid sequences in a biological sample in order to identify perturbations in the structure of these molecules. These perturbations can include insertions, deletions, substitutions and the like. Such evaluations are useful because perturbations in the nucleotide and amino acid sequences are observed in a large number of proteins associated with a growth dysregulated phenotype (see, e.g., Marrogi et al., 1999, J. Cutan. Pathol. 26(8):369-378). For example, a mutation in the sequence of 191P4D12(b) may be indicative of the presence or promotion of a tumor. Such assays therefore have diagnostic and predictive value where a mutation in 191P4D12(b) indicates a potential loss of function or increase in tumor growth.

[0406] A wide variety of assays for observing perturbations in nucleotide and amino acid sequences are well known in the art. For example, the size and structure of nucleic acid or amino acid sequences of 191P4D12(b) gene products are observed by the Northern, Southern, Western, PCR and DNA sequencing protocols discussed herein. In addition, other methods for observing perturbations in nucleotide and amino acid sequences such as single strand conformation polymorphism analysis are well known in the art (see, e.g., U.S. Pat. Nos. 5,382,510 issued 7 Sep. 1999, and 5,952,170 issued 17 Jan. 1995).

[0407] Additionally, one can examine the methylation status of a 191P4D12(b) gene in a biological sample. Aberrant demethylation and/or hypermethylation of CpG islands in gene 5′ regulatory regions frequently occurs in immortalized and transformed cells, and can result in altered expression of various genes. For example, promoter hypermethylation of the pi-class glutathione S-transferase (a protein expressed in normal prostate but not expressed in >90% of prostate carcinomas) appears to permanently silence transcription of this gene and is the most frequently detected genomic alteration in prostate carcinomas (De Marzo et al., Am. J. Pathol. 155(6): 1985-1992 (1999)). In addition, this alteration is present in at least 70% of cases of high-grade prostatic intraepithelial neoplasia (PIN) (Brooks et al., Cancer Epidemiol. Biomarkers Prev., 1998, 7:531-536). In another example, expression of the LAGE-I tumor specific gene (which is not expressed in normal prostate but is expressed in 25-50% of prostate cancers) is induced by deoxy-azacytidine in lymphoblastoid cells, suggesting that tumoral expression is due to demethylation (Lethe et al., Int. J. Cancer 76(6): 903-908 (1998)). A variety of assays for examining methylation status of a gene are well known in the art. For example, one can utlize, in Southern hybridization approaches, methylation-sensitive restriction enzymes that cannot cleave sequences that contain methylated CpG sites to assess the methylation status of CpG islands. In addition, MSP (methylation specific PCR) can rapidly profile the methylation status of all the CpG sites present in a CpG island of a given gene. This procedure involves initial modification of DNA by sodium bisulfite (which will convert all unmethylated cytosines to uracil) followed by amplification using primers specific for methylated versus unmethylated DNA. Protocols involving methylation interference can also be found for example in Current Protocols In Molecular Biology, Unit 12, Frederick M. Ausubel et al. eds., 1995.

[0408] Gene amplification is an additional method for assessing the status of 191P4D12(b). Gene amplification is measured in a sample directly, for example, by conventional Southern blotting or Northern blotting to quantitate the transcription of mRNA (Thomas, 1980, Proc. Natl. Acad. Sci. USA, 77:5201-5205), dot blotting (DNA analysis), or in situ hybridization, using an appropriately labeled probe, based on the sequences provided herein. Alternatively, antibodies are employed that recognize specific duplexes, including DNA duplexes, RNA duplexes, and DNA-RNA hybrid duplexes or DNA-protein duplexes. The antibodies in turn are labeled and the assay carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected.

[0409] Biopsied tissue or peripheral blood can be conveniently assayed for the presence of cancer cells using for example, Northern, dot blot or RT-PCR analysis to detect 191P4D12(b) expression. The presence of RT-PCR amplifiable 191P4D12(b) mRNA provides an indication of the presence of cancer. RT-PCR assays are well known in the art. RT-PCR detection assays for tumor cells in peripheral blood are currently being evaluated for use in the diagnosis and management of a number of human solid tumors. In the prostate cancer field, these include RT-PCR assays for the detection of cells expressing PSA and PSM (Verkaik et al., 1997, Urol. Res. 25:373-384; Ghossein et al., 1995, J. Clin. Oncol. 13:1195-2000; Heston et al., 1995, Clin. Chem. 41:1687-1688).

[0410] A further aspect of the invention is an assessment of the susceptibility that an individual has for developing cancer. In one embodiment, a method for predicting susceptibility to cancer comprises detecting 191P4D12(b) mRNA or 191P4D12(b) protein in a tissue sample, its presence indicating susceptibility to cancer, wherein the degree of 191P4D12(b) mRNA expression correlates to the degree of susceptibility. In a specific embodiment, the presence of 191P4D12(b) in prostate or other tissue is examined, with the presence of 191P4D12(b) in the sample providing an indication of prostate cancer susceptibility (or the emergence or existence of a prostate tumor). Similarly, one can evaluate the integrity 191P4D12(b) nucleotide and amino acid sequences in a biological sample, in order to identify perturbations in the structure of these molecules such as insertions, deletions, substitutions and the like. The presence of one or more perturbations in 191P4D12(b) gene products in the sample is an indication of cancer susceptibility (or the emergence or existence of a tumor).

[0411] The invention also comprises methods for gauging tumor aggressiveness. In one embodiment, a method for gauging aggressiveness of a tumor comprises determining the level of 191P4D12(b) mRNA or 191P4D12(b) protein expressed by tumor cells, comparing the level so determined to the level of 191P4D12(b) mRNA or 191P4D12(b) protein expressed in a corresponding normal tissue taken from the same individual or a normal tissue reference sample, wherein the degree of 191P4D12(b) mRNA or 191P4D12(b) protein expression in the tumor sample relative to the normal sample indicates the degree of aggressiveness. In a specific embodiment, aggressiveness of a tumor is evaluated by determining the extent to which 191P4D12(b) is expressed in the tumor cells, with higher expression levels indicating more aggressive tumors. Another embodiment is the evaluation of the integrity of 191P4D12(b) nucleotide and amino acid sequences in a biological sample, in order to identify perturbations in the structure of these molecules such as insertions, deletions, substitutions and the like. The presence of one or more perturbations indicates more aggressive tumors.

[0412] Another embodiment of the invention is directed to methods for observing the progression of a malignancy in an individual over time. In one embodiment, methods for observing the progression of a malignancy in an individual over time comprise determining the level of 191P4D12(b) mRNA or 191P4D12(b) protein expressed by cells in a sample of the tumor, comparing the level so determined to the level of 191P4D12(b) mRNA or 191P4D12(b) protein expressed in an equivalent tissue sample taken from the same individual at a different time, wherein the degree of 191P4D12(b) mRNA or 191P4D12(b) protein expression in the tumor sample over time provides information on the progression of the cancer. In a specific embodiment, the progression of a cancer is evaluated by determining 191P4D12(b) expression in the tumor cells over time, where increased expression overtime indicates a progression of the cancer. Also, one can evaluate the integrity 191P4D12(b) nucleotide and amino acid sequences in a biological sample in order to identify perturbations in the structure of these molecules such as insertions, deletions, substitutions and the like, where the presence of one or more perturbations indicates a progression of the cancer.

[0413] The above diagnostic approaches can be combined with any one of a wide variety of prognostic and diagnostic protocols known in the art. For example, another embodiment of the invention is directed to methods for observing a coincidence between the expression of 191P4D12(b) gene and 191P4D12(b) gene products (or perturbations in 191P4D12(b) gene and 191P4D12(b) gene products) and a factor that is associated with malignancy, as a means for diagnosing and prognosticating the status of a tissue sample. A wide variety of factors associated with malignancy can be utilized, such as the expression of genes associated with malignancy (e.g. PSA, PSCA and PSM expression for prostate cancer etc.) as well as gross cytological observations (see, e.g., Bocking et al, 1984, Anal. Quant. Cytol. 6(2):74-88; Epstein, 1995, Hum. Pathol. 26(2):223-9; Thorson et al., 1998, Mod. Pathol. 11(6):543-51; Baisden et al., 1999, Am. J. Surg. Pathol. 23(8):918-24). Methods for observing a coincidence between the expression of 191P4D12(b) gene and 191P4D12(b) gene products (or perturbations in 191P4D12(b) gene and 191P4D12(b) gene products) and another factor that is associated with malignancy are useful, for example, because the presence of a set of specific factors that coincide with disease provides information crucial for diagnosing and prognosticating the status of a tissue sample.

[0414] In one embodiment, methods for observing a coincidence between the expression of 191P4D12(b) gene and 191P4D12(b) gene products (or perturbations in 191P4D12(b) gene and 191P4D12(b) gene products) and another factor associated with malignancy entails detecting the overexpression of 191P4D12(b) mRNA or protein in a tissue sample, detecting the overexpression of PSA mRNA or protein in a tissue sample (or PSCA or PSM expression), and observing a coincidence of 191P4D12(b) mRNA or protein and PSA mRNA or protein overexpression (or PSCA or PSM expression). In a specific embodiment, the expression of 191P4D12(b) and PSA mRNA in prostate tissue is examined, where the coincidence of 191P4D12(b) and PSA mRNA overexpression in the sample indicates the existence of prostate cancer, prostate cancer susceptibility or the emergence or status of a prostate tumor.

[0415] Methods for detecting and quantifying the expression of 191P4D12(b) mRNA or protein are described herein, and standard nucleic acid and protein detection and quantification technologies are well known in the art. Standard methods for the detection and quantification of 191P4D12(b) mRNA include in situ hybridization using labeled 191P4D12(b) riboprobes, Northern blot and related techniques using 191P4D12(b) polynucleotide probes, RT-PCR analysis using primers specific for 191P4D12(b), and other amplification type detection methods, such as, for example, branched DNA, SISBA, TMA and the like. In a specific embodiment, semi-quantitative RT-PCR is used to detect and quantify 191P4D12(b) mRNA expression. Any number of primers capable of amplifying 191P4D12(b) can be used for this purpose, including but not limited to the various primer sets specifically described herein. In a specific embodiment, polyclonal or monoclonal antibodies specifically reactive with the wild-type 191P4D12(b) protein can be used in an immunohistochemical assay of biopsied tissue.

[0416] IX.) Identification of Molecules That Interact With 191P4D12(b)

[0417] The 191P4D12(b) protein and nucleic acid sequences disclosed herein allow a skilled artisan to identify proteins, small molecules and other agents that interact with 191P4D12(b), as well as pathways activated by 191P4D12(b) via any one of a variety of art accepted protocols. For example, one can utilize one of the so-called interaction trap systems (also referred to as the “two-hybrid assay”). In such systems, molecules interact and reconstitute a transcription factor which directs expression of a reporter gene, whereupon the expression of the reporter gene is assayed. Other systems identify protein-protein interactions in vivo through reconstitution of a eukaryotic transcriptional activator, see, e.g., U.S. Pat. Nos. 5,955,280 issued 21 Sep. 1999, 5,925,523 issued 20 Jul. 1999, 5,846,722 issued 8 Dec. 1998 and 6,004,746 issued 21 Dec. 1999. Algorithms are also available in the art for genome-based predictions of protein function (see, e.g., Marcotte, et al, Nature 402: 4 Nov. 1999, 83-86).

[0418] Alternatively one can screen peptide libraries to identify molecules that interact with 191P4D12(b) protein sequences. In such methods, peptides that bind to 191P4D12(b) are identified by screening libraries that encode a random or controlled collection of amino acids. Peptides encoded by the libraries are expressed as fusion proteins of bacteriophage coat proteins, the bacteriophage particles are then screened against the 191P4D12(b) protein(s).

[0419] Accordingly, peptides having a wide variety of uses, such as therapeutic, prognostic or diagnostic reagents, are thus identified without any prior information on the structure of the expected ligand or receptor molecule. Typical peptide libraries and screening methods that can be used to identify molecules that interact with 191P4D12(b) protein sequences are disclosed for example in U.S. Pat. Nos. 5,723,286 issued 3 Mar. 1998 and 5,733,731 issued 31 Mar. 1998.

[0420] Alternatively, cell lines that express 191P4D12(b) are used to identify protein-protein interactions mediated by 191P4D12(b). Such interactions can be examined using immunoprecipitation techniques (see, e.g., Hamilton B. J., et al. Biochem. Biophys. Res. Commun. 1999, 261:646-51). 191P4D12(b) protein can be immunoprecipitated from 191P4D12(b)-expressing cell lines using anti-191P4D12(b) antibodies. Alternatively, antibodies against His-tag can be used in a cell line engineered to express fusions of 191P4D12(b) and a His-tag (vectors mentioned above). The immunoprecipitated complex can be examined for protein association by procedures such as Western blotting, 35S-methionine labeling of proteins, protein microsequencing, silver staining and two-dimensional gel electrophoresis.

[0421] Small molecules and ligands that interact with 191P4D12(b) can be identified through related embodiments of such screening assays. For example, small molecules can be identified that interfere with protein function, including molecules that interfere with 191P4D12(b)'s ability to mediate phosphoryation and de-phosphorylation, interaction with DNA or RNA molecules as an indication of regulation of cell cycles, second messenger signaling or tumorigenesis. Similarly, small molecules that modulate 191P4D12(b)-related ion channel, protein pump, or cell communication functions are identified and used to treat patients that have a cancer that expresses 191P4D12(b) (see, e.g., Hille, B., Ionic Channels of Excitable Membranes 2nd Ed., Sinauer Assoc., Sunderland, Mass., 1992). Moreover, ligands that regulate 191P4D12(b) function can be identified based on their ability to bind 191P4D12(b) and activate a reporter construct. Typical methods are discussed for example in U.S. Pat. No. 5,928,868 issued 27 Jul. 1999, and include methods for forming hybrid ligands in which at least one ligand is a small molecule. In an illustrative embodiment, cells engineered to express a fusion protein of 191P4D12(b) and a DNA-binding protein are used to co-express a fusion protein of a hybrid ligand/small molecule and a cDNA library transcriptional activator protein. The cells further contain a reporter gene, the expression of which is conditioned on the proximity of the first and second fusion proteins to each other, an event that occurs only if the hybrid ligand binds to target sites on both hybrid proteins. Those cells that express the reporter gene are selected and the unknown small molecule or the unknown ligand is identified. This method provides a means of identifying modulators, which activate or inhibit 191P4D12(b).

[0422] An embodiment of this invention comprises a method of screening for a molecule that interacts with a 191P4D12(b) amino acid sequence shown in FIG. 2 or FIG. 3, comprising the steps of contacting a population of molecules with a 191P4D12(b) amino acid sequence, allowing the population of molecules and the 191P4D12(b) amino acid sequence to interact under conditions that facilitate an interaction, determining the presence of a molecule that interacts with the 191P4D12(b) amino acid sequence, and then separating molecules that do not interact with the 191P4D12(b) amino acid sequence from molecules that do. In a specific embodiment, the method further comprises purifying, characterizing and identifying a molecule that interacts with the 191P4D12(b) amino acid sequence. The identified molecule can be used to modulate a function performed by 191P4D12(b). In a preferred embodiment, the 191P4D12(b) amino acid sequence is contacted with a library of peptides.

[0423] X. Therapeutic Methods and Compositions

[0424] The identification of 191P4D12(b) as a protein that is normally expressed in a restricted set of tissues, but which is also expressed in cancers such as those listed in Table I, opens a number of therapeutic approaches to the treatment of such cancers.

[0425] Of note, targeted antitumor therapies have been useful even when the targeted protein is expressed on normal tissues, even vital normal organ tissues. A vital organ is one that is necessary to sustain life, such as the heart or colon. A non-vital organ is one that can be removed whereupon the individual is still able to survive. Examples of non-vital organs are ovary, breast, and prostate.

[0426] For example, Herceptin® is an FDA approved pharmaceutical that has as its active ingredient an antibody which is immunoreactive with the protein variously known as HER2, HER2/neu, and erb-b-2. It is marketed by Genentech and has been a commercially successful antitumor agent. Herceptin sales reached almost $400 million in 2002. Herceptin is a treatment for HER2 positive metastatic breast cancer. However, the expression of HER2 is not limited to such tumors. The same protein is expressed in a number of normal tissues. In particular, it is known that HER2/neu is present in normal kidney and heart, thus these tissues are present in all human recipients of Herceptin. The presence of HER2/neu in normal kidney is also confirmed by Latif, Z., et al., B.J.U. International (2002) 89:5-9. As shown in this article (which evaluated whether renal cell carcinoma should be a preferred indication for anti-HER2 antibodies such as Herceptin) both protein and mRNA are produced in benign renal tissues. Notably, HER2/neu protein was strongly overexpressed in benign renal tissue. Despite the fact that HER2/neu is expressed in such vital tissues as heart and kidney, Herceptin is a very useful, FDA approved, and commercially successful drug. The effect of Herceptin on cardiac tissue, i.e., “cardiotoxicity,” has merely been a side effect to treatment. When patients were treated with Herceptin alone, significant cardiotoxicity occurred in a very low percentage of patients.

[0427] Of particular note, although kidney tissue is indicated to exhibit normal expression, possibly even higher expression than cardiac tissue, kidney has no appreciable Herceptin side effect whatsoever. Moreover, of the diverse array of normal tissues in which HER2 is expressed, there is very little occurrence of any side effect. Only cardiac tissue has manifested any appreciable side effect at all. A tissue such as kidney, where HER2/neu expression is especially notable, has not been the basis for any side effect.

[0428] Furthermore, favorable therapeutic effects have been found for anti tumor therapies that target epidermal growth factor receptor (EGFR). EGFR is also expressed in numerous normal tissues. There have been very limited side effects in normal tissues following use of anti-EGFR therapeutics.

[0429] Thus, expression of a target protein in normal tissue, even vital normal tissue, does not defeat the utility of a targeting agent for the protein as a therapeutic for certain tumors in which the protein is also overexpressed.

[0430] Accordingly, therapeutic approaches that inhibit the activity of a 191P4D12(b) protein are useful for patients suffering from a cancer that expresses 191P4D12(b). These therapeutic approaches generally fall into two classes. One class comprises various methods for inhibiting the binding or association of a 191P4D12(b) protein with its binding partner or with other proteins. Another class comprises a variety of methods for inhibiting the transcription of a 191P4D12(b) gene or translation of 191P4D12(b) mRNA.

[0431] X.A.) Anti-Cancer Vaccines

[0432] The invention provides cancer vaccines comprising a 191P4D12(b)-related protein or 191P4D12(b)-related nucleic acid. In view of the expression of 191P4D12(b), cancer vaccines prevent and/or treat 191P4D12(b)-expressing cancers with minimal or no effects on non-target tissues. The use of a tumor antigen in a vaccine that generates humoral and/or cell-mediated immune responses as anti-cancer therapy is well known in the art and has been employed in prostate cancer using human PSMA and rodent PAP immunogens (Hodge et al., 1995, Int. J. Cancer 63:231-237; Fong et al., 1997, J. Immunol. 159:3113-3117).

[0433] Such methods can be readily practiced by employing a 191P4D12(b)-related protein, or a 191P4D12(b)-encoding nucleic acid molecule and recombinant vectors capable of expressing and presenting the 191P4D12(b) immunogen (which typically comprises a number of antibody or T cell epitopes). Skilled artisans understand that a wide variety of vaccine systems for delivery of immunoreactive epitopes are known in the art (see, e.g., Heryln et al., Ann Med 1999 Feb 31(1):66-78; Maruyama et al., Cancer Immunol Immunother 2000 Jun 49(3):123-32) Briefly, such methods of generating an immune response (e.g. humoral and/or cell-mediated) in a mammal, comprise the steps of: exposing the mammal's immune system to an immunoreactive epitope (e.g. an epitope present in a 191P4D12(b) protein shown in FIG. 3 or analog or homolog thereof) so that the mammal generates an immune response that is specific for that epitope (e.g. generates antibodies that specifically recognize that epitope). In a preferred method, a 191P4D12(b) immunogen contains a biological motif, see e.g., Tables VIII-XXI and XXII-XLIX, or a peptide of a size range from 191P4D12(b) indicated in FIG. 5, FIG. 6, FIG. 7, FIG. 8, and FIG. 9.

[0434] The entire 191P4D12(b) protein, immunogenic regions or epitopes thereof can be combined and delivered by various means. Such vaccine compositions can include, for example, lipopeptides (e.g., Vitiello, A. et al., J. Clin. Invest. 95:341, 1995), peptide compositions encapsulated in poly(DL-lactide-co-glycolide) (“PLG”) microspheres (see, e.g., Eldridge, et al., Molec. Immunol. 28:287-294, 1991: Alonso et al., Vaccine 12:299-306, 1994; Jones et al., Vaccine 13:675-681, 1995), peptide compositions contained in immune stimulating complexes (ISCOMS) (see, e.g., Takahashi et al., Nature 344:873-875,1990; Hu et al., Clin Exp Immunol. 113:235-243,1998), multiple antigen peptide systems (MAPs) (see e.g., Tam, J. P., Proc. Natl. Acad. Sci. U.S.A. 85:5409-5413, 1988; Tam, J. P., J. Immunol. Methods 196:17-32, 1996), peptides formulated as multivalent peptides; peptides for use in ballistic delivery systems, typically crystallized peptides, viral delivery vectors (Perkus, M. E. et al., In: Concepts in vaccine development, Kaufmann, S. H. E., ed., p. 379, 1996; Chakrabarti, S. et al., Nature 320:535, 1986; Hu, S. L. et al., Nature 320:537, 1986; Kieny, M.-P. et al., AIDS Bio/Technology 4:790, 1986; Top, F. H. et al., J. Infect. Dis. 124:148, 1971; Chanda, P. K. et al., Virology 175:535, 1990), particles of viral or synthetic origin (e.g., Kofler, N. et al., J. Immunol. Methods. 192:25, 1996; Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993; Falo, L. D., Jr. et al., Nature Med. 7:649,1995), adjuvants (Warren, H. S., Vogel, F. R., and Chedid, L. A. Annu. Rev. Immunol. 4:369,1986; Gupta, R. K. et al., Vaccine 11:293, 1993), liposomes (Reddy, R. et al., J. Immunol. 148:1585, 1992; Rock, K. L., Immunol. Today 17:131, 1996), or, naked or particle absorbed cDNA (Ulmer, J. B. et al., Science 259:1745, 1993; Robinson, H. L., Hunt, L. A., and Webster, R. G., Vaccine 11:957, 1993; Shiver, J. W. et al., In: Concepts in vaccine development, Kaufmann, S. H. E., ed., p. 423, 1996;, Cease, K. B., and Berzofsky, J. A., Annu. Rev. Immunol. 12:923, 1994 and Eldridge, J. H. et al., Sem. Hematol. 30:16, 1993). Toxin-targeted delivery technologies, also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Mass.) may also be used.

[0435] In patients with 191P4D12(b)-associated cancer, the vaccine compositions of the invention can also be used in conjunction with other treatments used for cancer, e.g., surgery, chemotherapy, drug therapies, radiation therapies, etc. including use in combination with immune adjuvants such as IL-2, IL-12, GM-CSF, and the like.

[0436] Cellular Vaccines:

[0437] CTL epitopes can be determined using specific algorithms to identify peptides within 191P4D12(b) protein that bind corresponding HLA alleles (see e.g., Table IV; Epimer™ and Epimatrix™, Brown University (URL brown.edu/Research/TB-HIV_Lab/epimatrix/epimatrix.html); and, BIMAS, (URL bimas.dcrt.nih.gov/; SYFPEITHI at URL syfpeithi.bmi-heidelberg.com/). In a preferred embodiment, a 191P4D12(b) immunogen contains one or more amino acid sequences identified using techniques well known in the art, such as the sequences shown in Tables VIII-XXI and XXII-XLIX or a peptide of 8, 9, 10 or 11 amino acids specified by an HLA Class I motif/supermotif (e.g., Table IV (A), Table IV (D), or Table IV (E)) and/or a peptide of at least 9 amino acids that comprises an HLA Class II motif/supermotif (e.g., Table IV (B) or Table IV (C)). As is appreciated in the art, the HLA Class I binding groove is essentially closed ended so that peptides of only a particular size range can fit into the groove and be bound, generally HLA Class I epitopes are 8, 9, 10, or 11 amino acids long. In contrast, the HLA Class II binding groove is essentially open ended; therefore a peptide of about 9 or more amino acids can be bound by an HLA Class II molecule. Due to the binding groove differences between HLA Class I and II, HLA Class I motifs are length specific, i.e., position two of a Class I motif is the second amino acid in an amino to carboxyl direction of the peptide. The amino acid positions in a Class II motif are relative only to each other, not the overall peptide, i.e., additional amino acids can be attached to the amino and/or carboxyl termini of a motif-bearing sequence. HLA Class II epitopes are often 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, or 25 amino acids long, or longer than 25 amino acids.

[0438] Antibody-based Vaccines

[0439] A wide variety of methods for generating an immune response in a mammal are known in the art (for example as the first step in the generation of hybridomas). Methods of generating an immune response in a mammal comprise exposing the mammal's immune system to an immunogenic epitope on a protein (e.g. a 191P4D12(b) protein) so that an immune response is generated. A typical embodiment consists of a method for generating an immune response to 191P4D12(b) in a thereof; and at least one periodic interval thereafter re-contacting the host with the 191P4D12(b) B cell or cytotoxic T-cell epitope or analog thereof. A specific embodiment consists of a method of generating an immune response against a 191P4D12(b)-related protein or a man-made multiepitopic peptide comprising: administering 191P4D12(b) immunogen (e.g. a 191P4D12(b) protein or a peptide fragment thereof, a 191P4D12(b) fusion protein or analog etc.) in a vaccine preparation to a human or another mammal. Typically, such vaccine preparations further contain a suitable adjuvant (see, e.g., U.S. Pat. No. 6,146,635) or a universal helper epitope such as a PADRE™ peptide (Epimmune Inc., San Diego, Calif.; see, e.g., Alexander et al., J. Immunol. 2000 164(3); 164(3): 1625-1633; Alexander et al., Immunity 1994 1(9): 751-761 and Alexander et al., Immunol. Res. 1998 18(2): 79-92). An alternative method comprises generating an immune response in an individual against a 191P4D12(b) immunogen by: administering in vivo to muscle or skin of the individual's body a DNA molecule that comprises a DNA sequence that encodes a 191P4D12(b) immunogen, the DNA sequence operatively linked to regulatory sequences which control the expression of the DNA sequence; wherein the DNA molecule is taken up by cells, the DNA sequence is expressed in the cells and an immune response is generated against the immunogen (see, e.g., U.S. Pat. No. 5,962,428). Optionally a genetic vaccine facilitator such as anionic lipids; saponins; lectins; estrogenic compounds; hydroxylated lower alkyls; dimethyl sulfoxide; and urea is also administered. In addition, an antiidiotypic antibody can be administered that mimics 191P4D12(b), in order to generate a response to the target antigen.

[0440] Nucleic Acid Vaccines:

[0441] Vaccine compositions of the invention include nucleic acid-mediated modalities. DNA or RNA that encode protein(s) of the invention can be administered to a patient. Genetic immunization methods can be employed to generate prophylactic or therapeutic humoral and cellular immune responses directed against cancer cells expressing 191P4D12(b). Constructs comprising DNA encoding a 191P4D12(b)-related protein/immunogen and appropriate regulatory sequences can be injected directly into muscle or skin of an individual, such that the cells of the muscle or skin take-up the construct and express the encoded 191P4D12(b) protein/immunogen. Alternatively, a vaccine comprises a 191P4D12(b)-related protein. Expression of the 191P4D12(b)-related protein immunogen results in the generation of prophylactic or therapeutic humoral and cellular immunity against cells that bear a 191P4D12(b) protein. Various prophylactic and therapeutic genetic immunization techniques known in the art can be used (for review, see information and references published at Internet address genweb.com). Nucleic acid-based delivery is described, for instance, in Wolff et. al., Science 247:1465 (1990) as well as U.S. Pat. Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118; 5,736,524; 5,679,647; WO 98/04720. Examples of DNA-based delivery technologies include “naked DNA”, facilitated (bupivicaine, polymers, peptide-mediated) delivery, cationic lipid complexes, and particle-mediated (“gene gun”) or pressure-mediated delivery (see, e.g., U.S. Pat. No. 5,922,687).

[0442] For therapeutic or prophylactic immunization purposes, proteins of the invention can be expressed via viral or bacterial vectors. Various viral gene delivery systems that can be used in the practice of the invention include, but are not limited to, vaccinia, fowlpox, canarypox, adenovirus, influenza, poliovirus, adeno-associated virus, lenfivirus, and sindbis virus (see, e.g., Restifo, 1996, Curr. Opin. Immunol. 8:658-663; Tsang et al. J. Natl. Cancer Inst. 87:982-990 (1995)). Non-viral delivery systems can also be employed by introducing naked DNA encoding a 191P4D12(b)-related protein into the patient (e.g., intramuscularly or intradermally) to induce an anti-tumor response.

[0443] Vaccinia virus is used, for example, as a vector to express nucleotide sequences that encode the peptides of the invention. Upon introduction into a host, the recombinant vaccinia virus expresses the protein immunogenic peptide, and thereby elicits a host immune response. Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Pat. No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al., Nature 351:456-460 (1991). A wide variety of other vectors useful for therapeutic administration or immunization of the peptides of the invention, e.g. adeno and adeno-associated virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the like, will be apparent to those skilled in the art from the description herein.

[0444] Thus, gene delivery systems are used to deliver a 191P4D12(b)-related nucleic acid molecule. In one embodiment, the full-length human 191P4D12(b) cDNA is employed. In another embodiment, 191P4D12(b) nucleic acid molecules encoding specific cytotoxic T lymphocyte (CTL) and/or antibody epitopes are employed.

[0445] Ex Vivo Vaccines

[0446] Various ex vivo strategies can also be employed to generate an immune response. One approach involves the use of antigen presenting cells (APCs) such as dendritic cells (DC) to present 191P4D12(b) antigen to a patient's immune system. Dendritic cells express MHC class I and II molecules, B7 co-stimulator, and IL-12, and are thus highly specialized antigen presenting cells. In prostate cancer, autologous dendritic cells pulsed with peptides of the prostate-specific membrane antigen (PSMA) are being used in a Phase I clinical trial to stimulate prostate cancer patients' immune systems (Tjoa et al., 1996, Prostate 28:65-69; Murphy et al., 1996, Prostate 29:371-380). Thus, dendritic cells can be used to present 191P4D12(b) peptides to T cells in the context of MHC class I or II molecules. In one embodiment, autologous dendritic cells are pulsed with 191P4D12(b) peptides capable of binding to MHC class I and/or class II molecules. In another embodiment, dendritic cells are pulsed with the complete 191P4D12(b) protein. Yet another embodiment involves engineering the overexpression of a 191P4D12(b) gene in dendritic cells using various implementing vectors known in the art, such as adenovirus (Arthur et al., 1997, Cancer Gene Ther. 4:17-25), retrovirus (Henderson et al., 1996, Cancer Res. 56:3763-3770), lentivirus, adeno-associated virus, DNA transfection (Ribas et al., 1997, Cancer Res. 57:2865-2869), or tumor-derived RNA transfection (Ashley et al., 1997, J. Exp. Med. 186:1177-1182). Cells that express 191P4D12(b) can also be engineered to express immune modulators, such as GM-CSF, and used as immunizing agents.

[0447] X.B.) 191P4D12(b) as a Target for Antibody-based Therapy

[0448] 191P4D12(b) is an attractive target for antibody-based therapeutic strategies. A number of antibody strategies are known in the art for targeting both extracellular and intracellular molecules (see, e.g., complement and ADCC mediated killing as well as the use of intrabodies). Because 191P4D12(b) is expressed by cancer cells of various lineages relative to corresponding normal cells, systemic administration of 191P4D12(b)-immunoreactive compositions are prepared that exhibit excellent sensitivity without toxic, non-specific and/or non-target effects caused by binding of the immunoreactive composition to non-target organs and tissues. Antibodies specifically reactive with domains of 191P4D12(b) are useful to treat 191P4D12(b)-expressing cancers systemically, either as conjugates with a toxin or therapeutic agent, or as naked antibodies capable of inhibiting cell proliferation or function.

[0449] 191P4D12(b) antibodies can be introduced into a patient such that the antibody binds to 191P4D12(b) and modulates a function, such as an interaction with a binding partner, and consequently mediates destruction of the tumor cells and/or inhibits the growth of the tumor cells. Mechanisms by which such antibodies exert a therapeutic effect can include complement-mediated cytolysis, antibody-dependent cellular cytotoxicity, modulation of the physiological function of 191P4D12(b), inhibition of ligand binding or signal transduction pathways, modulation of tumor cell differentiation, alteration of tumor angiogenesis factor profiles, and/or apoptosis.

[0450] Those skilled in the art understand that antibodies can be used to specifically target and bind immunogenic molecules such as an immunogenic region of a 191P4D12(b) sequence shown in FIG. 2 or FIG. 3. In addition, skilled artisans understand that it is routine to conjugate antibodies to cytotoxic agents (see, e.g., Slevers et al. Blood 93:11 3678-3684 (Jun. 1, 1999)). When cytotoxic and/or therapeutic agents are delivered directly to cells, such as by conjugating them to antibodies specific for a molecule expressed by that cell (e.g. 191P4D12(b)), the cytotoxic agent will exert its known biological effect (i.e. cytotoxicity) on those cells.

[0451] A wide variety of compositions and methods for using antibody-cytotoxic agent conjugates to kill cells are known in the art. In the context of cancers, typical methods entail administering to an animal having a tumor a biologically effective amount of a conjugate comprising a selected cytotoxic and/or therapeutic agent linked to a targeting agent (e.g. an anti-191P4D12(b) antibody) that binds to a marker (e.g. 191P4D12(b)) expressed, accessible to binding or localized on the cell surfaces. A typical embodiment is a method of delivering a cytotoxic and/or therapeutic agent to a cell expressing 191P4D12(b), comprising conjugating the cytotoxic agent to an antibody that immunospecifically binds to a 191P4D12(b) epitope, and, exposing the cell to the antibody-agent conjugate. Another illustrative embodiment is a method of treating an individual suspected of suffering from metastasized cancer, comprising a step of administering parenterally to said individual a pharmaceutical composition comprising a therapeutically effective amount of an antibody conjugated to a cytotoxic and/or therapeutic agent.

[0452] Cancer immunotherapy using anti-191P4D12(b) antibodies can be done in accordance with various approaches that have been successfully employed in the treatment of other types of cancer, including but not limited to colon cancer (Arlen et al., 1998, Crit. Rev. Immunol. 18:133-138), multiple myeloma (Ozaki et al., 1997, Blood 90:3179-3186, Tsunenari et al., 1997, Blood 90:2437-2444), gastric cancer (Kasprzyk et al., 1992, Cancer Res. 52:2771-2776), B-cell lymphoma (Funakoshi et al., 1996, J. Immunother. Emphasis Tumor Immunol. 19:93-101), leukemia (Zhong et al., 1996, Leuk. Res. 20:581-589), colorectal cancer (Moun et al., 1994, Cancer Res. 54:6160-6166; Velders et al., 1995, Cancer Res. 55:4398-4403), and breast cancer (Shepard et al., 1991, J. Clin. Immunol. 11:117-127). Some therapeutic approaches involve conjugation of naked antibody to a toxin or radioisotope, such as the conjugation of Y91 or I131 to anti-CD20 antibodies (e.g., Zevalin™, IDEC Pharmaceuticals Corp. or Bexxar™, Coulter Pharmaceuticals), while others involve co-administration of antibodies and other therapeutic agents, such as Herceptin™ (trastuzumab) with paclitaxel (Genentech, Inc.). The antibodies can be conjugated to a therapeutic agent. To treat prostate cancer, for example, 191P4D12(b) antibodies can be administered in conjunction with radiation, chemotherapy or hormone ablation. Also, antibodies can be conjugated to a toxin such as calicheamicin (e.g., Mylotarg™, Wyeth-Ayerst, Madison, N.J., a recombinant humanized lgG4 kappa antibody conjugated to antitumor antibiotic calicheamicin) or a maytansinoid (e.g., taxane-based Tumor-Activated Prodrug, TAP, platform, ImmunoGen, Cambridge, Mass., also see e.g., U.S. Pat. No. 5,416,064).

[0453] Although 191P4D12(b) antibody therapy is useful for all stages of cancer, antibody therapy can be particularly appropriate in advanced or metastatic cancers. Treatment with the antibody therapy of the invention is indicated for patients who have received one or more rounds of chemotherapy. Alternatively, antibody therapy of the invention is combined with a chemotherapeutic or radiation regimen for patients who have not received chemotherapeutic treatment. Additionally, antibody therapy can enable the use of reduced dosages of concomitant chemotherapy, particularly for patients who do not tolerate the toxicity of the chemotherapeutic agent very well. Fan et al. (Cancer Res. 53:4637-4642, 1993), Prewett et al. (International J. of Onco. 9:217-224, 1996), and Hancock et al. (Cancer Res. 51:4575-4580, 1991) describe the use of various antibodies together with chemotherapeutic agents.

[0454] Although 191P4D12(b) antibody therapy is useful for all stages of cancer, antibody therapy can be particularly appropriate in advanced or metastatic cancers. Treatment with the antibody therapy of the invention is indicated for patients who have received one or more rounds of chemotherapy. Alternatively, antibody therapy of the invention is combined with a chemotherapeutic or radiation regimen for patients who have not received chemotherapeutic treatment. Additionally, antibody therapy can enable the use of reduced dosages of concomitant chemotherapy, particularly for patients who do not tolerate the toxicity of the chemotherapeutic agent very well.

[0455] Cancer patients can be evaluated for the presence and level of 191P4D12(b) expression, preferably using immunohistochemical assessments of tumor tissue, quantitative 191P4D12(b) imaging, or other techniques that reliably indicate the presence and degree of 191P4D12(b) expression. Immunohistochemical analysis of tumor biopsies or surgical specimens is preferred for this purpose. Methods for immunohistochemical analysis of tumor tissues are well known in the art.

[0456] Anti-191P4D12(b) monoclonal antibodies that treat prostate and other cancers include those that initiate a potent immune response against the tumor or those that are directly cytotoxic. In this regard, anti-191P4D12(b) monoclonal antibodies (mAbs) can elicit tumor cell lysis by either complement-mediated or antibody-dependent cell cytotoxicity (ADCC) mechanisms, both of which require an intact Fc portion of the immunoglobulin molecule for interaction with effector cell Fc receptor sites on complement proteins. In addition, anti-191P4D12(b) mAbs that exert a direct biological effect on tumor growth are useful to treat cancers that express 191P4D12(b). Mechanisms by which directly cytotoxic mAbs act include: inhibition of cell growth, modulation of cellular differentiation, modulation of tumor angiogenesis factor profiles, and the induction of apoptosis. The mechanism(s) by which a particular anti-191P4D12(b) mAb exerts an anti-tumor effect is evaluated using any number of in vitro assays that evaluate cell death such as ADCC, ADMMC, complement-mediated cell lysis, and so forth, as is generally known in the art.

[0457] In some patients, the use of murine or other non-human monoclonal antibodies, or human/mouse chimeric mAbs can induce moderate to strong immune responses against the non-human antibody. This can result in clearance of the antibody from circulation and reduced efficacy. In the most severe cases, such an immune response can lead to the extensive formation of immune complexes which, potentially, can cause renal failure. Accordingly, preferred monoclonal antibodies used in the therapeutic methods of the invention are those that are either fully human or humanized and that bind specifically to the target 191P4D12(b) antigen with high affinity but exhibit low or no antigenicity in the patient.

[0458] Therapeutic methods of the invention contemplate the administration of single anti-191P4D12(b) mAbs as well as combinations, or cocktails, of different mAbs. Such mAb cocktails can have certain advantages inasmuch as they contain mAbs that target different epitopes, exploit different effector mechanisms or combine directly cytotoxic mAbs with mAbs that rely on immune effector functionality. Such mAbs in combination can exhibit synergistic therapeutic effects, In addition, anti-191P4D12(b) mAbs can be administered concomitantly with other therapeutic modalities, including but not limited to various chemotherapeutic agents, androgen-blockers, immune modulators (e.g., IL-2, GM-CSF), surgery or radiation. The anti-191P4D12(b) mAbs are administered in their “naked” or unconjugated form, or can have a therapeutic agent(s) conjugated to them.

[0459] Anti-191P4D12(b) antibody formulations are administered via any route capable of delivering the antibodies to a tumor cell. Routes of administration include, but are not limited to, intravenous, intraperitoneal, intramuscular, intratumor, intradermal, and the like. Treatment generally involves repeated administration of the anti-191P4D12(b) antibody preparation, via an acceptable route of administration such as intravenous injection (IV), typically at a dose in the range of about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, or 25 mg/kg body weight. In general, doses in the range of 10-1000 mg mAb per week are effective and well tolerated.

[0460] Based on clinical experience with the Herceptin™ mAb in the treatment of metastatic breast cancer, an initial loading dose of approximately 4 mg/kg patient body weight IV, followed by weekly doses of about 2 mg/kg IV of the anti-191P4D12(b) mAb preparation represents an acceptable dosing regimen. Preferably, the initial loading dose is administered as a 90-minute or longer infusion. The periodic maintenance dose is administered as a 30 minute or longer infusion, provided the initial dose was well tolerated. As appreciated by those of skill in the art, various factors can influence the ideal dose regimen in a particular case. Such factors include, for example, the binding affinity and half life of the Ab or mAbs used, the degree of 191P4D12(b) expression in the patient, the extent of circulating shed 191P4D12(b) antigen, the desired steady-state antibody concentration level, frequency of treatment, and the influence of chemotherapeutic or other agents used in combination with the treatment method of the invention, as well as the health status of a particular patient.

[0461] Optionally, patients should be evaluated for the levels of 191P4D12(b) in a given sample (e.g. the levels of circulating 191P4D12(b) antigen and/or 191P4D12(b) expressing cells) in order to assist in the determination of the most effective dosing regimen, etc. Such evaluations are also used for monitoring purposes throughout therapy, and are useful to gauge therapeutic success in combination with the evaluation of other parameters (for example, urine cytology and/or ImmunoCyt levels in bladder cancer therapy, or by analogy, serum PSA levels in prostate cancer therapy).

[0462] Anti-idiotypic anti-191P4D12(b) antibodies can also be used in anti-cancer therapy as a vaccine for inducing an immune response to cells expressing a 191P4D12(b)-related protein. In particular, the generation of anti-idiotypic antibodies is well known in the art; this methodology can readily be adapted to generate anti-idiotypic anti-191P4D12(b) antibodies that mimic an epitope on a 191P4D12(b)-related protein (see, for example, Wagner et al., 1997, Hybridomal16: 33-40; Foon et al., 1995, J. Clin. Invest. 96:334-342;, Herlyn et al., 1996, Cancer Immunol. Immunother. 43:65-76). Such an anti-idiotypic antibody can be used in cancer vaccine strategies.

[0463] X.C.) 191P4D12(b) as a Target for Cellular Immune Responses

[0464] Vaccines and methods of preparing vaccines that contain an immunogenically effective amount of one or more HLA-binding peptides as described herein are further embodiments of the invention. Furthermore, vaccines in accordance with the invention encompass compositions of one or more of the claimed peptides. A peptide can be present in a vaccine individually. Alternatively, the peptide can exist as a homopolymer comprising multiple copies of the same peptide, or as a heteropolymer of various peptides. Polymers have the advantage of increased immunological reaction and, where different peptide epitopes are used to make up the polymer, the additional ability to induce antibodies and/or CTLs that react with different antigenic determinants of the pathogenic organism or tumor-related peptide targeted for an immune response. The composition can be a naturally occurring region of an antigen or can be prepared, e.g., recombinantly or by chemical synthesis.

[0465] Carriers that can be used with vaccines of the invention are well known in the art, and include, e.g., thyroglobulin, albumins such as human serum albumin, tetanus toxoid, polyamino acids such as poly L-lysine, poly L-glutamic acid, influenza, hepatitis B virus core protein, and the like. The vaccines can contain a physiologically tolerable (i.e., acceptable) diluent such as water, or saline, preferably phosphate buffered saline. The vaccines also typically include an adjuvant. Adjuvants such as incomplete Freund's adjuvant, aluminum phosphate, aluminum hydroxide, or alum are examples of materials well known in the art. Additionally, as disclosed herein, CTL responses can be primed by conjugating peptides of the invention to lipids, such as tripalmitoyl-S-glycerylcysteinlyseryl-serine (P3CSS). Moreover, an adjuvant such as a synthetic cytosine-phosphorothiolated-guanine-containing (CpG) oligonucleotides has been found to increase CTL responses 10- to 100-fold. (see, e.g. Davila and Celis, J. Immunol. 165:539-547 (2000))

[0466] Upon immunization with a peptide composition in accordance with the invention, via injection, aerosol, oral, transdermal, transmucosal, intrapleural, intrathecal, or other suitable routes, the immune system of the host responds to the vaccine by producing large amounts of CTLs and/or HTLs specific for the desired antigen. Consequently, the host becomes at least partially immune to later development of cells that express or overexpress 191P4D12(b) antigen, or derives at least some therapeutic benefit when the antigen was tumor-associated.

[0467] In some embodiments, it may be desirable to combine the class I peptide components with components that induce or facilitate neutralizing antibody and or helper T cell responses directed to the target antigen. A preferred embodiment of such a composition comprises class I and class II epitopes in accordance with the invention. An alternative embodiment of such a composition comprises a class I and/or class II epitope in accordance with the invention, along with a cross reactive HTL epitope such as PADRE™ (Epimmune, San Diego, Calif.) molecule (described e.g., in U.S. Pat. No. 5,736,142).

[0468] A vaccine of the invention can also include antigen-presenting cells (APC), such as dendritic cells (DC), as a vehicle to present peptides of the invention. Vaccine compositions can be created in vitro, following dendritic cell mobilization and harvesting, whereby loading of dendritic cells occurs in vitro. For example, dendritic cells are transfected, e.g., with a minigene in accordance with the invention, or are pulsed with peptides. The dendritic cell can then be administered to a patient to elicit immune responses in vivo. Vaccine compositions, either DNA- or peptide-based, can also be administered in vivo in combination with dendritic cell mobilization whereby loading of dendritic cells occurs in vivo.

[0469] Preferably, the following principles are utilized when selecting an array of epitopes for inclusion in a polyepitopic composition for use in a vaccine, or for selecting discrete epitopes to be included in a vaccine and/or to be encoded by nucleic acids such as a minigene. It is preferred that each of the following principles be balanced in order to make the selection. The multiple epitopes to be incorporated in a given vaccine composition may be, but need not be, contiguous in sequence in the native antigen from which the epitopes are derived.

[0470] 1.) Epitopes are selected which, upon administration, mimic immune responses that have been observed to be correlated with tumor clearance. For HLA Class I this includes 3-4 epitopes that come from at least one tumor associated antigen (TAA). For HLA Class II a similar rationale is employed; again 3-4 epitopes are selected from at least one TAA (see, e.g., Rosenberg et al., Science 278:1447-1450). Epitopes from one TAA may be used in combination with epitopes from one or more additional TAAs to produce a vaccine that targets tumors with varying expression patterns of frequently-expressed TAAs.

[0471] 2.) Epitopes are selected that have the requisite binding affinity established to be correlated with immunogenicity: for HLA Class I an IC50 of 500 nM or less, often 200 nM or less; and for Class II an IC50 of 1000 nM or less.

[0472] 3.) Sufficient supermotif bearing-peptides, or a sufficient array of allele-specific motif-bearing peptides, are selected to give broad population coverage. For example, it is preferable to have at least 80% population coverage. A Monte Carlo analysis, a statistical evaluation known in the art, can be employed to assess the breadth, or redundancy of, population coverage.

[0473] 4.) When selecting epitopes from cancer-related antigens it is often useful to select analogs because the patient may have developed tolerance to the native epitope.

[0474] 5.) Of particular relevance are epitopes referred to as “nested epitopes.” Nested epitopes occur where at least two epitopes overlap in a given peptide sequence. A nested peptide sequence can comprise B cell, HLA class I and/or HLA class II epitopes. When providing nested epitopes, a general objective is to provide the greatest number of epitopes per sequence. Thus, an aspect is to avoid providing a peptide that is any longer than the amino terminus of the amino terminal epitope and the carboxyl terminus of the carboxyl terminal epitope in the peptide. When providing a multi-epitopic sequence, such as a sequence comprising nested epitopes, it is generally important to screen the sequence in order to insure that it does not have pathological or other deleterious biological properties.

[0475] 6.) If a polyepitopic protein is created, or when creating a minigene, an objective is to generate the smallest peptide that encompasses the epitopes of interest. This principle is similar, if not the same as that employed when selecting a peptide comprising nested epitopes. However, with an artificial polyepitopic peptide, the size minimization objective is balanced against the need to integrate any spacer sequences between epitopes in the polyepitopic protein. Spacer amino acid residues can, for example, be introduced to avoid junctional epitopes (an epitope recognized by the immune system, not present in the target antigen, and only created by the man-made juxtaposition of epitopes), or to facilitate cleavage between epitopes and thereby enhance epitope presentation. Junctional epitopes are generally to be avoided because the recipient may generate an immune response to that non-native epitope. Of particular concern is a junctional epitope that is a “dominant epitope.” A dominant epitope may lead to such a zealous response that immune responses to other epitopes are diminished or suppressed.

[0476] 7.) Where the sequences of multiple variants of the same target protein are present, potential peptide epitopes can also be selected on the basis of their conservancy. For example, a criterion for conservancy may define that the entire sequence of an HLA class I binding peptide or the entire 9-mer core of a class II binding peptide be conserved in a designated percentage of the sequences evaluated for a specific protein antigen.

[0477] X.C.1. Minigene Vaccines

[0478] A number of different approaches are available which allow simultaneous delivery of multiple epitopes. Nucleic acids encoding the peptides of the invention are a particularly useful embodiment of the invention. Epitopes for inclusion in a minigene are preferably selected according to the guidelines set forth in the previous section. A preferred means of administering nucleic acids encoding the peptides of the invention uses minigene constructs encoding a peptide comprising one or multiple epitopes of the invention.

[0479] The use of multi-epitope minigenes is described below and in, Ishioka et al., J. Immunol. 162:3915-3925, 1999; An, L. and Whitton, J. L., J. Virol. 71:2292, 1997; Thomson, S. A. et al., J. Immunol. 157:822, 1996; Whitton, J. L. et al., J. Virol. 67:348, 1993; Hanke, R. et al., Vaccine 16:426, 1998. For example, a multi-epitope DNA plasmid encoding supermotif- and/or motif-bearing epitopes derived 191P4D12(b), the PADRE® universal helper T cell epitope or multiple HTL epitopes from 191P4D12(b) (see e.g., Tables VIII-XXI and XXII to XLIX), and an endoplasmic reticulum-translocating signal sequence can be engineered. A vaccine may also comprise epitopes that are derived from other TAAs.

[0480] The immunogenicity of a multi-epitopic minigene can be confirmed in transgenic mice to evaluate the magnitude of CTL induction responses against the epitopes tested. Further, the immunogenicity of DNA-encoded epitopes in vivo can be correlated with the in vitro responses of specific CTL lines against target cells transfected with the DNA plasmid. Thus, these experiments can show that the minigene serves to both: 1.) generate a CTL response and 2.) that the induced CTLs recognized cells expressing the encoded epitopes.

[0481] For example, to create a DNA sequence encoding the selected epitopes (minigene) for expression in human cells, the amino acid sequences of the epitopes may be reverse translated. A human codon usage table can be used to guide the codon choice for each amino acid. These epitope-encoding DNA sequences may be directly adjoined, so that when translated, a continuous polypeptide sequence is created. To optimize expression and/or immunogenicity, additional elements can be incorporated into the minigene design. Examples of amino acid sequences that can be reverse translated and included in the minigene sequence include: HLA class I epitopes, HLA class II epitopes, antibody epitopes, a ubiquitination signal sequence, and/or an endoplasmic reticulum targeting signal. In addition, HLA presentation of CTL and HTL epitopes may be improved by including synthetic (e.g. poly-alanine) or naturally-occurring flanking sequences adjacent to the CTL or HTL epitopes; these larger peptides comprising the epitope(s) are within the scope of the invention.

[0482] The minigene sequence may be converted to DNA by assembling oligonucleotides that encode the plus and minus strands of the minigene. Overlapping oligonucleotides (30-100 bases long) may be synthesized, phosphorylated, purified and annealed under appropriate conditions using well known techniques. The ends of the oligonucleotides can be joined, for example, using T4 DNA ligase. This synthetic minigene, encoding the epitope polypeptide, can then be cloned into a desired expression vector.

[0483] Standard regulatory sequences well known to those of skill in the art are preferably included in the vector to ensure expression in the target cells. Several vector elements are desirable: a promoter with a down-stream cloning site for minigene insertion; a polyadenylation signal for efficient transcription termination; an E. coli origin of replication; and an E. coli selectable marker (e.g. ampicillin or kanamycin resistance). Numerous promoters can be used for this purpose, e.g., the human cytomegalovirus (hCMV) promoter. See, e.g., U.S. Pat. Nos. 5,580,859 and 5,589,466 for other suitable promoter sequences.

[0484] Additional vector modifications may be desired to optimize minigene expression and immunogenicity. In some cases, introns are required for efficient gene expression, and one or more synthetic or naturally-occurring introns could be incorporated into the transcribed region of the minigene. The inclusion of mRNA stabilization sequences and sequences for replication in mammalian cells may also be considered for increasing minigene expression.

[0485] Once an expression vector is selected, the minigene is cloned into the polylinker region downstream of the promoter. This plasmid is transformed into an appropriate E. coli strain, and DNA is prepared using standard techniques. The orientation and DNA sequence of the minigene, as well as all other elements included in the vector, are confirmed using restriction mapping and DNA sequence analysis. Bacterial cells harboring the correct plasmid can be stored as a master cell bank and a working cell bank.

[0486] In addition, immunostimulatory sequences (ISSs or CpGs) appear to play a role in the immunogenicity of DNA vaccines. These sequences may be included in the vector, outside the minigene coding sequence, if desired to enhance immunogenicity.

[0487] In some embodiments, a bi-cistronic expression vector which allows production of both the minigene-encoded epitopes and a second protein (included to enhance or decrease immunogenicity) can be used. Examples of proteins or polypeptides that could beneficially enhance the immune response if co-expressed include cytokines (e.g., IL-2, IL-12, GM-CSF), cytokine-inducing molecules (e.g., LeIF), costimulatory molecules, or for HTL responses, pan-DR binding proteins (PADRE™, Epimmune, San Diego, Calif.). Helper (HTL) epitopes can be joined to intracellular targeting signals and expressed separately from expressed CTL epitopes; this allows direction of the HTL epitopes to a cell compartment different than that of the CTL epitopes. If required, this could facilitate more efficient entry of HTL epitopes into the HLA class II pathway, thereby improving HTL induction. In contrast to HTL or CTL induction, specifically decreasing the immune response by co-expression of immunosuppressive molecules (e.g. TGF-&bgr;) may be beneficial in certain diseases.

[0488] Therapeutic quantities of plasmid DNA can be produced for example, by fermentation in E. coli, followed by purification. Aliquots from the working cell bank are used to inoculate growth medium, and grown to saturation in shaker flasks or a bioreactor according to well-known techniques. Plasmid DNA can be purified using standard bioseparation technologies such as solid phase anion-exchange resins supplied by QIAGEN, Inc. (Valencia, Calif.). If required, supercoiled DNA can be isolated from the open circular and linear forms using gel electrophoresis or other methods.

[0489] Purified plasmid DNA can be prepared for injection using a variety of formulations. The simplest of these is reconstitution of lyophilized DNA in sterile phosphate-buffer saline (PBS). This approach, known as “naked DNA,” is currently being used for intramuscular (IM) administration in clinical trials. To maximize the immunotherapeutic effects of minigene DNA vaccines, an alternative method for formulating purified plasmid DNA may be desirable. A variety of methods have been described, and new techniques may become available. Gationic lipids, glycolipids, and fusogenic liposomes can also be used in the formulation (see, e.g., as described by WO 93/24640; Mannino & Gould-Fogerite, Bio Techniques 6(7): 682 (1988); U.S. Pat No. 5,279,833; WO 91/06309; and Feigner, et al., Proc. Nat'l Acad. Sci. USA 84:7413 (1987). In addition, peptides and compounds referred to collectively as protective, interactive, non-condensing compounds (PINC) could also be complexed to purified plasmid DNA to influence variables such as stability, intramuscular dispersion, or trafficking to specific organs or cell types.

[0490] Target cell sensitization can be used as a functional assay for expression and HLA class I presentation of minigene-encoded CTL epitopes. For example, the plasmid DNA is introduced into a mammalian cell line that is suitable as a target for standard CTL chromium release assays. The transfection method used will be dependent on the final formulation. Electroporation can be used for “naked” DNA, whereas cationic lipids allow direct in vitro transfection. A plasmid expressing green fluorescent protein (GFP) can be co-transfected to allow enrichment of transfected cells using fluorescence activated cell sorting (FACS). These cells are then chromium-51 (51Cr) labeled and used as target cells for epitope-specific CTL lines; cytolysis, detected by 51Cr release, indicates both production of, and HLA presentation of, minigene-encoded CTL epitopes. Expression of HTL epitopes may be evaluated in an analogous manner using assays to assess HTL activity.

[0491] In vivo immunogenicity is a seconds approach for functional testing of minigene DNA formulations. Transgenic mice expressing appropriate human HLA proteins are immunized with the DNA product. The dose and route of administration are formulation dependent (e.g., IM for DNA in PBS, intraperitoneal (i.p.) for lipid-complexed DNA). Twenty-one days after immunization, splenocytes are harvested and restimulated for one week in the presence of peptides encoding each epitope being tested. Thereafter, for CTL effector cells, assays are conducted for cytolysis of peptide-loaded, 51Cr-labeled target cells using standard techniques. Lysis of target cells that were sensitized by HLA loaded with peptide epitopes, corresponding to minigene-encoded epitopes, demonstrates DNA vaccine function for in vivo induction of CTLs. Immunogenicity of HTL epitopes is confirmed in transgenic mice in an analogous manner.

[0492] Alternatively, the nucleic acids can be administered using ballistic delivery as described, for instance, in U.S. Pat. No. 5,204,253. Using this technique, particles comprised solely of DNA are administered. In a further alternative embodiment, DNA can be adhered to particles, such as gold particles.

[0493] Minigenes can also be delivered using other bacterial or viral delivery systems well known in the art, e.g., an expression construct encoding epitopes of the invention can be incorporated into a viral vector such as vaccinia.

[0494] X.C.2. Combinations of CTL Peptides with Helper Peptides

[0495] Vaccine compositions comprising CTL peptides of the invention can be modified, e.g., analoged, to provide desired attributes, such as improved serum half life, broadened population coverage or enhanced immunogenicity.

[0496] For instance, the ability of a peptide to induce CTL activity can be enhanced by linking the peptide to a sequence which contains at least one epitope that is capable of inducing a T helper cell response. Although a CTL peptide can be directly linked to a T helper peptide, often CTL epitope/HTL epitope conjugates are linked by a spacer molecule. The spacer is typically comprised of relatively small, neutral molecules, such as amino acids or amino acid mimetics, which are substantially uncharged under physiological conditions. The spacers are typically selected from, e.g., Ala, Gly, or other neutral spacers of nonpolar amino acids or neutral polar amino acids. It will be understood that the optionally present spacer need not be comprised of the same residues and thus may be a hetero- or homo-oligomer. When present, the spacer will usually be at least one or two residues, more usually three to six residues and sometimes 10 or more residues. The CTL peptide epitope can be linked to the T helper peptide epitope either directly or via a spacer either at the amino or carboxy terminus of the CTL peptide. The amino terminus of either the immunogenic peptide or the T helper peptide may be acylated.

[0497] In certain embodiments, the T helper peptide is one that is recognized by T helper cells present in a majority of a genetically diverse population. This can be accomplished by selecting peptides that bind to many, most, or all of the HLA class II molecules. Examples of such amino acid bind many HLA Class II molecules include sequences from antigens such as tetanus toxoid at positions 830-843 (QYIKANSKFIGITE; SEQ ID NO: 44), Plasmodium falciparum circumsporozoite (CS) protein at positions 378-398 (DIEKKIAKMEKASSVFNVVNS; SEQ ID NO: 45), and Streptococcus 18 kD protein at positions 116-131 (GAVDSILGGVATYGAA; SEQ ID NO. 46). Other examples include peptides bearing a DR 1-4-7 supermotif, or either of the DR3 motifs.

[0498] Alternatively, it is possible to prepare synthetic peptides capable of stimulating T helper lymphocytes, in a loosely HLA-restricted fashion, using amino acid sequences not found in nature (see, e.g., PCT publication WO 95/07707). These synthetic compounds called Pan-DR-binding epitopes (e.g., PADRE™, Epimmune, Inc., San Diego, Calif.) are designed, most preferably, to bind most HLA-DR (human HLA class II) molecules. For instance, a pan-DR-binding epitope peptide having the formula: XKXVAAWTLKAX (SEQ ID NO: 47), where “X” is either cycldhexylalanine, phenylalanine, or tyrosine, and a is either D-alanine or L-alanine, has been found to bind to most HLA-DR alleles, and to stimulate the response of T helper lymphocytes from most individuals, regardless of their HLA type. An alternative of a pan-DR binding epitope comprises all “L” natural amino acids and can be provided in the form of nucleic acids that encode the epitope.

[0499] HTL peptide epitopes can also be modified to alter their biological properties. For example, they can be modified to include D-amino acids to increase their resistance to proteases and thus extend their serum half life, or they can be conjugated to other molecules such as lipids, proteins, carbohydrates, and the like to increase their biological activity. For example, a T helper peptide can be conjugated to one or more palmitic acid chains at either the amino or carboxyl termini.

[0500] X.C.3. Combinations of CTL Peptides with T Cell Priming Agents

[0501] In some embodiments it may be desirable to include in the pharmaceutical compositions of the invention at least one component which primes B lymphocytes or T lymphocytes. Lipids have been identified as agents capable of priming CTL in vivo. For example, palmitic acid residues can be attached to the &egr;- and &agr;-amino groups of a lysine residue and then linked, e.g., via one or more linking residues such as Gly, Gly-Gly-, Ser, Ser-Ser, or the like, to an immunogenic peptide. The lipidated peptide can then be administered either directly in a micelle or particle, incorporated into a liposome, or emulsified in an adjuvant, e.g., incomplete Freund's adjuvant. In a preferred embodiment, a particularly effective immunogenic composition comprises palmitic acid attached to &egr;- and &agr;-amino groups of Lys, which is attached via linkage, e.g., Ser-Ser, to the amino terminus of the immunogenic peptide.

[0502] As another example of lipid priming of CTL responses, E. coli lipoproteins, such as tripalmitoyl-S-glycerylcysteinlyseryl-serine (P3CSS) can be used to prime virus specific CTL when covalently attached to an appropriate peptide (see, e.g., Deres, et al., Nature 342:561, 1989). Peptides of the invention can be coupled to P3CSS, for example, and the lipopeptide administered to an individual to prime specifically an immune response to the target antigen. Moreover, because the induction of neutralizing antibodies can also be primed with P3CSS-conjugated epitopes, two such compositions can be combined to more effectively elicit both humoral and cell-mediated responses.

[0503] X.C.4. Vaccine Compositions Comprising DC Pulsed with CTL and/or HTL Peptides

[0504] An embodiment of a vaccine composition in accordance with the invention comprises ex vivo administration of a cocktail of epitope-bearing peptides to PBMC, or isolated DC therefrom, from the patient's blood. A pharmaceutical to facilitate harvesting of DC can be used, such as Progenipoietin™ (Pharmacia-Monsanto, St. Louis, Mo.) or GM-CSF/IL-4. After pulsing the DC with peptides and prior to reinfusion into patients, the DC are washed to remove unbound peptides. In this embodiment, a vaccine comprises peptide-pulsed DCs which present the pulsed peptide epitopes complexed with HLA molecules on their surfaces.

[0505] The DC can be pulsed ex vivo with a cocktail of peptides, some of which stimulate CTL responses to 191P4D12(b). Optionally, a helper T cell (HTL) peptide, such as a natural or artificial loosely restricted HLA Class II peptide, can be included to facilitate the CTL response. Thus, a vaccine in accordance with the invention is used to treat a cancer which expresses or overexpresses 191P4D12(b).

[0506] X.D. Adoptive Immunotherapy

[0507] Antigenic 191P4D12(b)-related peptides are used to elicit a CTL and/or HTL response ex vivo, as well. The resulting CTL or HTL cells, can be used to treat tumors in patients that do not respond to other conventional forms of therapy, or will not respond to a therapeutic vaccine peptide or nucleic acid in accordance with the invention. Ex vivo CTL or HTL responses to a particular antigen are induced by incubating in tissue culture the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of antigen-presenting cells (APC), such as dendritic cells, and the appropriate immunogenic peptide. After an appropriate incubation time (typically about 7-28 days), in which the precursor cells are activated and expanded into effector cells, the cells are infused back into the patient, where they will destroy (CTL) or facilitate destruction (HTL) of their specific target cell (e.g., a tumor cell). Transfected dendritic cells may also be used as antigen presenting cells.

[0508] X.E. Administration of Vaccines for Therapeutic or Prophylactic Purposes

[0509] Pharmaceutical and vaccine compositions of the invention are typically used to treat and/or prevent a cancer that expresses or overexpresses 191P4D12(b). In therapeutic applications, peptide and/or nucleic acid compositions are administered to a patient in an amount sufficient to elicit an effective B cell, CTL and/or HTL response to the antigen and to cure or at least partially arrest or slow symptoms and/or complications. An amount adequate to accomplish this is defined as “therapeutically effective dose.” Amounts effective for this use will depend on, e.g., the particular composition administered, the manner of administration, the stage and severity of the disease being treated, the weight and general state of health of the patient, and the judgment of the prescribing physician.

[0510] For pharmaceutical compositions, the immunogenic peptides of the invention, or DNA encoding them, are generally administered to an individual already bearing a tumor that expresses 191P4D12(b). The peptides or DNA encoding them can be administered individually or as fusions of one or more peptide sequences. Patients can be treated with the immunogenic peptides separately or in conjunction with other treatments, such as surgery, as appropriate.

[0511] For therapeutic use, administration should generally begin at the first diagnosis of 191P4D12(b)-associated cancer. This is followed by boosting doses until at least symptoms are substantially abated and for a period thereafter. The embodiment of the vaccine composition (ie., including, but not limited to embodiments such as peptide cocktails, polyepitopic polypeptides, minigenes, or TAA-specific CTLs or pulsed dendritic cells) delivered to the patient may vary according to the stage of the disease or the patient's health status. For example, in a patient with a tumor that expresses 191P4D12(b), a vaccine comprising 191P4D12(b)-specific CTL may be more efficacious in killing tumor cells in patient with advanced disease than alternative embodiments.

[0512] It is generally important to provide an amount of the peptide epitope delivered by a mode of administration sufficient to stimulate effectively a cytotoxic T cell response; compositions which stimulate helper T cell responses can also be given in accordance with this embodiment of the invention.

[0513] The dosage for an initial therapeutic immunization generally occurs in a unit dosage range where the lower value is about 1, 5, 50, 500, or 1,000 &mgr;g and the higher value is about 10,000; 20,000; 30,000; or 50,000 &mgr;g. Dosage values for a human typically range from about 500 &mgr;g to about 50,000 &mgr;g per 70 kilogram patient. Boosting dosages of between about 1.0 &mgr;g to about 50,000 &mgr;g of peptide pursuant to a boosting regimen over weeks to months may be administered depending upon the patient's response and condition as determined by measuring the specific activity of CTL and HTL obtained from the patient's blood. Administration should continue until at least clinical symptoms or laboratory tests indicate that the neoplasia, has been eliminated or reduced and for a period thereafter. The dosages, routes of administration, and dose schedules are adjusted in accordance with methodologies known in the art.

[0514] In certain embodiments, the peptides and compositions of the present invention are employed in serious disease states, that is, life-threatening or potentially life threatening situations. In such cases, as a result of the minimal amounts of extraneous substances and the relative nontoxic nature of the peptides in preferred compositions of the invention, it is possible and may be felt desirable by the treating physician to administer substantial excesses of these peptide compositions relative to these stated dosage amounts.

[0515] The vaccine compositions of the invention can also be used purely as prophylactic agents. Generally the dosage for an initial prophylactic immunization generally occurs in a unit dosage range where the lower value is about 1, 5, 50, 500, or 1000 &mgr;g and the higher value is about 10,000; 20,000; 30,000; or 50,000 &mgr;g. Dosage values for a human typically range from about 500 &mgr;g to about 50,000 &mgr;g per 70 kilogram patient. This is followed by boosting dosages of between about 1.0 &mgr;g to about 50,000 &mgr;g of peptide administered at defined intervals from about four weeks to six months after the initial administration of vaccine. The immunogenicity of the vaccine can be assessed by measuring the specific activity of CTL and HTL obtained from a sample of the patient's blood.

[0516] The pharmaceutical compositions for therapeutic treatment are intended for parenteral, topical, oral, nasal, intrathecal, or local (e.g. as a cream or topical ointment) administration. Preferably, the pharmaceutical compositions are administered parentally, e.g., intravenously, subcutaneously, intradermally, or intramuscularly. Thus, the invention provides compositions for parenteral administration which comprise a solution of the immunogenic peptides dissolved or suspended in an acceptable carrier, preferably an aqueous carrier.

[0517] A variety of aqueous carriers may be used, e.g., water, buffered water, 0.8% saline, 0.3% glycine, hyaluronic acid and the like. These compositions may be sterilized by conventional, well-known sterilization techniques, or may be sterile filtered. The resulting aqueous solutions may be packaged for use as is, or lyophilized, the lyophilized preparation being combined with a sterile solution prior to administration.

[0518] The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions, such as pH-adjusting and buffering agents, tonicity adjusting agents, wetting agents, preservatives, and the like, for example, sodium acetate, sodium lactate, sodium chloride, potassium chloride, calcium chloride, sorbitan monolaurate, triethanolamine oleate, etc.

[0519] The concentration of peptides of the invention in the pharmaceutical formulations can vary widely, i.e., from less than about 0.1%, usually at or at least about 2% to as much as 20% to 50% or more by weight, and will be selected primarily by fluid volumes, viscosities, etc., in accordance with the particular mode of administration selected.

[0520] A human unit dose form of a composition is typically included in a pharmaceutical composition that comprises a human unit dose of an acceptable carrier, in one embodiment an aqueous carrier, and is administered in a volume/quantity that is known by those of skill in the art to be used for administration of suchf compositions to humans (see, e.g., Remington's Pharmaceutical Sciences, 17th Edition, A. Gennaro, Editor, Mack Publishing Co., Easton, Pa., 1985). For example a peptide dose for initial immunization can be from about 1 to about 50,000 &mgr;g, generally 100-5,000 &mgr;g, for a 70 kg patient. For example, for nucleic acids an initial immunization may be performed using an expression vector in the form of naked nucleic acid administered IM (or SC or ID) in the amounts of 0.5-5 mg at multiple sites. The nucleic acid (0.1 to 1000 &mgr;g) can also be administered using a gene gun. Following an incubation period of 3-4 weeks, a booster dose is then administered. The booster can be recombinant fowlpox virus administered at a dose of 5-107 to 5×109 pfu.

[0521] For antibodies, a treatment generally involves repeated administration of the anti-191P4D12(b) antibody preparation, via an acceptable route of administration such as intravenous injection (IV), typically at a dose in the range of about 0.1 to about 10 mg/kg body weight. In general, doses in the range of 10-500 mg mAb per week are effective and well tolerated. Moreover, an initial loading dose of approximately 4 mg/kg patient body weight IV, followed by weekly doses of about 2 mg/kg IV of the anti-191P4D12(b) mAb preparation represents an acceptable dosing regimen. As appreciated by those of skill in the art, various factors can influence the ideal dose in a particular case. Such factors include, for example, half life of a composition, the binding affinity of an Ab, the immunogenicity of a substance, the degree of 191P4D12(b) expression in the patient, the extent of circulating shed 191P4D12(b) antigen, the desired steady-state concentration level, frequency of treatment, and the influence of chemotherapeutic or other agents used in combination with the treatment method of the invention, as well as the health status of a particular patient. Non-limiting preferred human unit doses are, for example, 500 &mgr;g-1 mg, 1 mg-50 mg, 50 mg-100 mg, 100 mg-200 mg, 200 mg-300 mg, 400 mg-500 mg, 500 mg-600 mg, 600 mg-700 mg, 700 mg-800 mg, 800 mg-900 mg, 900 mg-1 g, or 1 mg-700 mg. In certain embodiments, the dose is in a range of 2-5 mg/kg body weight, e.g., with follow on weekly doses of 1-3 mg/kg; 0.5 mg, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 mg/kg body weight followed, e.g., in two, three or four weeks by weekly doses; 0.5-10 mg/kg body weight, e.g., followed in two, three or four weeks by weekly doses; 225, 250, 275, 300, 325, 350, 375, 400 mg m2 of body area weekly; 1-600 mg m2 of body area weekly; 225-400 mg m2 of body area weekly; these does can be followed by weekly doses for 2, 3, 4, 5, 6, 7, 8, 9, 19, 11, 12 or more weeks.

[0522] In one embodiment, human unit dose forms of polynucleotides comprise a suitable dosage range or effective amount that provides any therapeutic effect. As appreciated by one of ordinary skill in the art a therapeutic effect depends on a number of factors, including the sequence of the polynucleotide, molecular weight of the polynucleotide and route of administration. Dosages are generally selected by the physician or other health care professional in accordance with a variety of parameters known in the art, such as severity of symptoms, history of the patient and the like. Generally, for a polynucleotide of about 20 bases, a dosage range may be selected from, for example, an independently selected lower limit such as about 0.1, 0.25, 0.5, 1, 2, 5, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 200, 300, 400 or 500 mg/kg up to an independently selected upper limit, greater than the lower limit, of about 60, 80, 100, 200, 300, 400, 500, 750, 1000, 1500, 2000, 3000, 4000, 5000, 6000, 7000, 8000, 9000 or 10,000 mg/kg. For example, a dose may be about any of the following: 0.1 to 100 mg/kg, 0.1 to 50 mg/kg, 0.1 to 25 mg/kg, 0.1 to 10 mg/kg, 1 to 500 mg/kg, 100 to 400 mg/kg, 200 to 300 mg/kg, 1 to 100 mg/kg, 100 to 200 mg/kg, 300 to 400 mg/kg, 400 to 500 mg/kg, 500 to 1000 mg/kg, 500 to 5000 mg/kg, or 500 to 10,000 mg/kg. Generally, parenteral routes of administration may require higher doses of polynucleotide compared to more direct application to the nucleotide to diseased tissue, as do polynucleotides of increasing length.

[0523] In one embodiment, human unit dose forms of T-cells comprise a suitable dosage range or effective amount that provides any therapeutic effect. As appreciated by one of ordinary skill in the art, a therapeutic effect depends on a number of factors. Dosages are generally selected by the physician or other health care professional in accordance with a variety of parameters known in the art, such as severity of symptoms, history of the patient and the like. A dose may be about 104 cells to about 106 cells, about 106 cells to about 108 cells, about 108 to about 1011 cells, or about 108 to about 5×1010 cells. A dose may also about 106 cells/m2 to about 1010 cells/m2, or about 106 cells/m2 to about 108 cells/m2 .

[0524] Proteins(s) of the invention, and/or nucleic acids encoding the protein(s), can also be administered via liposomes, which may also serve to: 1) target the proteins(s) to a particular tissue, such as lymphoid tissue; 2) to target selectively to diseases cells; or, 3) to increase the half-life of the peptide composition. Liposomes include emulsions, foams, micelles, insoluble monolayers, liquid crystals, phospholipid dispersions, lamellar layers and the like. In these preparations, the peptide to be delivered is incorporated as part of a liposome, alone or in conjunction with a molecule which binds to a receptor prevalent among lymphoid cells, such as monoclonal antibodies which bind to the CD45 antigen, or with other therapeutic or immunogenic compositions. Thus, liposomes either filled or decorated with a desired peptide of the invention can be directed to the site of lymphoid cells, where the liposomes then deliver the peptide compositions. Liposomes for use in accordance with the invention are formed from standard vesicle-forming lipids, which generally include neutral and negatively charged phospholipids and a sterol, such as cholesterol. The selection of lipids is generally guided by consideration of, e.g., liposome size, acid lability and stability of the liposomes in the blood stream. A variety of methods are available for preparing liposomes, as described in, e.g., Szoka, et al., Ann. Rev. Biophys. Bioeng. 9:467 (1980), and U.S. Pat. Nos. 4,235,871, 4,501,728, 4,837,028, and 5,019,369.

[0525] For targeting cells of the immune system, a ligand to be incorporated into the liposome can include, e.g., antibodies or fragments thereof specific for cell surface determinants of the desired immune system cells. A liposome suspension containing a peptide may be administered intravenously, locally, topically, etc. in a dose which varies according to, inter alia, the manner of administration, the peptide being delivered, and the stage of the disease being treated.

[0526] For solid compositions, conventional nontoxic solid carriers may be used which include, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharin, talcum, cellulose, glucose, sucrose, magnesium carbonate, and the like. For oral administration, a pharmaceutically acceptable nontoxic composition is formed by incorporating any of the normally employed excipients, such as those carriers previously listed, and generally 10-95% of active ingredient, that is, one or more peptides of the invention, and more preferably at a concentration of 25%-75%.

[0527] For aerosol administration, immunogenic peptides are preferably supplied in finely divided form along with a surfactant and propellant. Typical percentages of peptides are about 0.01%-20% by weight, preferably about 1%-10%. The surfactant must, of course, be nontoxic, and preferably soluble in the propellant. Representative of such agents are the esters or partial esters of fatty acids containing from about 6 to 22 carbon atoms, such as caproic, octanoic, lauric, palmitic, stearic, linoleic, linolenic, olesteric and oleic acids with an aliphatic polyhydric alcohol or its cyclic anhydride. Mixed esters, such as mixed or natural glycerides may be employed. The surfactant may constitute about 0.1%-20% by weight of the composition, preferably about 0.25-5%. The balance of the composition is ordinarily propellant. A carrier can also be included, as desired, as with, e.g., lecithin for intranasal delivery.

[0528] XI.) Diagnostic and Prognostic Embodiments of 191P4D12(b).

[0529] As disclosed herein, 191P4D12(b) polynucleotides, polypeptides, reactive cytotoxic T cells (CTL), reactive helper T cells (HTL) and anti-polypeptide antibodies are used in well known diagnostic, prognostic and therapeutic assays that examine conditions associated with dysregulated cell growth such as cancer, in particular the cancers listed in Table I (see, e.g., both its specific pattern of tissue expression as well as its overexpression in certain cancers as described for example in the Example entitled “Expression analysis of 191P4D12(b) in normal tissues, and patient specimens”).

[0530] 191P4D12(b) can be analogized to a prostate associated antigen PSA, the archetypal marker that has been used by medical practitioners for years to identify and monitor the presence of prostate cancer (see, e.g., Merrill et al., J. Urol. 163(2): 503-5120 (2000); Polascik et al., J. Urol. Aug; 162(2):293-306 (1999) and Fortier et al., J. Nat. Cancer Inst. 91(19): 1635-1640(1999)). A variety of other diagnostic markers are also used in similar contexts including p53 and K-ras (see, e.g., Tulchinsky et al., Int J Mol Med 1999 Jul 4(1):99-102 and Minimoto et al., Cancer Detect Prev 2000;24(1):1-12). Therefore, this disclosure of 191P4D12(b) polynucleotides and polypeptides (as well as 191P4D12(b) polynucleotide probes and anti-191P4D12(b) antibodies used to identify the presence of these molecules) and their properties allows skilled artisans to utilize these molecules in methods that are analogous to those used, for example, in a variety of diagnostic assays directed to examining conditions associated with cancer.

[0531] Typical embodiments of diagnostic methods which utilize the 191P4D12(b) polynucleotides, polypeptides, reactive T cells and antibodies are analogous to those methods from well-established diagnostic assays, which employ, e.g., PSA polynucleotides, polypeptides, reactive T cells and antibodies. For example, just as PSA polynucleotides are used as probes (for example in Northern analysis, see, e.g., Sharief et al., Biochem. Mol. Biol. Int. 33(3):567-74(1994)) and primers (for example in PCR analysis, see, e.g., Okegawa et al., J. Urol. 163(4): 1189-1190 (2000)) to observe the presence and/or the level of PSA mRNAs in methods of monitoring PSA overexpression or the metastasis of prostate cancers, the 191P4D12(b) polynucleotides described herein can be utilized in the same way to detect 191P4D12(b) overexpression or the metastasis of prostate and other cancers expressing this gene. Alternatively, just as PSA polypeptides are used to generate antibodies specific for PSA which can then be used to observe the presence and/or the level of PSA proteins in methods to monitor PSA protein overexpression (see, e.g., Stephan et al., Urology 55(4):560-3 (2000)) or the metastasis of prostate cells (see, e.g., Alanen et al., Pathol. Res. Pract. 192(3):233-7 (1996)), the 191P4D12(b) polypeptides described herein can be utilized to generate antibodies for use in detecting 191P4D12(b) overexpression or the metastasis of prostate cells and cells of other cancers expressing this gene.

[0532] Specifically, because metastases involves the movement of cancer cells from an organ of origin (such as the lung or prostate gland etc.) to a different area of the body (such as a lymph node), assays which examine a biological sample for the presence of cells expressing 191P4D12(b) polynucleotides and/or polypeptides can be used to provide evidence of metastasis. For example, when a biological sample from tissue that does not normally contain 191P4D12(b)-expressing cells (lymph node) is found to contain 191P4D12(b)-expressing cells such as the 191P4D12(b) expression seen in LAPC4 and LAPC9, xenografts isolated from lymph node and bone metastasis, respectively, this finding is indicative of metastasis.

[0533] Alternatively 191P4D12(b) polynucleotides and/or polypeptides can be used to provide evidence of cancer, for example, when cells in a biological sample that do not normally express 191P4D12(b) or express 191P4D12(b) at a different level are found to express 191P4D12(b) or have an increased expression of 191P4D12(b) (see, e.g., the 191P4D12(b) expression in the cancers listed in Table I and in patient samples etc. shown in the accompanying Figures). In such assays, artisans may further wish to generate supplementary evidence of metastasis by testing the biological sample for the presence of a second tissue restricted marker (in addition to 191P4D12(b)) such as PSA, PSCA etc. (see, e.g., Alanen et al., Pathol. Res. Pract. 192(3): 233-237 (1996)).

[0534] The use of immunohistochemistry to identify the presence of a 191P4D12(b) polypeptide within a tissue section can indicate an altered state of certain cells within that tissue. It is well understood in the art that the ability of an antibody to localize to a polypeptide that is expressed in cancer cells is a way of diagnosing presence of disease, disease stage, progression and/or tumor aggressiveness. Such an antibody can also detect an altered distribution of the polypeptide within the cancer cells, as compared to corresponding non-malignant tissue.

[0535] The 191P4D12(b) polypeptide and immunogenic compositions are also useful in view of the phenomena of altered subcellular protein localization in disease states. Alteration of cells from normal to diseased state causes changes in cellular morphology and is often associated with changes in subcellular protein localization/distribution. For example, cell membrane proteins that are expressed in a polarized manner in normal cells can be altered in disease, resulting in distribution of the protein in a non-polar manner over the whole cell surface.

[0536] The phenomenon of altered subcellular protein localization in a disease state has been demonstrated with MUC1 and Her2 protein expression by use of immunohistochemical means. Normal epithelial cells have a typical apical distribution of MUC1, in addition to some supranuclear localization of the glycoprotein, whereas malignant lesions often demonstrate an apolar staining pattern (Diaz et al, The Breast Journal, 7; 40-45 (2001); Zhang et al, Clinical Cancer Research, 4; 2669-2676 (1998): Cao, et al, The Journal of Histochemistry and Cytochemistry, 45: 1547-1557 (1997)). In addition, normal breast epithelium is either negative for Her2 protein or exhibits only a basolateral distribution whereas malignant cells can express the protein over the whole cell surface (De Potter, et al, International Journal of Cancer, 44; 969-974 (1989): McCormick, et al, 117; 935-943 (2002)). Alternatively, distribution of the protein may be altered from a surface only localization to include diffuse cytoplasmic expression in the diseased state. Such an example can be seen with MUC1 (Diaz, et al, The Breast Journal, 7: 40-45 (2001)).

[0537] Alteration in the localization/distribution of a protein in the cell, as detected by immunohistochemical methods, can also provide valuable information concerning the favorability of certain treatment modalities. This last point is illustrated by a situation where a protein may be intracellular in normal tissue, but cell surface in malignant cells; the cell surface location makes the cells favorably amenable to antibody-based diagnostic and treatment regimens. When such an alteration of protein localization occurs for 191P4D12(b), the 191P4D12(b) protein and immune responses related thereto are very useful. Accordingly, the ability to determine whether alteration of subcellular protein localization occurred for 24P4C12 make the 191P4D12(b) protein and immune responses related thereto very useful. Use of the 191P4D12(b) compositions allows those skilled in the art to make important diagnostic and therapeutic decisions. Immunohistochemical reagents specific to 191P4D12(b) are also useful to detect metastases of tumors expressing 191P4D12(b) when the polypeptide appears in tissues where 191P4D12(b) is not normally produced.

[0538] Thus, 191P4D12(b) polypeptides and antibodies resulting from immune responses thereto are useful in a variety of important contexts such as diagnostic, prognostic, preventative and/or therapeutic purposes known to those skilled in the art.

[0539] Just as PSA polynucleotide fragments and polynucleotide variants are employed by skilled artisans for use in methods of monitoring PSA, 191P4D12(b) polynucleotide fragments and polynucleotide variants are used in an analogous manner. In particular, typical PSA polynucleotides used in methods of monitoring PSA are probes or primers which consist of fragments of the PSA cDNA sequence. Illustrating this, primers used to PCR amplify a PSA polynucleotide must include less than the whole PSA sequence to function in the polymerase chain reaction. In the context of such PCR reactions, skilled artisans generally create a variety of different polynucleotide fragments that can be used as primers in order to amplify different portions of a polynucleotide of interest or to optimize amplification reactions (see, e.g., Caetano-Anolles, G. Biotechniques 25(3): 472-476, 478-480 (1998); Robertson et al., Methods Mol. Biol. 98:121-154 (1998)). An additional illustration of the use of such fragments is provided in the Example entitled “Expression analysis of 191P4D12(b) in normal tissues, and patient specimens,” where a 191P4D12(b) polynucleotide fragment is used as a probe to show the expression of 191P4D12(b) RNAs in cancer cells. In addition, variant polynucleotide sequences are typically used as primers and probes for the corresponding mRNAs in PCR and Northern analyses (see, e.g., Sawai et al., Fetal Diagn. Ther. 1996 Nov-Dec 11(6):407-13 and Current Protocols In Molecular Biology, Volume 2, Unit 2, Frederick M. Ausubel et al. eds., 1995)). Polynucleotide fragments and variants are useful in this context where they are capable of binding to a target polynucleotide sequence (e.g., a 191P4D12(b) polynucleotide shown in FIG. 2 or variant thereof) under conditions of high stringency.

[0540] Furthermore, PSA polypeptides which contain an epitope that can be recognized by an antibody or T cell that specifically binds to that epitope are used in methods of monitoring PSA. 191P4D12(b) polypeptide fragments and polypeptide analogs or variants can also be used in an analogous manner. This practice of using polypeptide fragments or polypeptide variants to generate antibodies (such as anti-PSA antibodies or T cells) is typical in the art with a wide variety of systems such as fusion proteins being used by practitioners (see, e.g., Current Protocols In Molecular Biology, Volume 2, Unit 16, Frederick M. Ausubel et al. eds., 1995). In this context, each epitope(s) functions to provide the architecture with which an antibody or T cell is reactive. Typically, skilled artisans create a variety of different polypeptide fragments that can be used in order to generate immune responses specific for different portions of a polypeptide of interest (see, e.g., U.S. Pat. No. 5,840,501 and U.S. Pat. No. 5,939,533). For example it may be preferable to utilize a polypeptide comprising one of the 191P4D12(b) biological motifs discussed herein or a motif-bearing subsequence which is readily identified by one of skill in the art based on motifs available in the art. Polypeptide fragments, variants or analogs are typically useful in this context as long as they comprise an epitope capable of generating an antibody or T cell specific for a target polypeptide sequence (e.g. a 191P4D12(b) polypeptide shown in FIG. 3).

[0541] As shown herein, the 191P4D12(b) polynucleotides and polypeptides (as well as the 191P4D12(b) polynucleotide probes and anti-191P4D12(b) antibodies or T cells used to identify the presence of these molecules) exhibit specific properties that make them useful in diagnosing cancers such as those listed in Table I. Diagnostic assays that measure the presence of 191P4D12(b) gene products, in order to evaluate the presence or onset of a disease condition described herein, such as prostate cancer, are used to identify patients for preventive measures or further monitoring, as has been done so successfully with PSA. Moreover, these materials satisfy a need in the art for molecules having similar or complementary characteristics to PSA in situations where, for example, a definite diagnosis of metastasis of prostatic origin cannot be made on the basis of a test for PSA alone (see, e.g., Alanen et al., Pathol. Res. Pract. 192(3): 233-237 (1996)), and consequently, materials such as 191P4D12(b) polynucleotides and polypeptides (as well as the 191P4D12(b) polynucleotide probes and anti-191P4D12(b) antibodies used to identify the presence of these molecules) need to be employed to confirm a metastases of prostatic origin.

[0542] Finally, in addition to their use in diagnostic assays, the 191P4D12(b) polynucleotides disclosed herein have a number of other utilities such as their use in the identification of oncogenetic associated chromosomal abnormalities in the chromosomal region to which the 191P4D12(b) gene maps (see the Example entitled “Chromosomal Mapping of 191P4D12(b)” below). Moreover, in addition to their use in diagnostic assays, the 191P4D12(b)-related proteins and polynucleotides disclosed herein have other utilities such as their use in the forensic analysis of tissues of unknown origin (see, e.g., Takahama K Forensic Sci Int 1996 Jun 28;80(1-2): 63-9).

[0543] Additionally, 191P4D12(b)-related proteins or polynucleotides of the invention can be used to treat a pathologic condition characterized by the over-expression of 191P4D12(b). For example, the amino acid or nucleic acid sequence of FIG. 2 or FIG. 3, or fragments of either, can be used to generate an immune response to a 191P4D12(b) antigen. Antibodies or other molecules that react with 191P4D12(b) can be used to modulate the function of this molecule, and thereby provide a therapeutic benefit.

[0544] XII.) Inhibition of 191P4D12(b) Protein Function

[0545] The invention includes various methods and compositions for inhibiting the binding of 191P4D12(b) to its binding partner or its association with other protein(s) as well as methods for inhibiting 191P4D12(b) function.

[0546] XII.A.) Inhibition of 191P4D12(b) With Intracellular Antibodies

[0547] In one approach, a recombinant vector that encodes single chain antibodies that specifically bind to 191P4D12(b) are introduced into 191P4D12(b) expressing cells via gene transfer technologies. Accordingly, the encoded single chain anti-191P4D12(b) antibody is expressed intracellularly, binds to 191P4D12(b) protein, and thereby inhibits its function. Methods for engineering such intracellular single chain antibodies are well known. Such intracellular antibodies, also known as “intrabodies”, are specifically targeted to a particular compartment within the cell, providing control over where the inhibitory activity of the treatment is focused. This technology has been successfully applied in the art (for review, see Richardson and Marasco, 1995, TIBTECH vol. 13). Intrabodies have been shown to virtually eliminate the expression of otherwise abundant cell surface receptors (see, e.g., Richardson et al., 1995, Proc. Natl. Acad. Sci. USA 92: 3137-3141; Beerli et al., 1994, J. Biol. Chem. 289: 23931-23936; Deshane et al., 1994, Gene Ther. 1: 332-337).

[0548] Single chain antibodies comprise the variable domains of the heavy and light chain joined by a flexible linker polypeptide, and are expressed as a single polypeptide. Optionally, single chain antibodies are expressed as a single chain variable region fragment joined to the light chain constant region. Well-known intracellular trafficking signals are engineered into recombinant polynucleotide vectors encoding such single chain antibodies in order to target precisely the intrabody to the desired intracellular compartment. For example, intrabodies targeted to the endoplasmic reticulum (ER) are engineered to incorporate a leader peptide and, optionally, a C-terminal ER retention signal, such as the KDEL amino acid motif. Intrabodies intended to exert activity in the nucleus are engineered to include a nuclear localization signal. Lipid moieties are joined to intrabodies in order to tether the intrabody to the cytosolic side of the plasma membrane. Intrabodies can also be targeted to exert function in the cytosol. For example, cytosolic intrabodies are used to sequester factors within the cytosol, thereby preventing them from being transported to their natural cellular destination.

[0549] In one embodiment, intrabodies are used to capture 191P4D12(b) in the nucleus, thereby preventing its activity within the nucleus. Nuclear targeting signals are engineered into such 191P4D12(b) intrabodies in order to achieve the desired targeting. Such 191P4D12(b) intrabodies are designed to bind specifically to a particular 191P4D12(b) domain. In another embodiment, cytosolic intrabodies that specifically bind to a 191P4D12(b) protein are used to prevent 191P4D12(b) from gaining access to the nucleus, thereby preventing it from exerting any biological activity within the nucleus (e.g., preventing 191P4D12(b) from forming transcription complexes with other factors).

[0550] In order to specifically direct the expression of such intrabodies to particular cells, the transcription of the intrabody is placed under the regulatory control of an appropriate tumor-specific promoter and/or enhancer. In order to target intrabody expression specifically to prostate, for example, the PSA promoter and/or promoter/enhancer can be utilized (See, for example, U.S. Pat. No. 5,919,652 issued 6 Jul. 1999).

[0551] XII.B.) Inhibition of 191P4D12(b) with Recombinant Proteins

[0552] In another approach, recombinant molecules bind to 191P4D12(b) and thereby inhibit 191P4D12(b) function. For example, these recombinant molecules prevent or inhibit 191P4D12(b) from accessing/binding to its binding partner(s) or associating with other protein(s). Such recombinant molecules can, for example, contain the reactive part(s) of a 191P4D12(b) specific antibody molecule. In a particular embodiment, the 191P4D12(b) binding domain of a 191P4D12(b) binding partner is engineered into a dimeric fusion protein, whereby the fusion protein comprises two 191P4D12(b) ligand binding domains linked to the Fc portion of a human IgG, such as human IgG1. Such IgG portion can contain, for example, the CH2 and CH3 domains and the hinge region, but not the CH1 domain. Such dimeric fusion proteins are administered in soluble form to patients suffering from a cancer associated with the expression of 191P4D12(b), whereby the dimeric fusion protein specifically binds to 191P4D12(b) and blocks 191P4D12(b) interaction with a binding partner. Such dimeric fusion proteins are further combined into multimeric proteins using known antibody linking technologies.

[0553] XII.C.) Inhibition of 191P4D12(b) Transcription or Translation

[0554] The present invention also comprises various methods and compositions for inhibiting the transcription of the 191P4D12(b) gene. Similarly, the invention also provides methods and compositions for inhibiting the translation of 191P4D12(b) mRNA into protein.

[0555] In one approach, a method of inhibiting the transcription of the 191P4D12(b) gene comprises contacting the 191P4D12(b) gene with a 191P4D12(b) antisense polynucleotide. In another approach, a method of inhibiting 191P4D12(b) mRNA translation comprises contacting a 191P4D12(b) mRNA with an antisense polynucleotide. In another approach, a 191P4D12(b) specific ribozyme is used to cleave a 191P4D12(b) message, thereby inhibiting translation. Such antisense and ribozyme based methods can also be directed to the regulatory regions of the 191P4D12(b) gene, such as 191P4D12(b) promoter and/or enhancer elements. Similarly, proteins capable of inhibiting a 191P4D12(b) gene transcription factor are used to inhibit 191P4D12(b) mRNA transcription. The various polynucleotides and compositions useful in the aforementioned methods have been described above. The use of antisense and ribozyme molecules to inhibit transcription and translation is well known in the art.

[0556] Other factors that inhibit the transcription of 191P4D12(b) by interfering with 191P4D12(b) transcriptional activation are also useful to treat cancers expressing 191P4D12(b). Similarly, factors that interfere with 191P4D12(b) processing are useful to treat cancers that express 191P4D12(b). Cancer treatment methods utilizing such factors are also within the scope of the invention.

[0557] XII.D.) General Considerations for Therapeutic Strategies

[0558] Gene transfer and gene therapy technologies can be used to deliver therapeutic polynucleotide molecules to tumor cells synthesizing 191P4D12(b) (i.e., antisense, ribozyme, polynucleotides encoding intrabodies and other 191P4D12(b) inhibitory molecules). A number of gene therapy approaches are known in the art. Recombinant vectors encoding 191P4D12(b) antisense polynucleotides, ribozymes, factors capable of interfering with 191P4D12(b) transcription, and so forth, can be delivered to target tumor cells using such gene therapy approaches.

[0559] The above therapeutic approaches can be combined with any one of a wide variety of surgical, chemotherapy or radiation therapy regimens. The therapeutic approaches of the invention can enable the use of reduced dosages of chemotherapy (or other therapies) and/or less frequent administration, an advantage for all patients and particularly for those that do not tolerate the toxicity of the chemotherapeutic agent well.

[0560] The anti-tumor activity of a particular compositon (e.g., antisense, ribozyme, intrabody), or a combination of such compositions, can be evaluated using various in vitro and in vivo assay systems. In vitro assays that evaluate therapeutic activity include cell growth assays, soft agar assays and other assays indicative of tumor promoting activity, binding assays capable of determining the extent to which a therapeutic composition will inhibit the binding of 191P4D12(b) to a binding partner, etc.

[0561] In vivo, the effect of a 191P4D12(b) therapeutic composition can be evaluated in a suitable animal model. For example, xenogenic prostate cancer models can be used, wherein human prostate cancer explants or passaged xenograft issues are introduced into immune compromised animals, such as nude or SCID mice (Klein et al., 1997, Nature Medicine 3: 402-408). For example, PCT Patent Application WO98/16628 and U.S. Pat. No. 6,107,540 describe various xenograft models of human prostate cancer capable of recapitulating the development of primary tumors, micrometastasis, and the formation of osteoblastic metastases characteristic of late stage disease. Efficacy can be predicted using assays that measure inhibition of tumor formation, tumor regression or metastasis, and the like.

[0562] In vivo assays that evaluate the promotion of apoptosis are useful in evaluating therapeutic compositions. In one embodiment, xenografts from tumor bearing mice treated with the therapeutic composition can be examined for the presence of apoptotic foci and compared to untreated control xenograft-bearing mice. The extent to which apoptotic foci are found in the tumors of the treated mice provides an indication of the therapeutic efficacy of the composition.

[0563] The therapeutic compositions used in the practice of the foregoing methods can be formulated into pharmaceutical compositions comprising a carrier suitable for the desired delivery method. Suitable carriers include any material that when combined with the therapeutic composition retains the anti-tumor function of the therapeutic composition and is generally non-reactive with the patient's immune system. Examples include, but are not limited to, any of a number of standard pharmaceutical carriers such as sterile phosphate buffered saline solutions, bacteriostatic water, and the like (see, generally, Remington's Pharmaceutical Sciences 16th Edition, A. Osal., Ed., 1980).

[0564] Therapeutic formulations can be solubilized and administered via any route capable of delivering the therapeutic composition to the tumor site. Potentially effective routes of administration include, but are not limited to, intravenous, parenteral, intraperitoneal, intramuscular, intratumor, intradermal, intraorgan, orthotopic, and the like. A preferred formulation for intravenous injection comprises the therapeutic composition in a solution of preserved bacteriostatic water, sterile unpreserved water, and/or diluted in polyvinylchloride or polyethylene bags containing 0.9% sterile Sodium Chloride for Injection, USP. Therapeutic protein preparations can be lyophilized and stored as sterile powders, preferably under vacuum, and then reconstituted in bacteriostatic water (containing for example, benzyl alcohol preservative) or in sterile water prior to injection.

[0565] Dosages and administration protocols for the treatment of cancers using the foregoing methods will vary with the method and the target cancer, and will generally depend on a number of other factors appreciated in the art.

[0566] XIII.) Identification, Characterization and Use of Modulators of 191P4D12(b)

[0567] Methods to Identify and Use Modulators

[0568] In one embodiment, screening is performed to identify modulators that induce or suppress a particular expression profile, suppress or induce specific pathways, preferably generating the associated phenotype thereby. In another embodiment, having identified differentially expressed genes important in a particular state; screens are performed to identify modulators that alter expression of individual genes, either increase or decrease. In another embodiment, screening is performed to identify modulators that alter a biological function of the expression product of a differentially expressed gene. Again, having identified the importance of a gene in a particular state, screens are performed to identify agents that bind and/or modulate the biological activity of the gene product.

[0569] In addition, screens are done for genes that are induced in response to a candidate agent. After identifying a modulator (one that suppresses a cancer expression pattern leading to a normal expression pattern, or a modulator of a cancer gene that leads to expression of the gene as in normal tissue) a screen is performed to identify genes that are specifically modulated in response to the agent. Comparing expression profiles between normal tissue and agent-treated cancer tissue reveals genes that are not expressed in normal tissue or cancer tissue, but are expressed in agent treated tissue, and vice versa. These agent-specific sequences are identified and used by methods described herein for cancer genes or proteins. In particular these sequences and the proteins they encode are used in marking or identifying agent-treated cells. In addition, antibodies are raised against the agent-induced proteins and used to target novel therapeutics to the treated cancer tissue sample.

[0570] Modulator-related Identification and Screening Assays:

[0571] Gene Expression-related Assays

[0572] Proteins, nucleic acids, and antibodies of the invention are used in screening assays. The cancer-associated proteins, antibodies, nucleic acids, modified proteins and cells containing these sequences are used in screening assays, such as evaluating the effect of drug candidates on a “gene expression profile,” expression profile of polypeptides or alteration of biological function. In one embodiment, the expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes after treatment with a candidate agent (e.g., Davis, G F, et al, J Biol Screen 7:69 (2002); Zlokarnik, et al., Science 279:84-8 (1998); Heid, Genome Res 6:986-94,1996).

[0573] The cancer proteins, antibodies, nucleic acids, modified proteins and cells containing the native or modified cancer proteins or genes are used in screening assays. That is, the present invention comprises methods for screening for compositions which modulate the cancer phenotype or a physiological function of a cancer protein of the invention. This is done on a gene itself or by evaluating the effect of drug candidates on a “gene expression profile” or biological function. In one embodiment, expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring after treatment with a candidate agent, see Zlokamik, supra.

[0574] A variety of assays are executed directed to the genes and proteins of the invention. Assays are run on an individual nucleic acid or protein level. That is, having identified a particular gene as up regulated in cancer, test compounds are screened for the ability to modulate gene expression or for binding to the cancer protein of the invention. “Modulation” in this context includes an increase or a decrease in gene expression. The preferred amount of modulation will depend on the original change of the gene expression in normal versus tissue undergoing cancer, with changes of at least 10%, preferably 50%, more preferably 100-300%, and in some embodiments 300-1000% or greater. Thus, if a gene exhibits a 4-fold increase in cancer tissue compared to normal tissue, a decrease of about four-fold is often desired; similarly, a 10-fold decrease in cancer tissue compared to normal tissue a target value of a 10-fold increase in expression by the test compound is often desired. Modulators that exacerbate the type of gene expression seen in cancer are also useful, e.g., as an upregulated target in further analyses.

[0575] The amount of gene expression is monitored using nucleic acid probes and the quantification of gene expression levels, or, alternatively, a gene product itself is monitored, e.g., through the use of antibodies to the cancer protein and standard immunoassays. Proteomics and separation techniques also allow for quantification of expression.

[0576] Expression Monitoring to Identify Compounds that Modify Gene Expression

[0577] In one embodiment, gene expression monitoring, i.e., an expression profile, is monitored simultaneously for a number of entities. Such profiles will typically involve one or more of the genes of FIG. 2. In this embodiment, e.g., cancer nucleic acid probes are attached to biochips to detect and quantify cancer sequences in a particular cell. Alternatively, PCR can be used. Thus, a series, e.g., wells of a microtiter plate, can be used with dispensed primers in desired wells. A PCR reaction can then be performed and analyzed for each well.

[0578] Expression monitoring is performed to identify compounds that modify the expression of one or more cancer-associated sequences, e.g., a polynucleotide sequence set out in FIG. 2. Generally, a test modulator is added to the cells prior to analysis. Moreover, screens are also provided to identify agents that modulate cancer, modulate cancer proteins of the invention, bind to a cancer protein of the invention, or interfere with the binding of a cancer protein of the invention and an antibody or other binding partner.

[0579] In one embodiment, high throughput screening methods involve providing a library containing a large number of potential therapeutic compounds (candidate compounds). Such “combinatorial chemical libraries” are then screened in one or more assays to identify those library members (particular chemical species or subclasses) that display a desired characteristic activity. The compounds thus identified can serve as conventional “lead compounds,” as compounds for screening, or as therapeutics.

[0580] In certain embodiments, combinatorial libraries of potential modulators are screened for an ability to bind to a cancer polypeptide or to modulate activity. Conventionally, new chemical entities with useful properties are generated by identifying a chemical compound (called a “lead compound”) with some desirable property or activity, e.g., inhibiting activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds. Often, high throughput screening (HTS) methods are employed for such an analysis.

[0581] As noted above, gene expression monitoring is conveniently used to test candidate modulators (e.g., protein, nucleic acid or small molecule). After the candidate agent has been added and the cells allowed to incubate for a period, the sample containing a target sequence to be analyzed is, e.g., added to a biochip.

[0582] If required, the target sequence is prepared using known techniques. For example, a sample is treated to lyse the cells, using known lysis buffers, electroporation, etc., with purification and/or amplification such as PCR performed as appropriate. For example, an in vitro transcription with labels covalently attached to the nucleotides is performed. Generally, the nucleic acids are labeled with biotin-FITC or PE, or with cy3 or cy5.

[0583] The target sequence can be labeled with, e.g., a fluorescent, a chemiluminescent, a chemical, or a radioactive signal, to provide a means of detecting the target sequence's specific binding to a probe. The label also can be an enzyme, such as alkaline phosphatase or horseradish peroxidase, which when provided with an appropriate substrate produces a product that is detected. Alternatively, the label is a labeled compound or small molecule, such as an enzyme inhibitor, that binds but is not catalyzed or altered by the enzyme. The label also can be a moiety or compound, such as, an epitope tag or biotin which specifically binds to streptavidin. For the example of biotin, the streptavidin is labeled as described above, thereby, providing a detectable signal for the bound target sequence. Unbound labeled streptavidin is typically removed prior to analysis.

[0584] As will be appreciated by those in the art, these assays can be direct hybridization assays or can comprise “sandwich assays”, which include the use of multiple probes, as is generally outlined in U.S. Pat. Nos. 5,681,702; 5,597,909; 5,545,730; 5,594,117; 5,591,584; 5,571,670; 5,580,731; 5,571,670; 5,591,584; 5,624,802; 5,635,352; 5,594,118; 5,359,100; 5,124,246; and 5,681,697. In this embodiment, in general, the target nucleic acid is prepared as outlined above, and then added to the biochip comprising a plurality of nucleic acid probes, under conditions that allow the formation of a hybridization complex.

[0585] A variety of hybridization conditions are used in the present invention, including high, moderate and low stringency conditions as outlined above. The assays are generally run under stringency conditions which allow formation of the label probe hybridization complex only in the presence of target. Stringency can be controlled by altering a step parameter that is a thermodynamic variable, including, but not limited to, temperature, formamide concentration, salt concentration, chaotropic salt concentration pH, organic solvent concentration, etc. These parameters may also be used to control non-specific binding, as is generally outlined in U.S. Pat. No. 5,681,697. Thus, it can be desirable to perform certain steps at higher stringency conditions to reduce non-specific binding.

[0586] The reactions outlined herein can be accomplished in a variety of ways. Components of the reaction can be added simultaneously, or sequentially, in different orders, with preferred embodiments outlined below. In addition, the reaction may include a variety of other reagents. These include salts, buffers, neutral proteins, e.g. albumin, detergents, etc. which can be used to facilitate optimal hybridization and detection, and/or reduce nonspecific or background interactions. Reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc., may also be used as appropriate, depending on the sample preparation methods and purity of the target. The assay data are analyzed to determine the expression levels of individual genes, and changes in expression levels as between states, forming a gene expression profile.

[0587] Biological Activity-related Assays

[0588] The invention provides methods identify or screen for a compound that modulates the activity of a cancer-related gene or protein of the invention. The methods comprise adding a test compound, as defined above, to a cell comprising a cancer protein of the invention. The cells contain a recombinant nucleic acid that encodes a cancer protein of the invention. In another embodiment, a library of candidate agents is tested on a plurality of cells.

[0589] In one aspect, the assays are evaluated in the presence or absence or previous or subsequent exposure of physiological signals, e.g. hormones, antibodies, peptides, antigens, cytokines, growth factors, action potentials, pharmacological agents including chemotherapeutics, radiation, carcinogenics, or other cells (i.e., cell-cell contacts). In another example, the determinations are made at different stages of the cell cycle process. In this way, compounds that modulate genes or proteins of the invention are identified. Compounds with pharmacological activity are able to enhance or interfere with the activity of the cancer protein of the invention. Once identified, similar structures are evaluated to identify critical structural features of the compound.

[0590] In one embodiment, a method of modulating (e.g., inhibiting) cancer cell division is provided; the method comprises administration of a cancer modulator. In another embodiment, a method of modulating (e.g., inhibiting) cancer is provided; the method comprises administration of a cancer modulator. In a further embodiment, methods of treating cells or individuals with cancer are provided; the method comprises administration of a cancer modulator.

[0591] In one embodiment, a method for modulating the status of a cell that expresses a gene of the invention is provided. As used herein status comprises such art-accepted parameters such as growth, proliferation, survival, function, apoptosis, senescence, location, enzymatic activity, signal transduction, etc. of a cell. In one embodiment, a cancer inhibitor is an antibody as discussed above. In another embodiment, the cancer inhibitor is an antisense molecule. A variety of cell growth, proliferation, and metastasis assays are known to those of skill in the art, as described herein.

[0592] High Throughput Screening to Identify Modulators

[0593] The assays to identify suitable modulators are amenable to high throughput screening. Preferred assays thus detect enhancement or inhibition of cancer gene transcription, inhibition or enhancement of polypeptide expression, and inhibition or enhancement of polypeptide activity.

[0594] In one embodiment, modulators evaluated in high throughput screening methods are proteins, often naturally occurring proteins or fragments of naturally occurring proteins. Thus, e.g., cellular extracts containing proteins, or random or directed digests of proteinaceous cellular extracts, are used. In this way, libraries of proteins are made for screening in the methods of the invention. Particularly preferred in this embodiment are libraries of bacterial, fungal, viral, and mammalian proteins, with the latter being preferred, and human proteins being especially preferred. Particularly useful test compound will be directed to the class of proteins to which the target belongs, e.g., substrates for enzymes, or ligands and receptors.

[0595] Use of Soft Agar Growth and Colony Formation to Identify and Characterize Modulators

[0596] Normal cells require a solid substrate to attach and grow. When cells are transformed, they lose this phenotype and grow detached from the substrate. For example, transformed cells can grow in stirred suspension culture or suspended in semi-solid media, such as semi-solid or soft agar. The transformed cells, when transfected with tumor suppressor genes, can regenerate normal phenotype and once again require a solid substrate to attach to and grow. Soft agar growth or colony formation in assays are used to identify modulators of cancer sequences, which when expressed in host cells, inhibit abnormal cellular proliferation and transformation. A modulator reduces or eliminates the host cells' ability to grow suspended in solid or semisolid media, such as agar.

[0597] Techniques for soft agar growth or colony formation in suspension assays are described in Freshney, Culture of Animal Cells a Manual of Basic Technique (3rd ed., 1994). See also, the methods section of Garkavtsev et al. (1996), supra.

[0598] Evaluation of Contact Inhibition and Growth Density Limitation to Identify and Characterize Modulators

[0599] Normal cells typically grow in a flat and organized pattern in cell culture until they touch other cells. When the cells touch one another, they are contact inhibited and stop growing. Transformed cells, however, are not contact inhibited and continue to grow to high densities in disorganized foci. Thus, transformed cells grow to a higher saturation density than corresponding normal cells. This is detected morphologically by the formation of a disoriented monolayer of cells or cells in foci. Alternatively, labeling index with (3H)-thymidine at saturation density is used to measure density limitation of growth, similarly an MTT or Alamar blue assay will reveal proliferation capacity of cells and the the ability of modulators to affect same. See Freshney (1994), supra. Transformed cells, when transfected with tumor suppressor genes, can regenerate a normal phenotype and become contact inhibited and would grow to a lower density.

[0600] In this assay, labeling index with 3H)-thymidine at saturation density is a preferred method of measuring density limitation of growth. Transformed host cells are transfected with a cancer-associated sequence and are grown for 24 hours at saturation density in non-limiting medium conditions. The percentage of cells labeling with (3H)-thymidine is determined by incorporated cpm.

[0601] Contact independent growth is used to identify modulators of cancer sequences, which had led to abnormal cellular proliferation and transformation. A modulator reduces or eliminates contact independent growth, and returns the cells to a normal phenotype.

[0602] Evaluation of Growth Factor or Serum Dependence to Identify and Characterize Modulators

[0603] Transformed cells have lower serum dependence than their normal counterparts (see, e.g., Temin, J. Natl. Cancer Inst. 37:167-175 (1966); Eagle et al., J. Exp. Med 131:836-879 (1970)); Freshney, supra. This is in part due to release of various growth factors by the transformed cells. The degree of growth factor or serum dependence of transformed host cells can be compared with that of control. For example, growth factor or serum dependence of a cell is monitored in methods to identify and characterize compounds that modulate cancer-associated sequences of the invention.

[0604] Use of Tumor-specific Marker Levels to Identify and Characterize Modulators

[0605] Tumor cells release an increased amount of certain factors (hereinafter “tumor specific markers”) than their normal counterparts. For example, plasminogen activator (PA) is released from human glioma at a higher level than from normal brain cells (see, e.g., Gullino, Angiogenesis, Tumor Vascularization, and Potential Interference with Tumor Growth, in Biological Responses in Cancer, pp. 178-184 (Mihich (ed.) 1985)). Similarly, Tumor Angiogenesis Factor (TAF) is released at a higher level in tumor cells than their normal counterparts. See, e.g., Folkman, Angiogenesis and Cancer, Sem Cancer Biol. (1992)), while bFGF is released from endothelial tumors (Ensoli, B et al).

[0606] Various techniques which measure the release of these factors are described in Freshney (1994), supra. Also, see, Unkless et al., J. Biol. Chem. 249:4295-4305 (1974); Strickland & Beers, J. Biol. Chem. 251:5694-5702 (1976); Whur et al., Br. J. Cancer 42:305 312 (1980);, Gullino, Angiogenesis, Tumor Vascularization; and Potential Interference with Tumor Growth, in Biological Responses in Cancer, pp. 178-184 (Mihich (ed.) 1985); Freshney, Anticancer Res. 5:111-130 (1985). For example, tumor specific marker levels are monitored in methods to identify and characterize compounds that modulate cancer-associated sequences of the invention.

[0607] Invasiveness into Matrigel to Identify and Characterize Modulators

[0608] The degree of invasiveness into Matrigel or an extracellular matrix constituent can be used as an assay to identify and characterize compounds that modulate cancer associated sequences. Tumor cells exhibit a positive correlation between malignancy and invasiveness of cells into Matrigel or some other extracellular matrix constituent. In this assay, tumorigenic cells are typically used as host cells. Expression of a tumor suppressor gene in these host cells would decrease invasiveness of the host cells. Techniques described in Cancer Res. 1999; 59:6010; Freshney (1994), supra, can be used. Briefly, the level of invasion of host cells is measured by using filters coated with Matrigel or some other extracellular matrix constituent. Penetration into the gel, or through to the distal side of the filter, is rated as invasiveness, and rated histologically by number of cells and distance moved, or by prelabeling the cells with 1251 and counting the radioactivity on the distal side of the filter or bottom of the dish. See, e.g., Freshney (1984), supra.

[0609] Evaluation of Tumor Growth In Vivo to Identify and Characterize Modulators

[0610] Effects of cancer-associated sequences on cell growth are tested in transgenic or immune-suppressed organisms. Transgenic organisms are prepared in a variety of art-accepted ways. For example, knock-out transgenic organisms, e.g., mammals such as mice, are made, in which a cancer gene is disrupted or in which a cancer gene is inserted. Knock-out transgenic mice are made by insertion of a marker gene or other heterologous gene into the endogenous cancer gene site in the mouse genome via homologous recombination. Such mice can also be made by substituting the endogenous cancer gene with a mutated version of the cancer gene, or by mutating the endogenous cancer gene, e.g., by exposure to carcinogens.

[0611] To prepare transgenic chimeric animals, e.g., mice, a DNA construct is introduced into the nuclei of embryonic stem cells. Cells containing the newly engineered genetic lesion are injected into a host mouse embryo, which is re-implanted into a recipient female. Some of these embryos develop into chimeric mice that possess germ cells some of which are derived from the mutant cell line. Therefore, by breeding the chimeric mice it is possible to obtain a new line of mice containing the introduced genetic lesion (see, e.g., Capecchi et al., Science 244:1288 (1989)). Chimeric mice can be derived according to U.S. Pat. No. 6,365,797, issued 2 Apr. 2002; U.S. Pat. No. 6,107,540 issued 22 Aug. 2000; Hogan et al., Manipulating the Mouse Embryo: A laboratory Manual, Cold Spring Harbor Laboratory (1988) and Teratocarcinomas and Embryonic Stem Cells: A Practical Approach, Robertson, ed., IRL Press, Washington, D.C., (1987).

[0612] Alternatively, various immune-suppressed or immune-deficient host animals can be used. For example, a genetically athymic “nude” mouse (see, e.g., Giovanella et al., J. Natl. Cancer Inst. 52:921 (1974)), a SCID mouse, a thymectornized mouse, or an irradiated mouse (see, e.g., Bradley et al., Br. J. Cancer 38:263 (1978); Selby et al., Br. J. Cancer 41:52 (1980)) can be used as a host. Transplantable tumor cells (typically about 106 cells) injected into isogenic hosts produce invasive tumors in a high proportion of cases, while normal cells of similar origin will not. In hosts which developed invasive tumors, cells expressing cancer-associated sequences are injected subcutaneously or orthotopically. Mice are then separated into groups, including control groups and treated experimental groups) e.g. treated with a modulator). After a suitable length of time, preferably 4-8 weeks, tumor growth is measured (e.g., by volume or by its two largest dimensions, or weight) and compared to the control. Tumors that have statistically significant reduction (using, e.g., Student's T test) are said to have inhibited growth,

[0613] In Vitro Assays to Identify and Characterize Modulators

[0614] Assays to identify compounds with modulating activity can be performed in vitro. For example, a cancer polypeptide is first contacted with a potential modulator and incubated for a suitable amount of time, e.g., from 0.5 to 48 hours. In one embodiment, the cancer polypeptide levels are determined in vitro by measuring the level of protein or mRNA. The level of protein is measured using immunoassays such as Western blotting, ELISA and the like with an antibody that selectively binds to the cancer polypeptide or a fragment thereof. For measurement of mRNA, amplification, e.g., using PCR, LCR, or hybridization assays, e. g., Northern hybridization, RNAse protection, dot blotting, are preferred. The level of protein or mRNA is detected using directly or indirectly labeled detection agents, e.g., fluorescently or radioactively labeled nucleic acids, radioactively or enzymatically labeled antibodies, and the like, as described herein.

[0615] Alternatively, a reporter gene system can be devised using a cancer protein promoter operably linked to a reporter gene such as luciferase, green fluorescent protein, CAT, or P-gal. The reporter construct is typically transfected into a cell. After treatment with a potential modulator, the amount of reporter gene transcription, translation, or activity is measured according to standard techniques known to those of skill in the art (Davis G F, supra; Gonzalez, J. & Negulescu, P. Curr. Opin. Biotechnol. 1998: 9:624).

[0616] As outlined above, in vitro screens are done on individual genes and gene products. That is, having identified a particular differentially expressed gene as important in a particular state, screening of modulators of the expression of the gene or the gene product itself is performed.

[0617] In one embodiment, screening for modulators of expression of specific gene(s) is performed. Typically, the expression of only one or a few genes is evaluated. In another embodiment, screens are designed to first find compounds that bind to differentially expressed proteins. These compounds are then evaluated for the ability to modulate differentially expressed activity. Moreover, once initial candidate compounds are identified, variants can be further screened to better evaluate structure activity relationships.

[0618] Binding Assays to Identify and Characterize Modulators

[0619] In binding assays in accordance with the invention, a purified or isolated gene product of the invention is generally used. For example, antibodies are generated to a protein of the invention, and immunoassays are run to determine the amount and/or location of protein. Alternatively, cells comprising the cancer proteins are used in the assays.

[0620] Thus, the methods comprise combining a cancer protein of the invention and a candidate compound such as a ligand, and determining the binding of the compound to the cancer protein of the invention. Preferred embodiments utilize the human cancer protein; animal models of human disease of can also be developed and used. Also, other analogous mammalian proteins also can be used as appreciated by those of skill in the art. Moreover, in some embodiments variant or derivative cancer proteins are used.

[0621] Generally, the cancer protein of the invention, or the ligand, is non-diffusibly bound to an insoluble support. The support can, e.g., be one having isolated sample receiving areas (a microtiter plate, an array, etc.). The insoluble supports can be made of any composition to which the compositions can be bound, is readily separated from soluble material, and is otherwise compatible with the overall method of screening. The surface of such supports can be solid or porous and of any convenient shape.

[0622] Examples of suitable insoluble supports include microtiter plates, arrays, membranes and beads. These are typically made of glass, plastic (e.g., polystyrene), polysaccharide, nylon, nitrocellulose, or Teflon™, etc. Microtiter plates and arrays are especially convenient because a large number of assays can be carried out simultaneously, using small amounts of reagents and samples. The particular manner of binding of the composition to the support is not crucial so long as it is compatible with the reagents and overall methods of the invention, maintains the activity of the composition and is nondiffusable. Preferred methods of binding include the use of antibodies which do not sterically block either the ligand binding site or activation sequence when attaching the protein to the support, direct binding to “sticky” or ionic supports, chemical crosslinking, the synthesis of the protein or agent on the surface, etc. Following binding of the protein or ligand/binding agent to the support, excess unbound material is removed by washing. The sample receiving areas may then be blocked through incubation with bovine serum albumin (BSA), casein or other innocuous protein or other moiety.

[0623] Once a cancer protein of the invention is bound to the support, and a test compound is added to the assay. Alternatively, the candidate binding agent is bound to the support and the cancer protein of the invention is then added. Binding agents include specific antibodies, non-natural binding agents identified in screens of chemical libraries, peptide analogs, etc.

[0624] Of particular interest are assays to identify agents that have a low toxicity for human cells. A wide variety of assays can be used for this purpose, including proliferation assays, cAMP assays, labeled in vitro protein-protein binding assays, electrophoretic mobility shift assays, immunoassays for protein binding, functional assays (phosphorylation assays, etc.) and the like.

[0625] A determination of binding of the test compound (ligand, binding agent, modulator, etc.) to a cancer protein of the invention can be done in a number of ways. The test compound can be labeled, and binding determined directly, e.g., by attaching all or a portion of the cancer protein of the invention to a solid support, adding a labeled candidate compound (e.g., a fluorescent label), washing off excess reagent, and determining whether the label is present on the solid support. Various blocking and washing steps can be utilized as appropriate.

[0626] In certain embodiments, only one of the components is labeled, e.g., a protein of the invention or ligands labeled. Alternatively, more than one component is labeled with different labels, e.g., I125, for the proteins and a fluorophor for the compound. Proximity reagents, e.g., quenching or energy transfer reagents are also useful.

[0627] Competitive Binding to Identify and Characterize Modulators

[0628] In one embodiment, the binding of the “test compound” is determined by competitive binding assay with a “competitor.” The competitor is a binding moiety that binds to the target molecule (e.g., a cancer protein of the invention). Competitors include compounds such as antibodies, peptides, binding partners, ligands, etc. Under certain circumstances, the competitive binding between the test compound and the competitor displaces the test compound. In one embodiment, the test compound is labeled. Either the test compound, the competitor, or both, is added to the protein for a time sufficient to allow binding. Incubations are performed at a temperature that facilitates optimal activity, typically between four and 40° C. Incubation periods are typically optimized, e.g., to facilitate rapid high throughput screening; typically between zero and one hour will be sufficient. Excess reagent is generally removed or washed away. The second component is then added, and the presence or absence of the labeled component is followed, to indicate binding.

[0629] In one embodiment, the competitor is added first, followed by the test compound. Displacement of the competitor is an indication that the test compound is binding to the cancer protein and thus is capable of binding to, and potentially modulating, the activity of the cancer protein. In this embodiment, either component can be labeled. Thus, e.g., if the competitor is labeled, the presence of label in the post-test compound wash solution indicates displacement by the test compound. Alternatively, if the test compound is labeled, the presence of the label on the support indicates displacement.

[0630] In an alternative embodiment, the test compound is added first, with incubation and washing, followed by the competitor. The absence of binding by the competitor indicates that the test compound binds to the cancer protein with higher affinity than the competitor. Thus, if the test compound is labeled, the presence of the label on the support, coupled with a lack of competitor binding, indicates that the test compound binds to and thus potentially modulates the cancer protein of the invention.

[0631] Accordingly, the competitive binding methods comprise differential screening to identity agents that are capable of modulating the activity of the cancer proteins of the invention. In this embodiment, the methods comprise combining a cancer protein and a competitor in a first sample. A second sample comprises a test compound, the cancer protein, and a competitor. The binding of the competitor is determined for both samples, and a change, or difference in binding between the two samples indicates the presence of an agent capable of binding to the cancer protein and potentially modulating its activity. That is, if the binding of the competitor is different in the second sample relative to the first sample, the agent is capable of binding to the cancer protein.

[0632] Alternatively, differential screening is used to identify drug candidates that bind to the native cancer protein, but cannot bind to modified cancer proteins. For example the structure of the cancer protein is modeled and used in rational drug design to synthesize agents that interact with that site, agents which generally do not bind to site-modified proteins. Moreover, such drug candidates that affect the activity of a native cancer protein are also identified by screening drugs for the ability to either enhance or reduce the activity of such proteins.

[0633] Positive controls and negative controls can be used in the assays. Preferably control and test samples are performed in at least triplicate to obtain statistically significant results. Incubation of all samples occurs for a time sufficient to allow for the binding of the agent to the protein. Following incubation, samples are washed free of non-specifically bound material and the amount of bound, generally labeled agent determined. For example, where a radiolabel is employed, the samples can be counted in a scintillation counter to determine the amount of bound compound.

[0634] A variety of other reagents can be included in the screening assays. These include reagents like salts, neutral proteins, e.g. albumin, detergents, etc. which are used to facilitate optimal protein-protein binding and/or reduce non-specific or background interactions. Also reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc., can be used. The mixture of components is added in an order that provides for the requisite binding.

[0635] Use of Polynucleotides to Down-regulate or Inhibit a Protein of the Invention.

[0636] Polynucleotide modulators of cancer can be introduced into a cell containing the target nucleotide sequence by formation of a conjugate with a ligand-binding molecule, as described in WO 91/04753. Suitable ligand-binding molecules include, but are not limited to, cell surface receptors, growth factors, other cytokines, or other ligands that bind to cell surface receptors. Preferably, conjugation of the ligand binding molecule does not substantially interfere with the ability of the ligand binding molecule to bind to its corresponding molecule or receptor, or block entry of the sense or anti sense oligonucleotide or its conjugated version into the cell. Alternatively, a polynucleotide modulator of cancer can be introduced into a cell containing the target nucleic acid sequence, e.g., by formation of a polynucleotide-lipid complex, as described in WO 90/10448. It is understood that the use of antisense molecules or knock out and knock in models may also be used in screening assays as discussed above, in addition to methods of treatment.

[0637] Inhibitory and Antisense Nucleotides

[0638] In certain embodiments, the activity of a cancer-associated protein is down-regulated, or entirely inhibited, by the use of antisense polynucleotide or inhibitory small nuclear RNA (snRNA), i.e., a nucleic acid complementary to, and which can preferably hybridize specifically to, a coding mRNA nucleic acid sequence, e.g., a cancer protein of the invention, mRNA, or a subsequence thereof. Binding of the antisense polynucleotide to the mRNA reduces the translation and/or stability of the mRNA.

[0639] In the context of this invention, antisense polynucleotides can comprise naturally occurring nucleotides, or synthetic species formed from naturally occurring subunits or their close homologs. Antisense polynucleotides may also have altered sugar moieties or inter-sugar linkages. Exemplary among these are the phosphorothioate and other sulfur containing species which are known for use in the art. Analogs are comprised by this invention so long as they function effectively to hybridize with nucleotides of the invention. See, e.g., Isis Pharmaceuticals, Carlsbad, Calif.; Sequitor, Inc., Natick, Mass.

[0640] Such antisense polynucleotides can readily be synthesized using recombinant means, or can be synthesized in vitro. Equipment for such synthesis is sold by several vendors, including Applied Biosystems. The preparation of other oligonucleotides such as phosphorothioates and alkylated derivatives is also well known to those of skill in the art.

[0641] Antisense molecules as used herein include antisense or sense oligonucleotides. Sense oligonucleotides can, e.g., be employed to block transcription by binding to the anti-sense strand. The antisense and sense oligonucleotide comprise a single stranded nucleic acid sequence (either RNA or DNA) capable of binding to target mRNA (sense) or DNA (antisense) sequences for cancer molecules. Antisense or sense oligonucleotides, according to the present invention, comprise a fragment generally at least about 12 nucleotides, preferably from about 12 to 30 nucleotides. The ability to derive an antisense or a sense oligonucleotide, based upon a cDNA sequence encoding a given protein is described in, e.g., Stein & Cohen (Cancer Res. 48:2659 (1988 and van der Krol et al. (BioTechniques 6:958 (1988)).

[0642] Ribozymes

[0643] In addition to antisense polynucleotides, ribozymes can be used to target and inhibit transcription of cancer-associated nucleotide sequences. A ribozyme is an RNA molecule that catalytically cleaves other RNA molecules. Different kinds of ribozymes have been described, including group I ribozymes, hammerhead ribozymes, hairpin ribozymes, RNase P, and axhead ribozymes (see, e.g., Castanotto et al., Adv. in Pharmacology 25: 289-317 (1994) for a general review of the properties of different ribozymes).

[0644] The general features of hairpin ribozymes are described, e.g., in Hampel et al., Nucl. Acids Res. 18:299-304 (1990); European Patent Publication No. 0360257; U.S. Pat. No. 5,254,678. Methods of preparing are well known to those of skill in the art (see, e.g., WO 94/26877; Ojwang et al., Proc. Natl. Acad. Sci. USA 90:6340-6344 (1993); Yamada et al., Human Gene Therapy 1:39-45 (1994); Leavitt et al., Proc. Natl. Acad Sci. USA 92:699-703 (1995); Leavitt et al., Human Gene Therapy 5: 1151-120 (1994); and Yamada et al., Virology 205: 121-126 (1994)).

[0645] Use of Modulators in Phenotypic Screening

[0646] In one embodiment, a test compound is administered to a population of cancer cells, which have an associated cancer expression profile. By “administration” or “contacting” herein is meant that the modulator is added to the cells in such a manner as to allow the modulator to act upon the cell, whether by uptake and intracellular action, or by action at the cell surface. In some embodiments, a nucleic acid encoding a proteinaceous agent (i.e., a peptide) is put into a viral construct such as an adenoviral or retroviral construct, and added to the cell, such that expression of the peptide agent is accomplished, e.g., PCT US97/01019. Regulatable gene therapy systems can also be used. Once the modulator has been administered to the cells, the cells are washed if desired and are allowed to incubate under preferably physiological conditions for some period. The cells are then harvested and a new gene expression profile is generated. Thus, e.g., cancer tissue is screened for agents that modulate, e.g., induce or suppress, the cancer phenotype. A change in at least one gene, preferably many, of the expression profile indicates that the agent has an effect on cancer activity. Similarly, altering a biological function or a signaling pathway is indicative of modulator activity. By defining such a signature for the cancer phenotype, screens for new drugs that alter the phenotype are devised. With this approach, the drug target need not be known and need not be represented in the original gene/protein expression screening platform, nor does the level of transcript for the target protein need to change. The modulator inhibiting function will serve as a surrogate marker As outlined above, screens are done to assess genes or gene products. That is, having identified a particular differentially expressed gene as important in a particular state, screening of modulators of either the expression of the gene or the gene product itself is performed.

[0647] Use of Modulators to Affect Peptides of the Invention

[0648] Measurements of cancer polypeptide activity, or of the cancer phenotype are performed using a variety of assays. For example, the effects of modulators upon the function of a cancer polypeptide(s) are measured by examining parameters described above. A physiological change that affects activity is used to assess the influence of a test compound on the polypeptides of this invention. When the functional outcomes are determined using intact cells or animals, a variety of effects can be assesses such as, in the case of a cancer associated with solid tumors, tumor growth, tumor metastasis, neovascularization, hormone release, transcriptional changes to both known and uncharacterized genetic markers (e.g., by Northern blots), changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as cGNIP.

[0649] Methods of Identifying Characterizing Cancer-associated Sequences

[0650] Expression of various gene sequences is correlated with cancer. Accordingly, disorders based on mutant or variant cancer genes are determined. In one embodiment, the invention provides methods for identifying cells containing variant cancer genes, e.g., determining the presence of, all or part, the sequence of at least one endogenous cancer gene in a cell. This is accomplished using any number of sequencing techniques. The invention comprises methods of identifying the cancer genotype of an individual, e.g., determining all or part of the sequence of at least one gene of the invention in the individual. This is generally done in at least one tissue of the individual, e.g., a tissue set forth in Table I, and may include the evaluation of a number of tissues or different samples of the same tissue. The method may include comparing the sequence of the sequenced gene to a known cancer gene, i.e., a wild-type gene to determine the presence of family members, homologies, mutations or variants. The sequence of all or part of the gene can then be compared to the sequence of a known cancer gene to determine if any differences exist. This is done using any number of known homology programs, such as BLAST, Bestfit, etc. The presence of a difference in the sequence between the cancer gene of the patient and the known cancer gene correlates with a disease state or a propensity for a disease state, as outlined herein.

[0651] In a preferred embodiment, the cancer genes are used as probes to determine the number of copies of the cancer gene in the genome. The cancer genes are used as probes to determine the chromosomal localization of the cancer genes. Information such as chromosomal localization finds use in providing a diagnosis or prognosis in particular when chromosomal abnormalities such as translocations, and the like are identified in the cancer gene locus.

[0652] XIV.) Kits/Articles of Manufacture

[0653] For use in the diagnostic and therapeutic applications described herein, kits are also within the scope of the invention. Such kits can comprise a carrier, package, or container that is compartmentalized to receive one or more containers such as vials, tubes, and the like, each of the container(s) comprising one of the separate elements to be used in the method. For example, the container(s) can comprise a probe that is or can be detectably labeled. Such probe can be an antibody or polynucleotide specific for a FIG. 2-related protein or a FIG. 2 gene or message, respectively. Where the method utilizes nucleic acid hybridization to detect the target nucleic acid, the kit can also have containers containing nucleotide(s) for amplification of the target nucleic acid sequence and/or a container comprising a reporter-means, such as a biotin-binding protein, such as avidin or streptavidin, bound to a reporter molecule, such as an enzymatic, florescent, or radioisotope label. The kit can include all or part of the amino acid sequences in FIG. 2 or FIG. 3 or analogs thereof, or a nucleic acid molecules that encodes such amino acid sequences.

[0654] The kit of the invention will typically comprise the container described above and one or more other containers comprising materials desirable from a commercial and user standpoint, including buffers, diluents, filters, needles, syringes; carrier, package, container, vial and/or tube labels listing contents and/or instructions for use, and package inserts with instructions for use.

[0655] A label can be present on the container to indicate that the composition is used for a specific therapy or non-therapeutic application, such as a diagnostic or laboratory application, and can also indicate directions for either in vivo or in vitro use, such as those described herein. Directions and or other information can also be included on an insert(s) or label(s) which is included with or on the kit.

[0656] The terms “kit” and “article of manufacture” can be used as synonyms.

[0657] In another embodiment of the invention, an article(s) of manufacture containing compositions, such as amino acid sequence(s), small molecule(s), nucleic acid sequence(s), and/or antibody(s), e.g., materials useful for the diagnosis, prognosis, prophylaxis and/or treatment of neoplasias of tissues such as those set forth in Table I is provided. The article of manufacture typically comprises at least one container and at least one label. Suitable containers include, for example, bottles, vials, syringes, and test tubes. The containers can be formed from a variety of materials such as glass or plastic. The container can hold amino acid sequence(s), small molecule(s), nucleic acid sequence(s), and/or antibody(s), in one embodiment the container holds a polynucleotide for use in examining the mRNA expression profile of a cell, together with reagents used for this purpose.

[0658] The container can alternatively hold a composition which is effective for treating, diagnosis, prognosing or prophylaxing a condition and can have a sterile access port (for example the container can be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The active agents in the composition can be an antibody capable of specifically binding 191P4D12(b) and modulating the function of 191P4D12(b).

[0659] The label can be on or associated with the container. A label a can be on a container when letters, numbers or other characters forming the label are molded or etched into the container itself; a label can be associated with a container when it is present within a receptacle or carrier that also holds the container, e.g., as a package insert. The label can indicate that the composition is used for diagnosing, treating, prophylaxing or prognosing a condition, such as a neoplasia of a tissue set forth in Table I. The article of manufacture can further comprise a second container comprising a pharmaceutically-acceptable buffer, such as phosphate-buffered saline, Ringer's solution and/ordextrose solution. It can further include other materials desirable from a commercial and user standpoint, including other buffers, diluents, filters, stirrers, needles, syringes, and/or package inserts with indications and/or instructions for use.

EXAMPLES

[0660] Various aspects of the invention are further described and illustrated by way of the several examples that follow, none of which are intended to limit the scope of the invention.

Example 1 SSH-Generated Isolation of cDNA Fragment of the 191P4D12(b) Gene

[0661] To isolate genes that are over-expressed in prostate cancer we used the Suppression Subtractive Hybridization (SSH) procedure using cDNA derived from prostate cancer tissues. The 191P4D12(b) SSH cDNA sequence was derived from bladder tumor minus cDNAs derived from a pool of 9 normal tissues. The 191P4D12(b) cDNA was identified as highly expressed in the bladder cancer.

Materials and Methods

[0662] Human Tissues:

[0663] The patient cancer and normal tissues were purchased from different sources such as the NDRI (Philadelphia, Pa.). mRNA for some normal tissues were purchased from Clontech, Palo Alto, Calif.

[0664] RNA Isolation:

[0665] Tissues were homogenized in Trizol reagent (Life Technologies, Gibco BRL) using 10 ml/g tissue isolate total RNA. Poly A RNA was purified from total RNA using Qiagen's Oligotex mRNA Mini and Midi kits. Total and mRNA were quantified by spectrophotometric analysis (O.D. 260/280 nm) and analyzed by gel electrophoresis.

[0666] Oligonucleotides:

[0667] The following HPLC purified oligonucleotides were used. 2 DPNGDN (cDNA synthesis primer): 5′TTTTGATCAAGCTT303′ (SEQ ID NO: 48) Adaptor 1: 5′CTMTACGACTCACTATAGGGCTCGAGCGGGCGCCCGGGCAG3′ (SEQ ID NO: 49) 3′GGCCCGTCCTAG5′ (SEQ ID NO: 50) Adaptor 2: 5′GTAATACGACTCACTATAGGGCAGCGTGGTCGCGGCCGAG3′ (SEQ ID NO: 51) 3′CGGCTCCTAG5′ (SEQ ID NO: 52) POR primer 1: 5′CTAATACGACTCACTATAGGGC3′ (SEQ ID NO: 53) Nested primer (NP)1: 5′TGGAGCGGCCGCCCGGGCAGGA3′ (SEQ ID NO: 54) Nested primer (NP)2: 5′AGCGTGGTCGCGGGGGAGGA3′ (SEQ ID NO: 55)

[0668] Suppression Subtractive Hybridization:

[0669] Suppression Subtractive Hybridization (SSH) was used to identify cDNAs corresponding to genes that may be differentially expressed in bladder cancer. The SSH reaction utilized cDNA from bladder cancer and normal tissues.

[0670] The gene 191P4D12(b) sequence was derived from bladder cancer minus normal tissue cDNA subtraction. The SSH DNA sequence (FIG. 1) was identified.

[0671] The cDNA derived from of pool of normal tissues was used as the source of the “driver” cDNA, while the cDNA from bladder cancer was used as the source of the “tester” cDNA. Double stranded cDNAs corresponding to tester and driver cDNAs were synthesized from 2 &mgr;g of poly(A)+ RNA isolated from the relevant xenograft tissue, as described above, using CLONTECH's PCR-Select cDNA Subtraction Kit and 1 ng of oligonucleotide DPNCDN as primer. First- and second-strand synthesis were carried out as described in the Kit's user manual protocol (CLONTECH Protocol No. PT1117-1, Catalog No. K1804-1). The resulting cDNA was digested with Dpn II for 3 hrs at 37° C. Digested cDNA was extracted with phenol/chloroform (1:1) and ethanol precipitated.

[0672] Driver cDNA was generated by combining in a 1:1 ratio Dpn II digested cDNA from the relevant tissue source (see above) with a mix of digested cDNAs derived from the nine normal tissues: stomach, skeletal muscle, lung, brain, liver, kidney, pancreas, small intestine, and heart.

[0673] Tester cDNA was generated by diluting 1 &mgr;l of Dpn II digested cDNA from the relevant tissue source (see above) (400 ng) in 5 &mgr;l of water. The diluted cDNA (2 &mgr;l, 160 ng) was then ligated to 2 &mgr;l of Adaptor 1 and Adaptor 2 (10 &mgr;M), in separate ligation reactions, in a total volume of 10 &mgr;l at 16° C. overnight, using 400 u of T4 DNA ligase (CLONTECH). Ligation was terminated with 1 &mgr;l of 0.2 M EDTA and heating at 72° C. for 5 min.

[0674] The first hybridization was performed by adding 1.5 &mgr;l (600 ng) of driver cDNA to each of two tubes containing 1.5 &mgr;l (20 ng) Adaptor 1- and Adaptor 2-ligated tester cDNA. In a final volume of 4 &mgr;l, the samples were overlaid with mineral oil, denatured in an MJ Research thermal cycler at 98° C. for 1.5 minutes, and then were allowed to hybridize for 8 hrs at 68° C. The two hybridizations were then mixed together with an additional 1 &mgr;l of fresh denatured driver cDNA and were allowed to hybridize overnight at 68° C. The second hybridization was then diluted in 200 &mgr;l of 20 mM Hepes, pH 8.3, 50 mM NaCl, 0.2 mM EDTA, heated at 70° C. for 7 min. and stored at −20° C.

[0675] PCR Amplification, Cloning and Sequencing of Gene Fragments Generated from SSH:

[0676] To amplify gene fragments resulting from SSH reactions, two PCR amplifications were performed. In the primary PCR reaction 1 &mgr;l of the diluted final hybridization mix was added to 1 &mgr;l of PCR primer 1 (10 &mgr;M), 0.5 &mgr;l dNTP mix (10 &mgr;M), 2.5 &mgr;l 10× reaction buffer (CLONTECH) and 0.5 &mgr;l 50× Advantage cDNA polymerase Mix (CLONTECH) in a final volume of 25 &mgr;l. PCR 1 was conducted using the following conditions: 75° C. for 5 min., 94° C. for 25 sec., then 27 cycles of 94° C. for 10 sec, 66° C. for 30 sec, 72° C. for 1.5 min. Five separate primary PCR reactions were performed for each experiment. The products were pooled and diluted 1:10 with water. For the secondary PCR reaction, 1 &mgr;l from the pooled and diluted primary PCR reaction was added to the same reaction mix as used for PCR 1, except that primers NP1 and NP2 (10 &mgr;M) were used instead of PCR primer 1. PCR 2 was performed using 10-12 cycles of 94° C. for 10 sec, 68° C. for 30 sec, and 72° C. for 1.5 minutes. The PCR products were analyzed using 2% agarose gel electrophoresis.

[0677] The PCR products were inserted into pCR2.1 using the T/A vector cloning kit (Invitrogen). Transformed E. coli were subjected to blue/white and ampicillin selection. White colonies were picked and arrayed into 96 well plates and were grown in liquid culture overnight. To identify inserts, PCR amplification was performed on 1 &mgr;l of bacterial culture using the conditions of PCR1 and NP1 and NP2 as primers. PCR products were analyzed using 2% agarose gel electrophoresis.

[0678] Bacterial clones were stored in 20% glycerol in a 96 well format. Plasmid DNA was prepared, sequenced, and subjected to nucleic acid homology searches of the GenBank, dBest, and NCI-CGAP databases.

[0679] RT-PCR Expression Analysis:

[0680] First strand cDNAs can be generated from 1 &mgr;g of mRNA with oligo (dT)12-18 priming using the Gibco-BRL Superscript Preamplification system. The manufacturer's protocol was used which included an incubation for 50 min at 42° C. with reverse transcriptase followed by RNAse H treatment at 37° C. for 20 min. After completing the reaction, the volume can be increased to 200 &mgr;l with water prior to normalization. First strand cDNAs from 16 different normal human tissues can be obtained from Clontech.

[0681] Normalization of the first strand cDNAs from multiple tissues was performed by using the primers 5′atatcgccgcgctcgtcgtcgacaa3′ (SEQ ID NO: 56) and 5′agccacacgcagctcattgtagaagg 3′ (SEQ ID NO: 57) to amplify &bgr;-actin. First strand cDNA (5 &mgr;l) were amplified in a total volume of 50 &mgr;l containing 0.4 &mgr;M primers, 0.2 &mgr;M each dNTPs, 1×PCR buffer (Clontech, 10 mM Tris-HCL, 1.5 mM MgCl2, 50 mM KCl, pH8.3) and 1× Klentaq DNA polymerase (Clontech). Five &mgr;l of the POR reaction can be removed at 18, 20, and 22 cycles and used for agarose gel electrophoresis. PCR was performed using an MJ Research thermal cycler under the following conditions: Initial denaturation can be at 94° C. for 15 sec, followed by a 18, 20, and 22 cycles of 94° C. for 15, 65° C. for 2 min, 72° C. for 5 sec. A final extension at 72° C. was carried out for 2 min. After agarose gel electrophoresis, the band intensities of the 283 b.p. &bgr;-actin bands from multiple tissues were compared by visual inspection. Dilution factors for the first strand cDNAs were calculated to result in equal &bgr;-actin band intensities in all tissues after 22 cycles of PCR. Three rounds of normalization can be required to achieve equal band intensities in all tissues after 22 cycles of PCR.

[0682] To determine expression levels of the 191P4D12(b) gene, 5 &mgr;l of normalized first strand cDNA were analyzed by PCR using 26, and 30 cycles of amplification. Semi-quantitative expression analysis can be achieved by comparing the PCR products at cycle numbers that give light band intensities. The primers used for RT-PCR were designed using the 191P4D12(b) SSH sequence and are listed below: 3 191P4012(b).1 5′-GGCTGGAGTTCAATGAGGTTTATTT-3′ (SEQ ID NO: 58) 191 P4012(b)2 5′-TGCAGCAGATTTCAGACTAAGAAGA-3′ (SEQ ID NO: 59)

[0683] A typical RT-PCR expression analysis is shown in FIG. 14. First strand cDNA was prepared from vital pool 1 (liver, lung and kidney), vital pool 2 (pancreas, colon and stomach), normal kidney, prostate cancer pool, bladder cancer pool, colon cancer pool, lung cancer pool, breast cancer pool and cancer metastasis pool. Normalization was performed by PCR using primers to actin and GAPDH. Semi-quantitative PCR, using primers to 191P4D12(b), was performed at 26 and 30 cycles of amplification. Results show strong expression of 191P4D12(b) in bladder cancer pool. Expression of 191P4D12(b) was also detected in prostate cancer pool, colon cancer pool, lung cancer pool, breast cancer pool and cancer metastasis pool but very weakly in vital pool 1 and vital pool 2.

Example 2 Isolation of Full Length 191P4D12(b) Encoding cDNA

[0684] The 191P4D12(b) SSH cDNA sequence was derived from a subtraction consisting of bladder cancer minus a mixture of 9 normal tissues: stomach, skeletal muscle, lung, brain, liver, kidney, pancreas, small intestine and heart. The SSH cDNA sequence of 223 bp (FIG. 1) was designated 191P4D12(b).

[0685] 191P4D12(b) v.1 (clone 1A1) of 3464 bp was cloned from bladder cancer cDNA library, revealing an ORF of 510 amino acids (FIG. 2 and FIG. 3). Other variants of 191P4D12(b) were also identified and these are listed in FIGS. 2 and 3.

[0686] 191P4D12(b) v.1, v.2, v.10, v.11, and v.12 proteins are 510 amino acids in length and differ from each other by one amino acid as shown in FIG. 11. 191P4D12(b) v.3, v.4, v.5, and v.8 code for the same protein as 191P4D12(b) v.1. 191P4D12(b) v.6 and v.7 are splice variants and code for proteins of 295 and 485 amino acids, respectively. 191P4D12(b) v.13 clone 9C was cloned from bladder cancer cDNA and has one amino acid insertion at position 334 compared to 191P4D12(b) v.1. 191P4D12(b) v.9 clone BCP1 is a splice variant of 191P4D12(b) v.1 and was cloned from a bladder cancer cDNA library. 191P4D12(b) v.14 is a SNP variant and differs from 191P4D12(b) v.9 by one amino acid as shown in FIG. 2.

[0687] 191P4D12(b) v.1 shows 99% identity over 2744 to the Ig superfamily receptor LNIR (nectin-4), accession number NM—030916. 191P4D12(b) v.9 protein is 100% identical to clone AF218028 with function of inhibiting cancer cell growth.

Example 3 Chromosomal Mapping of 191P4D12(b)

[0688] Chromosomal localization can implicate genes in disease pathogenesis. Several chromosome mapping approaches are available including fluorescent in situ hybridization (FISH), human/hamster radiation hybrid (RH) panels (Walter et al., 1994; Nature Genetics 7:22; Research Genetics, Huntsville Ala.), human-rodent somatic cell hybrid panels such as is available from the Cornell Institute (Camden, N.J.), and genomic viewers utilizing BLAST homologies to sequenced and mapped genomic clones (NCBI, Bethesda, Md.).

[0689] 191P4D12(b) maps to chromosome 1q22-q23.2 using 191P4D12(b) sequence and the NCBI BLAST tool located on the World Wide Web at (.ncbi.nlm.nih.gov/genome/seq/page.cgi?F=HsBlast.html&&ORG=Hs).

Example 4 Expression Analysis of 191P4D12(b) in Normal Tissues and Patient Specimens

[0690] Expression analysis by RT-PCR demonstrated that 191P4D12(b) is strongly expressed in bladder cancer patient specimens (FIG. 14). First strand cDNA was prepared from (A) vital pool 1 (liver, lung and kidney), vital pool 2 (pancreas, colon and stomach), normal kidney, prostate cancer pool, bladder cancer pool, colon cancer pool, lung cancer pool, breast cancer pool and cancer metastasis pool; (B) prostate cancer metastasis to lymph node, prostate cancer pool, bladder cancer pool, kidney cancer pool, colon cancer pool, lung cancer pool, ovary cancer pool, breast cancer pool, cancer metastasis pool, pancreas cancer pool, and LAPC prostate xenograff pool. Normalization was performed by PCR using primers to actin and GAPDH. Semi-quantitative PCR, using primers to 191P4D12(b), was performed at 26 and 30 cycles of amplification. In (A), results show strong expression of 191P4D12(b) in bladder cancer pool. Expression of 191P4D12(b) was also detected in prostate cancer pool, colon cancer pool, lung cancer pool, breast cancer pool and cancer metastasis pool but very weakly in vital pool 1 and vital pool 2. In (B), results show strong expression of 191P4D12(b) in prostate, bladder, kidney, colon, lung, ovary, breast, cancer metastasis, and pancreas cancer specimens.

[0691] Northern blot analysis of 251P5G2 is a technique known to those skilled in the art to detect 251P5G2 protein production. Northern blotting detects relative levels of mRNA expressed from a 251P5G2 gene. Specific mRNA is measured using a nucleic acid hybridization technique and the signal is detected on an autoradiog ram. The stronger the signal, the more abundant is the mRNA. For 251P5G2 genes that produce mRNA that contains an open reading frame flanked by a good Kozak translation initiation site and a stop codon, in the vast majority of cases the synthesized mRNA is expressed as a protein.

[0692] The level of expression of the 251P5G2 gene is determined in various normal tissues and in various tumor tissues and tumor cell lines using the technique of Northern blotting, which detects production of messenger RNA. It is well known in the art that the production of messenger RNA, that encodes the protein, is a necessary step in the production of the protein itself. Thus, detection of high levels of messenger RNA by, for example, Northern blot, is a way of determining that the protein itself is produced. The Northern blot technique is used as a routine procedure because it does not require the time delays (as compared to Western blotting, immunoblotting or immunohistochemistry) involved in isolating or synthesizing the protein, preparing an immunological composition of the protein, eliciting a humoral immune response, harvesting the antibodies, and verifying the specificity thereof.

[0693] The Kozak consensus sequence for translation initiation CCACCATGG, where the ATG start codon is noted, is the sequence with the highest established probability of initiating translation. This was confirmed by Peni and Pandey Trends in Genetics (2001) 17: 685-687. The conclusion is consistent with the general knowledge in the art that, with rare exceptions, expression of an mRNA is predictive of expression of its encoded protein. This is particularly true for mRNA with an open reading frame and a Kozak consensus sequence for translation initiation.

[0694] It is understood in the art that the absolute levels of messenger RNA present and the amounts of protein produced do not always provide a 1:1 correlation. In those instances where the Northern blot has shown mRNA to be present, it is almost always possible to detect the presence of the corresponding protein in the tissue which provided a positive result in the Northern blot. The levels of the protein compared to the levels of the mRNA may be differential, but generally, cells that exhibit detectable mRNA also exhibit detectable corresponding protein and vice versa. This is particularly true where the mRNA has an open reading frame and a good Kozak sequence (See, Peni and Pandey, supra.).

[0695] Occasionally those skilled in the art encounter a rare occurrence where there is no detectable protein in the presence of corresponding mRNA. (See, Fu, L., et al., Embo. Journal, 15:4392-4401 (1996)). In many cases, a reported lack of protein expression is due to technical limitations of the protein detection assay. These limitations are readily known to those skilled in the art. These limitations include but are not limited to, available antibodies that only detect denatured protein and not native protein present in a cell and unstable proteins with very short half-life. Short-lived proteins are still functional and have been previously described to induce tumor formation. (See, e.g., Reinstein, et al., Oncogene, 19: 5944-5950). In such situations, when more sensitive detection techniques are performed and/or other antibodies are generated, protein expression is detected. When studies fail to take these principles into account, they are likely to report artifactually lowered correlations of mRNA to protein. Outside of these rare exceptions the use of Northern blot analysis is recognized to those skilled in the art to be predictive and indicative of the detection of 251P5G2 protein production.

[0696] Extensive expression of 191P4D12(b) in normal tissues is shown in FIG. 15. Two multiple tissue northern blots (Clontech) both with 2 ug of mRNA/lane were probed with the 191P4D12(b) sequence. Size standards in kilobases (kb) are indicated on the side. Results show expression of an approximately 4 kb transcript in placenta and very weakly in prostate but not in any other normal tissue tested. A smaller 191P4D12(b) transcript of approximately 2.5 kb was detected in heart and skeletal muscle.

[0697] Expression of 191P4D12(b) in bladder cancer patient specimens and human normal tissues is shown in FIG. 16. RNA was extracted from a pool of 3 bladder cancer patient specimens, as well as from normal prostate (NP), normal bladder (NB), normal kidney (NK), normal colon (NC), normal lung (NL), normal breast (NBr), normal ovary (NO), and normal pancreas (NPa). Northern blot with 10 ug oftotal RNA/lane was probed with 191P4D12(b) SSH sequence. Size standards in kilobases (kb) are indicated on the side. The 191P4D12(b) transcript was detected in the bladder cancer specimens, but not in the normal tissues tested.

[0698] Analysis of individual bladder cancer patient specimens is depicted in FIG. 17. RNA was extracted from bladder cancer cell lines (CL), normal bladder (N), and bladder cancer patient tumors (T). Northern blots with 10 ug of total RNA were probed with the 191P4D12(b) SSH fragment. Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in the bladder tumor tissues but not in normal bladder. A smaller transcript was detected in the HT1197 cell line but not in the other cancer cell lines tested.

[0699] Expression of 191P4D12(b) was also detected in prostate cancer xenograft tissues (FIG. 18). RNA was extracted from normal prostate, and from the prostate cancer xenograffs LAPC-4AD, LAPC-4AI, LAPC-9AD, and LAPC-9AI. Northern blots with 10 ug of total RNA were probed with the 191P4D12(b) SSH fragment. Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in all the LAPC xenograft tissues but not in normal prostate.

[0700] FIG. 19 shows expression of 191P4D12(b) in cervical cancer patient specimens. RNA was extracted from normal cervix, Hela cancer cell line, and 3 cervix cancer patient tumors (T). Northern blots with 10 ug of total RNA were probed with the 191P4D12(b) SSH fragment. Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in 2 out of 3 cervix tumors tested but not in normal cervix nor in the Hela cell line.

[0701] 191P4D12(b) was also expressed in lung cancer patient specimens (FIG. 20). RNA was extracted from lung cancer cell lines (CL), normal lung (N), bladder cancer patient tumors (T), and normal adjacent tissue (Nat). Northern blots with 10 ug of total RNA were probed with the 191P4D12(b). Size standards in kilobases are on the side. Results show expression of the approximately 4 kb 191P4D12(b) transcript in the lung tumor tissues but not in normal lung nor in the cell lines tested.

[0702] 191P4D12(b) expression was tested in a panel of individual patient cancer specimens (FIG. 21). First strand cDNA was prepared from a panel of lung cancer specimens (A), bladder cancer specimens (B), prostate cancer specimens (C), colon cancer specimens (D), uterus cancer specimens (E), and cervix cancer specimens (F). Normalization was performed by PCR using primers to actin. Semi-quantitative PCR, using primers to 191P4D12(b) SSH fragment, was performed at 26 and 30 cycles of amplification. Expression level was recorded as 0=no expression detected; 1=weak expression, 2=moderate expression; 3=strong expression. Results show expression of 191P4D12(b) in 97% of the 31 lung cancer patient specimens tested, 94% of 18 bladder cancer patient specimens, 100% of 20 prostate cancer patient specimens, 100% of 22 colon cancer patient specimens, 100% of 12 uterus cancer patient specimens, and 100% of 14 cervix cancer patient specimens tested.

[0703] The restricted expression of 191P4D12(b) in normal tissues and the expression detected in cancer patient specimens suggest that 191P4D12(b) is a potential therapeutic target and a diagnostic marker for human cancers.

Example 5 Transcript Variants of 191P4D12(b)

[0704] Transcript variants are variants of mature mRNA from the same gene which arise by alternative transcription or alternative splicing. Alternative transcripts are transcripts from the same gene but start transcription at different points. Splice variants are mRNA variants spliced differently from the same transcript. In eukaryotes, when a multi-exon gene is transcribed from genomic DNA, the initial RNA is spliced to produce functional mRNA, which has only exons and is used for translation into an amino acid sequence. Accordingly, a given gene can have zero to many alternative transcripts and each transcript can have zero to many splice variants. Each transcript variant has a unique exon makeup, and can have different coding and/or non-coding (5′ or 3′ end) portions, from the original transcript. Transcript variants can code for similar or different proteins with the same or a similar function or can encode proteins with different functions, and can be expressed in the same tissue at the same time, or in different tissues at the same time, or in the same tissue at different times, or in different tissues at different times. Proteins encoded by transcript variants can have similar or different cellular or extracellular localizations, e.g., secreted versus intracellular.

[0705] Transcript variants are identified by a variety of art-accepted methods. For example, alternative transcripts and splice variants are identified by full-length cloning experiment, or by use of full-length transcript and EST sequences. First, all human ESTs were grouped into clusters which show direct or indirect identity with each other. Second, ESTs in the same cluster were further grouped into sub-clusters and assembled into a consensus sequence. The original gene sequence is compared to the consensus sequence(s) or other full-length sequences. Each consensus sequence is a potential splice variant for that gene. Even when a variant is identified that is not a full-length clone, that portion of the variant is very useful for antigen generation and for further cloning of the full-length splice variant, using techniques known in the art.

[0706] Moreover, computer programs are available in the art that identify transcript variants based on genomic sequences. Genomic-based transcript variant identification programs include FgenesH (A. Salamov and V. Solovyev, “Ab initio gene finding in Drosophila genomic DNA,” Genome Research. 2000 April; 10(4):516-22); Grail (URL compbio.ornl.gov/Grail-bin/EmptyGrailForm) and GenScan (URL genes.mit.edu/GENSCAN.html). For a general discussion of splice variant identification protocols see., e.g., Southan, C., A genomic perspective on human proteases, FEBS Lett. 2001 Jun 8; 498(2-3):214-8; de Souza, S. J., et al., Identification of human chromosome 22 transcribed sequences with ORF expressed sequence tags, Proc. Natl Acad Sci U S A. 2000 Nov 7; 97(23):12690-3.

[0707] To further confirm the parameters of a transcript variant, a variety of techniques are available in the art, such as full-length cloning, proteomic validation, PCR-based validation, and 5′ RACE validation, etc. (see e.g., Proteomic Validation: Brennan, S. O., et al., Albumin banks peninsula: a new termination variant characterized by electrospray mass spectrometry, Biochem Biophys Acta. 1999 Aug 17;1433(1-2):321-6; Ferranti P, et al., Differential splicing of pre-messenger RNA produces multiple forms of mature caprine alpha(s1)-casein, Eur J Biochem. 1997 Oct 1;249(1):1-7. For PCR-based Validation: Wellmann S, et al., Specific reverse transcription-PCR quantification of vascular endothelial growth factor (VEGF) splice variants by LightCycler technology, Clin Chem. 2001 Apr;47(4):654-60; Jia, H. P., et al., Discovery of new human beta-defensins using a genomics-based approach, Gene. 2001 Jan 24; 263(1-2):211-8. For PCR-based and 5′ RACE Validation: Brigle, K. E., et al., Organization of the murine reduced folate carrier gene and identification of variant splice forms, Biochem Biophys Acta. 1997 Aug 7;, 1353(2): 191-8).

[0708] It is known in the art that genomic regions are modulated in cancers. When the genomic region to which a gene maps is modulated in a particular cancer, the alternative transcripts or splice variants of the gene are modulated as well. Disclosed herein is that 191P4D12(b) has a particular expression profile related to cancer. Alternative transcripts and splice variants of 191P4D12(b) may also be involved in cancers in the same or different tissues, thus serving as tumor-associated markers/antigens.

[0709] Using the full-length gene and EST sequences, four additional transcript variants were identified, designated as 191P4D12(b) v.6, v.7, v.8 and v.9 as shown in FIG. 12. The boundaries of exons in the original transcript, 191P4D12(b) v.1 were shown in Table LI. Compared with 191P4D12(b) v.1, variant v.6 spliced out 202-321 from the first exon of v.1 while variant v.8 spliced out 63 bases from the last exon of v.1. Variant v.7 spliced out exon 8 of v.1. Variant 9 was part of the last exon of v.1. Theoretically, each different combination of exons in spatial order, e.g. exons 2, 3, 5, 7 and 9 of v.1, is a potential splice variant. Tables LII (a)-(d) through LV (a)-(d) are set forth on a variant-by-variant bases. Tables LII (a)-(d) shows nucleotide sequence of the transcript variants. Tables LIII (a)-(d) shows the alignment of the transcript variant with nucleic acid sequence of 191P4D12(b) v.1. Tables LIV (a)-(d) lays out amino acid translation of the transcript variant for the identified reading frame orientation. Tables LV (a)-(d) displays alignments of the amino acid sequence encoded by the splice variant with that of 191P4D12(b) v.1.

Example 6 Single Nucleotide Polymorphisms of 191P4D12(b)

[0710] A Single Nucleotide Polymorphism (SNP) is a single base pair variation in a nucleotide sequence at a specific location. At any given point of the genome, there are four possible nucleotide base pairs: A/T, C/G, G/C and T/A. Genotype refers to the specific base pair sequence of one or more locations in the genome of an individual. Haplotype refers to the base pair sequence of more than one location on the same DNA molecule (or the same chromosome in higher organisms), often in the context of one gene or in the context of several tightly linked genes. SNP that occurs on a cDNA is called cSNP. This cSNP may change amino acids of the protein encoded by the gene and thus change the functions of the protein. Some SNP cause inherited diseases; others contribute to quantitative variations in phenotype and reactions to environmental factors including diet and drugs among individuals. Therefore, SNP and/or combinations of alleles (called haplotypes) have many applications, including diagnosis of inherited diseases, determination of drug reactions and dosage, identification of genes responsible for diseases, and analysis of the genetic relationship between individuals (P. Nowotny, J. M. Kwon and A. M. Goate, “SNP analysis to dissect human traits,” Curr. Opin. Neurobiol. 2001 Oct; 11(5):637-641; M. Pirmohamed and B. K. Park, “Genetic susceptibility to adverse drug reactions,” Trends Pharmacol. Sci. 2001 Jun; 22(6):298-305; J. H. Riley, C. J. Allan, E. Lai and A. Roses, “The use of single nucleotide polymorphisms in the isolation of common disease genes,” Pharmacogenomics. 2000 Feb; 1(1):39-47; R. Judson, J. C. Stephens and A. Windemuth, “The predictive power of haplotypes in clinical response,” Pharmacogenomics. 2000 feb; 1(1):15-26).

[0711] SNP are identified by a variety of art-accepted methods (P. Bean, “The promising voyage of SNP target discovery,” Am. Clin. Lab. 2001 Oct-Nov; 20(9):18-20; K. M. Weiss, “In search of human variation,” Genome Res. 1998 Jul; 8(7):691-697; M. M. She, “Enabling large-scale pharmacogenetic studies by high-throughput mutation detection and genotyping technologies,” Clin. Chem. 2001 Feb; 47(2):164-172). For example, SNP can be identified by sequencing DNA fragments that show polymorphism by gel-based methods such as restriction fragment length polymorphism (RFLP) and denaturing gradient gel electrophoresis (DGGE). They can also be discovered by direct sequencing of DNA samples pooled from different individuals or by comparing sequences from different DNA samples. With the rapid accumulation of sequence data in public and private databases, one can discover SNP by comparing sequences using computer programs (Z. Gu, L. Hillier and P. Y. Kwok, “Single nucleotide polymorphism hunting in cyberspace,” Hum. Mutat. 1998; 12(4):221-225). SNP can be verified and genotype or haplotype of an individual can be determined by a variety of methods including direct sequencing and high throughput microarrays (P. Y. Kwok, “Methods for genotyping single nucleotide polymorphisms,” Annu. Rev. Genomics Hum. Genet. 2001; 2:235-258; M. Kokoris, K. Dix, K. Moynihan, J. Mathis, B. Erwin, P. Grass, B. Hines and A. Duesterhoeft, “High-throughput SNP genotyping with the Masscode system,” Mol. Diagn. 2000 Dec; 5(4):329-340). Using the methods described above, seven SNP and one insertion/deletion of three bases were identified in the original transcript, 191P4D12(b) v.1, at positions 420 (T/C), 2184 (G/T), 2341 (G/A), 2688 (C/A), 367 (A/G), 699 (C/A), 1590 (C/T), and insertion of GCA in between 1262 and 1263I. The transcripts or proteins with alternative allele were designated as variant 191P4D12(b) v.2 through v.5 and v.10 through v.13, as shown in FIG. 10. FIG. 11 shows the schematic alignment of protein variants, corresponding to nucleotide variants. Nucleotide variants that code for the same amino acid sequence as v.1 are not shown in FIG. 11. These alleles of the SNP, though shown separately here, can occur in different combinations (haplotypes) and in any one of the transcript variants (such as 191P4D12(b) v.9) that contains the site of the SNP. The SNP at 2688 of v.1 occurs also in transcript variant v.9 and contributed to one codon change of v.9 at amino acid 64 from Ala to Asp (FIG. 11).

Example 7 Production of Recombinant 191P4D12(b) in Prokaryotic Systems

[0712] To express recombinant 191P4D12(b) and 191P4D12(b) variants in prokaryotic cells, the full or partial length 191P4D12(b) and 191P4D12(b) variant cDNA sequences are cloned into any one of a variety of expression vectors known in the art. One or more of the following regions of 191P4D12(b) variants are expressed: the full length sequence presented in FIGS. 2 and 3, or any 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more contiguous amino acids from 191P4D12(b), variants, or analogs thereof.

[0713] A. In vitro Transcription and Translation Constructs:

[0714] pCII: To generate 191P4D12(b) sense and anti-sense RNA probes for RNA in situ investigations, pCRII constructs (Invitrogen, Carlsbad Calif.) are generated encoding either all or fragments of the 191P4D12(b) cDNA. The pCRII vector has Sp6 and T7 promoters flanking the insert to drive the transcription of 191P4D12(b) RNA for use as probes in RNA in situ hybridization experiments. These probes are used to analyze the cell and tissue expression of 191P4D12(b) at the RNA level. Transcribed 191P4D12(b) RNA representing the cDNA amino acid coding region of the 191P4D12(b) gene is used in in vitro translation systems such as the TnT™ Coupled Reticulolysate System (Promega, Corp., Madison, Wis.) to synthesize 191P4D12(b) protein.

[0715] B. Bacterial Constructs:

[0716] pGEX Constructs: To generate recombinant 191P4D12(b) proteins in bacteria that are fused to the Glutathione S-transferase (GST) protein, all or parts of the 191P4D12(b) cDNA protein coding sequence are cloned into the pGEX family of GST-fusion vectors (Amersham Pharmacia Biotech, Piscataway, N.J.). These constructs allow controlled expression of recombinant 191P4D12(b) protein sequences with GST fused at the amino-terminus and a six histidine epitope (6X His) at the carboxyl-terminus. The GST and 6X His tags permit purification of the recombinant fusion protein from induced bacteria with the appropriate affinity matrix and allow recognition of the fusion protein with anti-GST and anti-His antibodies. The 6X His tag is generated by adding 6 histidine codons to the cloning primer at the 3′ end, e.g., of the open reading frame (ORF). A proteolytic cleavage site, such as the PreScission™ recognition site in pGEX-6P-1, may be employed such that it permits cleavage of the GST tag from 191P4D12(b)-related protein. The ampicillin resistance gene and pBR322 origin permits selection and maintenance of the pGEX plasmids in E. coli.

[0717] pMAL Constructs: To generate, in bacteria, recombinant 191P4D12(b) proteins that are fused to maltose-binding protein (MBP), all or parts of the 191P4D12(b) cDNA protein coding sequence are fused to the MBP gene by cloning into the pMAL-c2X and pMAL-p2X vectors (New England Biolabs, Beverly, Mass.). These constructs allow controlled expression of recombinant 191P4D12(b) protein sequences with MBP fused at the amino-terminus and a 6X His epitope tag at the carboxyl-terminus. The MBP and 6X His tags permit purification of the recombinant protein from induced bacteria with the appropriate affinity matrix and allow recognition of the fusion protein with anti-MBP and anti-His antibodies. The 6X His epitope tag is generated by adding 6 histidine codons to the 3′ cloning primer. A Factor Xa recognition site permits cleavage of the pMAL tag from 191P4D12(b). The pMAL-c2X and pMAL-p2X vectors are optimized to express the recombinant protein in the cytoplasm or periplasm respectively. Periplasm expression enhances folding of proteins with disulfide bonds.

[0718] pET Constructs: To express 191P4D12(b) in bacterial cells, all or parts of the 191P4D12(b) cDNA protein coding sequence are cloned into the pET family of vectors (Novagen, Madison, Wis.). These vectors allow tightly controlled expression of recombinant 191P4D12(b) protein in bacteria with and without fusion to proteins that enhance solubility, such as NusA and thioredoxin (Trx), and epitope tags, such as 6X His and S-Tag™ that aid purification and detection of the recombinant protein. For example, constructs are made utilizing pET NusA fusion system 43.1 such that regions of the 191P4D12(b) protein are expressed as amino-terminal fusions to NusA.

[0719] C. Yeast Constructs:

[0720] pESC Constructs. To express 191P4D12(b) in the yeast species Saccharomyces cerevisiae for generation of recombinant protein and functional studies, all or parts of the 191P4D12(b) cDNA protein coding sequence are cloned into the pESC family of vectors each of which contain 1 of 4 selectable markers, HIS3, TRP1, LEU2, and URA3 (Stratagene, La Jolla, Calif.). These vectors allow controlled expression from the same plasmid of up to 2 different genes or cloned sequences containing either Flag™ or Myc epitope tags in the same yeast cell. This system is useful to confirm protein-protein interactions of 191P4D12(b). In addition, expression in yeast yields similar post-translational modifications, such as glycosylations and phosphorylations, that are found when expressed in eukaryotic cells.

[0721] pESP Constructs: To express 191P4D12(b) in the yeast species Saccharomyces pombe, all or parts of the 191P4D12(b) cDNA protein coding sequence are cloned into the pESP family of vectors. These vectors allow controlled high level of expression of a 191P4D12(b) protein sequence that is fused at either the amino terminus or at the carboxyl terminus to GST which aids purification of the recombinant protein. A Flag™ epitope tag allows detection of the recombinant protein with anti-Flag™ antibody.

Example 8 Production of Recombinant 191P4D12(b) in Higher Eukaryotic Systems

[0722] A. Mammalian Constructs:

[0723] To express recombinant 191P4D12(b) in eukaryotic cells, the full or partial length 191P4D12(b) cDNA sequences can be cloned into any one of a variety of expression vectors known in the art. One or more of the following regions of 191P4D12(b) are expressed in these constructs, amino acids 1 to 510, or any 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more contiguous amino acids from 191P4D12(b) v.1, v.2, v.10, v.11, v.12; amino acids 1 to 511, or any 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30 or more contiguous amino acids from 191P4D12(b) v.13, variants, or analogs thereof.

[0724] The constructs can be transfected into any one of a wide variety of mammalian cells such as 293T cells. Transfected 293T cell lysates can be probed with the anti-191P4D12(b) polyclonal serum, described herein.

[0725] pcDNA4/HisMax Constructs: To express 191P4D12(b) in mammalian cells, a 191P4D12(b) ORF, or portions thereof, of 191P4D12(b) were cloned into pcDNA4/HisMax Version A (Invitrogen, Carlsbad, Calif.). Protein expression is driven from the cytomegalovirus (CMV) promoter and the SP16 translational enhancer. The recombinant protein has Xpress™ and six histidine (6X His) epitopes fused to the amino-terminus. The pcDNA4/HisMax vector also contains the bovine growth hormone (BGH) polyadenylation signal and transcription termination sequence to enhance mRNA stability along with the SV40 origin for episomal replication and simple vector rescue in cell lines expressing the large T antigen. The Zeocin resistance gene allows for selection of mammalian cells expressing the protein and the ampicillin resistance gene and ColE1 origin permits selection and maintenance of the plasmid in E. coli.

[0726] pcDNA3.11/MycHis Constructs: To express 191P4D12(b) in mammalian cells, a 191P4D12(b) ORF, or portions thereof, of 191P4D12(b) with a consensus Kozak translation initiation site was cloned into pcDNA3.1/MycHis Version A (Invitrogen, Carlsbad, Calif.). Protein expression is driven from the cytomegalovirus (CMV) promoter. The recombinant proteins have the myc epitope and 6X His epitope fused to the carboxyl-terminus. The pcDNA3.1/MycHis vector also contains the bovine growth hormone (BGH) polyadenylation signal and transcription termination sequence to enhance mRNA stability, along with the SV40 origin for episomal replication and simple vector rescue in cell lines expressing the large T antigen. The Neomycin resistance gene can be used, as it allows for selection of mammalian cells expressing the protein and the ampicillin resistance gene and ColE1 origin permits selection and maintenance of the plasmid in E. coli. FIG. 22 shows expression of 191P4D12(b).pcDNA3.1/MycHis following vector transfection into 293T cells. 293T cells were transfected with either 191P4D12(b).pcDNA3.1/mychis or pcDNA3.1/mychis vector control. Forty hours later cell lysates were collected. Samples were run on an SDS-PAGE acrylamide gel, blotted and stained with anti-his antibody. The blot was developed using the ECL chemiluminescence kit and visualized by autoradiography. Results show expression of 191P4D12(b) in the lysates of 191P4D12(b).pcDNA3.1/mychis transfected cells (Lane 3), but not from the control pcDNA3.1/mychis (Lane 4).

[0727] pcDNA3.1/CT-GFP-TOPO Construct: To express 191P4D12(b) in mammalian cells and to allow detection of the recombinant proteins using fluorescence, a 191P4D12(b) ORF, or portions thereof, with a consensus Kozak translation initiation site are cloned into pcDNA3.1/CT-GFP-TOPO (Invitrogen, Calif.). Protein expression is driven from the cytomegalovirus (CMV) promoter. The recombinant proteins have the Green Fluorescent Protein (GFP) fused to the carboxyl-terminus facilitating non-invasive, in vivo detection and cell biology studies. The pcDNA3.1CT-GFP-TOPO vector also contains the bovine growth hormone (BGH) polyadenylation signal and transcription termination sequence to enhance mRNA stability along with the SV40 origin for episomal replication and simple vector rescue in cell lines expressing the large T antigen. The Neomycin resistance gene allows for selection of mammalian cells that express the protein, and the ampicillin resistance gene and ColE1 origin permits selection and maintenance of the plasmid in E. coli. Additional constructs with an amino-terminal GFP fusion are made in pcDNA3.1/NT-GFP-TOPO spanning the entire length of a 191P4D12(b) protein.

[0728] PAPtag: A 191P4D12(b) ORF, or portions thereof, is cloned into pAPtag-5 (GenHunter Corp. Nashville, Tenn.). This construct generates an alkaline phosphatase fusion at the carboxyl-terminus of a 191P4D12(b) protein while fusing the IgG&kgr; signal sequence to the amino-terminus. Constructs are also generated in which alkaline phosphatase with an amino-terminal IgG&kgr; signal sequence is fused to the amino-terminus of a 191P4D12(b) protein. The resulting recombinant 191P4D12(b) proteins are optimized for secretion into the media of transfected mammalian cells and can be used to identify proteins such as ligands or receptors that interact with 191P4D12(b) proteins. Protein expression is driven from the CMV promoter and the recombinant proteins also contain myc and 6X His epitopes fused at the carboxyl-terminus that facilitates detection and purification. The Zeocin resistance gene present in the vector allows for selection of mammalian cells expressing the recombinant protein and the ampicillin resistance gene permits selection of the plasmid in E. coli.

[0729] pTaq5: A 191P4D12(b) v.1 extracellular domain was cloned into pTag-5 plasmid. This vector is similar to pAPtag but without the alkaline phosphatase fusion. This construct generates 191P4D12(b) protein with an amino-terminal IgG&kgr; signal sequence and myc and 6X His epitope tags at the carboxyl-terminus that facilitate detection and affinity purification. The resulting recombinant 191P4D12(b) protein is optimized for secretion into the media of transfected mammalian cells, and is used as immunogen or ligand to identify proteins such as ligands or receptors that interact with the 191P4D12(b) proteins. Protein expression is driven from the CMV promoter. The Zeocin resistance gene present in the vector allows for selection of mammalian cells expressing the protein, and the ampicillin resistance gene permits selection of the plasmid in E. coli. FIG. 22 shows expression and secretion of the extracellular domain of 191P4D12(b) following 191P4D12(b).pTag5 vector transfection into 293T cells. 293T cells were transfected with 191P4D12(b).pTag5. Forty hours later, cell lysate and supernatant were collected. Samples were run on an SDS-PAGE acrylamide gel, blotted and stained with anti-his antibody. The blot was developed using the ECL chemiluminescence kit and visualized by autoradiography. Results show expression from 191P4D12(b).pTag5 plasmid of 191P4D12(b) extracellular domain in the lysate (Lane 2) and secretion in the culture supernatant (Lane 1).

[0730] 191P4D12(b) ORF, or portions thereof, is also cloned into pTag-5 plasmid.

[0731] PsecFc: A 191P4D12(b) ORF, or portions thereof, is also cloned into psecFc. The psecFc vector was assembled by cloning the human immunoglobulin G1 (IgG) Fc (hinge, CH2, CH3 regions) into pSecTag2 (Invitrogen, Calif.). This construct generates an IgG1 Fc fusion at the carboxyl-terminus of the 191P4D12(b) proteins, while fusing the IgGK signal sequence to N-terminus. 191P4D12(b) fusions utilizing the murine IgG1 Fc region are also used. The resulting recombinant 191P4D12(b) proteins are optimized for secretion into the media of transfected mammalian cells, and can be used as immunogens or to identify proteins such as ligands or receptors that interact with 191P4D12(b) protein. Protein expression is driven from the GMV promoter. The hygromycin resistance gene present in the vector allows for selection of mammalian cells that express the recombinant protein, and the ampicillin resistance gene permits selection of the plasmid in E. coli.

[0732] pSR&agr; Constructs: To generate mammalian cell lines that express 191P4D12(b) constitutively, 191P4D12(b) ORF, or portions thereof, of 191P4D12(b) were cloned into pSR&agr; constructs. Amphotropic and ecotropic retroviruses were generated by transfection of pSR&agr; constructs into the 293T-10A1 packaging line or co-transfection of pSR&agr; and a helper plasmid (containing deleted packaging sequences) into the 293 cells, respectively. The retrovirus is used to infect a variety of mammalian cell lines, resulting in the integration of the cloned gene, 191P4D12(b), into the host cell-lines. Protein expression is driven from a long terminal repeat (LTR). The Neomycin resistance gene present in the vector allows for selection of mammalian cells that express the protein, and the ampicillin resistance gene and ColE1 origin permit selection and maintenance of the plasmid in E. coli. The retroviral vectors can thereafter be used for infection and generation of various cell lines using, for example, PC3, NIH 3T3, TsuPr1, 293 or rat-1 cells.

[0733] FIG. 23 shows stable expression of 191P4D12(b) following 191P4D12(b).pSRa transduction into 3T3 cells. 3T3 cells were transduced with the pSRa retroviral vector encoding the 191P4D12(b) gene. Following selection with neomycin, the cells were expanded and RNA was extracted. Northern blot with 10 ug of total RNA/lane was probed with the 191P4D12(b) SSH sequence. Size standards in kilobases (kb) are indicated on the side. Results show expression of the 191P4D12(b) transcript driven from the retroviral LTR, which migrates slower than the endogenous 4kb 191P4D12(b) transcript detected in the positive control LAPC-4AD.

[0734] Additional pSR&agr; constructs are made that fuse an epitope tag such as the FLAG™ tag to the carboxyl-terminus of 191P4D12(b) sequences to allow detection using anti-Flag antibodies. For example, the FLAG™ sequence 5′ gat tac aag gat gac gac gat aag 3′ (SEQ ID NO: 60) is added to cloning primer at the 3′ end of the ORF. Additional pSR&agr; constructs are made to produce both amino-terminal and carboxyl-terminal GFP and myc/6X His fusion proteins of the full-length 191P4D12(b) proteins.

[0735] Additional Viral Vectors: Additional constructs are made for viral-mediated delivery and expression of 191P4D12(b). High virus titer leading to high level expression of 191P4D12(b) is achieved in viral delivery systems such as adenoviral vectors and herpes amplicon vectors. A 191P4D12(b) coding sequences or fragments thereof are amplified by PCR and subcloned into the AdEasy shuttle vector (Stratagene). Recombination and virus packaging are performed according to the manufacturer's instructions to generate adenoviral vectors. Alternatively, 191P4D12(b) coding sequences or fragments thereof are cloned into the HSV-1 vector (Imgenex) to generate herpes viral vectors. The viral vectors are thereafter used for infection of various cell lines such as PC3, NIH 3T3, 293 or rat-1 cells.

[0736] Regulated Expression Systems: To control expression of 191P4D12(b) in mammalian cells, coding sequences of 191P4D12(b), or portions thereof, are cloned into regulated mammalian expression systems such as the T-Rex System (Invitrogen), the GeneSwitch System (Invitrogen) and the tightly-regulated Ecdysone System (Sratagene). These systems allow the study of the temporal and concentration dependent effects of recombinant 191P4D12(b). These vectors are thereafter used to control expression of 191P4D12(b) in various cell lines such as PC3, NIH 3T3, 293 or rat-1 cells.

[0737] B. Baculovirus Expression Systems

[0738] To generate recombinant 191P4D12(b) proteins in a baculovirus expression system, 191P4D12(b) ORF, or portions thereof, are cloned into the baculovirus transfer vector pBlueBac 4.5 (Invitrogen), which provides a His-tag at the N-terminus. Specifically, pBlueBac-191P4D12(b) is co-transfected with helper plasmid pBac-N-Blue (Invitrogen) into SF9 (Spodoptera frugiperda) insect cells to generate recombinant baculovirus (see Invitrogen instruction manual for details). Baculovirus is then collected from cell supernatant and purified by plaque assay.

[0739] Recombinant 191P4D12(b) protein is then generated by infection of HighFive insect cells (Invitrogen) with purified baculovirus. Recombinant 191P4D12(b) protein can be detected using anti-191P4D12(b) or anti-His-tag antibody. 191P4D12(b) protein can be purified and used in various cell-based assays or as immunogen to generate polyclonal and monoclonal antibodies specific for 191P4D12(b).

Example 9 Antigenicity Profiles and Secondary Structure

[0740] FIGS. 5(A-C), FIGS. 6(A-C), FIGS. 7(A-E), FIGS. 8(A-C), and FIGS. 9(A-C) depict graphically five amino acid profiles of 191P4D12(b) variants 1, 7, and 9, each assessment available by accessing the ProtScale website located on the World Wide Web at (.expasy.ch/cgi-bin/protscale.pl) on the ExPasy molecular biology server.

[0741] These profiles: FIG. 5, Hydrophilicity, (Hopp T. P., Woods K. R., 1981. Proc. Natl. Acad. Sci. U.S.A. 78:3824-3828); FIG. 6, Hydropathicity, (Kyte J., Doolittle R. F., 1982. J. Mol. Biol. 157:105-132); FIG. 7, Percentage Accessible Residues (Janin J., 1979 Nature 277:491-492); FIG. 8, Average Flexibility, (Bhaskaran R., and Ponnuswamy P. K., 1988. Int. J. Pept. Protein Res. 32:242-255); FIG. 9, Beta-turn (Deleage, G., Roux B. 1987 Protein Engineering 1:289-294); and optionally others available in the art, such as on the ProtScale website, were used to identify antigenic regions of each of the 191P4D12(b) variant proteins. Each of the above amino acid profiles of 191P4D12(b) variants were generated using the following ProtScale parameters for analysis: 1) A window size of 9; 2) 100% weight of the window edges compared to the window center; and, 3) amino acid profile values normalized to lie between 0 and 1.

[0742] Hydrophilicity (FIG. 5), Hydropathicity (FIG. 6) and Percentage Accessible Residues (FIG. 7) profiles were used to determine stretches of hydrophilic amino acids (i.e., values greater than 0.5 on the Hydrophilicity and Percentage Accessible Residues profile, and values less than 0.5 on the Hydropathicity profile). Such regions are likely to be exposed to the aqueous environment, be present on the surface of the protein, and thus available for immune recognition, such as by antibodies.

[0743] Average Flexibility (FIG. 8) and Beta-turn (FIG. 9) profiles determine stretches of amino acids (i.e., values greater than 0.5 on the Beta-turn profile and the Average Flexibility profile) that are not constrained in secondary structures such as beta sheets and alpha helices. Such regions are also more likely to be exposed on the protein and thus accessible to immune recognition, such as by antibodies.

[0744] Antigenic sequences of the 191P4D12(b) variant proteins indicated, e.g., by the profiles set forth in FIGS. 5(A-C), FIGS. 6(A-C), FIGS. 7(A-C), FIGS. 8(A-C), and/or FIGS. 9(A-C) are used to prepare immunogens, either peptides or nucleic acids that encode them, to generate therapeutic and diagnostic anti-191P4D12(b) antibodies. The immunogen can be any 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50 or more than 50 contiguous amino acids, or the corresponding nucleic acids that encode them, from the 191P4D12(b) protein variants listed in FIGS. 2 and 3, of which the amino acid profiles are shown in FIG. 9, or are identical to the variant sequences that are the same as a variant depicted in FIG. 9. In particular, peptide immunogens of the invention can comprise, a peptide region of at least 5 amino acids of FIGS. 2 and 3 in any whole number increment that includes an amino acid position having a value greater than 0.5 in the Hydrophilicity profiles of FIG. 5; a peptide region of at least 5 amino acids of FIGS. 2 and 3 in any whole number increment that includes an amino acid position having a value less than 0.5 in the Hydropathicity profile of FIG. 6; a peptide region of at least 5 amino acids of FIGS. 2 and 3 in any whole number increment that includes an amino acid position having a value greater than 0.5 in the Percent Accessible Residues profiles of FIG. 7; a peptide region of at least 5 amino acids of FIGS. 2 and 3 in any whole number increment that includes an amino acid position having a value greater than 0.5 in the Average Flexibility profiles on FIG. 8 and, a peptide region of at least 5 amino acids of FIGS. 2 and 3 in any whole number increment that includes an amino acid position having a value greater than 0.5 in the Beta-turn profile of FIG. 9. Peptide immunogens of the invention can also comprise nucleic acids that encode any of the forgoing.

[0745] All immunogens of the invention, peptide or nucleic acid, can be embodied in human unit dose form, or comprised by a composition that includes a pharmaceutical excipient compatible with human physiology.

[0746] The secondary structure of 191P4D12(b) protein variants 1, 7, and 9, namely the predicted presence and location of alpha helices, extended strands, and random coils, is predicted from the primary amino acid sequence using the HNN—Hierarchical Neural Network method (Guermeur, 1997, http://pbil.ibcp.fr/cgi-bin/npsa_automat.pl?page=npsa_nn.html), accessed from the ExPasy molecular biology server located on the World Wide Web at (.expasy.ch/tools/). The analysis indicates that 191P4D12(b) variant 1 is composed of 24.90% alpha helix, 18.63% extended strand, and 56.47% random coil (FIG. 13A). Variant 6 is composed of 28.47% alpha helix, 19.32% extended strand, and 52.20% random coil (FIG. 13B). Variant 7 is composed of 26.19% alpha helix, 18.76% extended strand, and 55.05% random coil (FIG. 13C). Variant 7 is composed of 56.20% alpha helix, 8.76% extended strand, and 35.04% random coil (FIG. 13D).

[0747] Analysis for the potential presence of transmembrane domains in the 191P4D12(b) variant proteins was carried out using a variety of transmembrane prediction algorithms accessed from the ExPasy molecular biology server located on the World Wide Web at (.expasy.ch/tools/). Shown graphically in FIGS. 13E and 13F are the results of analysis of variant 1 depicting the presence and location of 1 transmembrane domain using the TMpred program (FIG. 13E) and 1 transmembrane domain using the TMHMM program (FIG. 13F). Shown graphically in FIGS. 13G and 13H are the results of analysis of variant 6 depicting the presence and location of 1 transmembrane domains using the TMpred program (FIG. 13G) and 1 transmembrane domain using the TMHMM program (FIG. 13H). Shown graphically in FIG. 13I and 13J are the results of analysis of variant 7 depicting the presence and location of 1 transmembrane domain using the TMpred program (FIG. 13I) and 1 transmembrane domain using the TMHMM program (FIG. 13J). Shown graphically in FIG. 13K and 13L are the results of analysis of variant 9 depicting the presence and location of 2 transmembrane domains using the TMpred program (FIG. 1K) and 1 transmembrane domain using the TMHMM program (FIG. 13L). The results of each program, namely the amino acids encoding the transmembrane domains are summarized in Table VI and Table L.

Example 10 Generation of 191P4D12(b) Polyclonal Antibodies

[0748] Polyclonal antibodies can be raised in a mammal, for example, by one or more injections of an immunizing agent and, if desired, an adjuvant. Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. In addition to immunizing with a full length 191P4D12(b) protein variant, computer algorithms are employed in design of immunogens that, based on amino acid sequence analysis contain characteristics of being antigenic and available for recognition by the immune system of the immunized host (see the Example entitled “Antigenicity Profiles and Secondary Structures”). Such regions would be predicted to be hydrophilic, flexible, in beta-turn conformations, and be exposed on the surface of the protein (see, e.g., FIGS. 5(A-C), FIGS. 6(A & C), FIGS. 7(A-C), FIGS. 8(A-C), or FIGS. 9(A-C) for amino acid profiles that indicate such regions of 191P4D12(b) protein variants).

[0749] For example, recombinant bacterial fusion proteins or peptides containing hydrophilic, flexible, beta-turn regions of 191P4D12(b) protein variants are used as antigens to generate polyclonal antibodies in New Zealand White rabbits or monoclonal antibodies as described in Example 11. For example, in 191P4D12(b) variant 1, such regions include, but are not limited to, amino acids 27-39, amino acids 93-109, and amino acids 182-204. In sequence unique to variant 7, such regions include, but are not limited to, amino acids 400-420. In sequence specific for variant 9, such regions include, but are not limited to, amino acids 80-94. It is useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include, but are not limited to, keyhole limpet hemocyanin (KLH), serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. In one embodiment, a peptide encoding amino acids 52-63 of 191P4D12(b) variant 1 and amino acids 179-197 were each conjugated to KLH and used to immunize separate rabbits. Alternatively the immunizing agent may include all or portions of the 191P4D12(b) variant proteins, analogs or fusion proteins thereof. For example, the 191P4D12(b) variant 1 amino acid sequence can be fused using recombinant DNA techniques to any one of a variety of fusion protein partners that are well known in the art, such as glutathione-S-transferase (GST) and HIS tagged fusion proteins. In another embodiment, amino acids 2-349 of 191P4D12(b) variant 1 was fused to GST using recombinant techniques and the pGEX expression vector, expressed, purified and used to immunize a rabbit. Such fusion proteins are purified from induced bacteria using the appropriate affinity matrix.

[0750] Other recombinant bacterial fusion proteins that may be employed include maltose binding protein, LacZ, thioredoxin, NusA, or an immunoglobulin constant region (see the section entitled “Production of 191P4D12(b) in Prokaryotic Systems” and Current Protocols In Molecular Biology, Volume 2, Unit 16, Frederick M. Ausubul et al. eds., 1995; Linsley, P. S., Brady, W., Urnes, M., Grosmaire, L., Damle, N., and Ledbetter, L.(1991) J.Exp. Med. 174, 561-566).

[0751] In addition to bacterial derived fusion proteins, mammalian expressed protein antigens are also used. These antigens are expressed from mammalian expression vectors such as the Tag5 and Fc-fusion vectors (see the section entitled “Production of Recombinant 191P4D12(b) in Eukaryotic Systems”), and retain post-translational modifications such as glycosylations found in native protein. In one embodiment, amino acids 31-347 of variant 1, encoding the extracellular domain, was cloned into the Tag5 mammalian secretion vector, and expressed in 293T cells resulting in a soluble secreted protein (FIG. 22). The recombinant protein is purified by metal chelate chromatography from tissue culture supernatants of 293T cells stably expressing the recombinant vector. The purified Tag5 191 P4D12(b) protein is then used as immunogen.

[0752] During the immunization protocol, it is useful to mix or emulsify the antigen in adjuvants that enhance the immune response of the host animal. Examples of adjuvants include, but are not limited to, complete Freund's adjuvant (CFA) and MPL-TDM adjuvant (monophosphory Lipid A, synthetic trehalose dicorynomycolate).

[0753] In a typical protocol, rabbits are initially immunized subcutaneously with up to 200 &mgr;g, typically 100-200 &mgr;g, of fusion protein or peptide conjugated to KLH mixed in complete Freund's adjuvant (CFA). Rabbits are then injected subcutaneously every two weeks with up to 200 &mgr;g, typically 100-200 &mgr;g, of the immunogen in incomplete Freund's adjuvant (IFA). Test bleeds are taken approximately 7-10 days following each immunization and used to monitor the titer of the antiserum by ELISA.

[0754] To test reactivity and specificity of immune serum, such as the rabbit serum derived from immunization with the Tag5 -191P4D12(b) variant 1 protein, the full-length 191P4D12(b) variant 1 cDNA is cloned into pCDNA 3.1 myc-his expression vector (Invitrogen, see the Example entitled “Production of Recombinant 191P4D12(b) in Eukaryotic Systems”). After transfection of the constructs into 293T cells, cell lysates are probed with the anti-191P4D12(b) serum and with anti-His antibody (Santa Cruz Biotechnologies, Santa Cruz, Calif.) to determine specific reactivity to denatured 191P4D12(b) protein using the Western blot technique. In addition, the immune serum is tested by fluorescence microscopy, flow cytometry and immunoprecipitation against 293T (FIG. 22) and other recombinant 191P4D12(b)-expressing cells to determine specific recognition of native protein. Western blot, immunoprecipitation, fluorescent microscopy, and flow cytometric techniques using cells that endogenously express 191P4D12(b) are also carried out to test reactivity and specificity. Anti-serum from rabbits immunized with 191P4D12(b) variant fusion proteins, such as GST and MBP fusion proteins, are purified by depletion of antibodies reactive to the fusion partner sequence by passage over an affinity column containing the fusion partner either alone or in the context of an irrelevant fusion protein. For example, antiserum derived from a GST-191P4D12(b) variant 1 fusion protein is first purified by passage over a column of GST protein covalently coupled to AffiGel matrix (BioRad, Hercules, Calif.). The antiserum is then affinity purified by passage over a column composed of a MBP-191P4D12(b) fusion protein covalently coupled to Affigel matrix. The serum is then further purified by protein G affinity chromatography to isolate the IgG fraction. Sera from other His-tagged antigens and peptide immunized rabbits as well as fusion partner depleted sera are affinity purified by passage over a column matrix composed of the original protein immunogen or free peptide.

Example 11 Generation of 191P4D12(b) Monoclonal Antibodies (mAbs)

[0755] In one embodiment, therapeutic mAbs to 191P4D12(b) variants comprise those that react with epitopes specific for each variant protein or specific to sequences in common between the variants that would disrupt or modulate the biological function of the 191P4D12(b) variants, for example those that would disrupt the interaction with ligands and binding partners. Immunogens for generation of such mAbs include those designed to encode or contain the entire 191P4D12(b) protein variant sequence, regions of the 191P4D12(b) protein variants predicted to be antigenic from computer analysis of the amino acid sequence (see, e.g., FIGS. 5(A-C), FIGS. 6(A-C), FIGS. 7(A-C), FIGS. 8(A-C), or FIGS. 9(A-C), and the Example entitled “Antigenicity Profiles”). Immunogens include peptides, recombinant bacterial proteins, and mammalian expressed Tag 5 proteins and human and murine IgG FC fusion proteins. In addition, cells engineered to express high levels of a respective 191P4D12(b) variant, such as 293T-191P4D12(b) variant 1 or 300.19-191P4D12(b) variant 1murine Pre-B cells, are used to immunize mice.

[0756] To generate mAbs to a 191P4D12(b) variant, mice are first immunized intraperitoneally (IP) with, typically, 10-50 &mgr;g of protein immunogen or 107 191P4D12(b)-expressing cells mixed in complete Freund's adjuvant. Mice are then subsequently immunized IP every 2-4 weeks with, typically, 10-50 &mgr;g of protein immunogen or 107 cells mixed in incomplete Freund's adjuvant. Alternatively, MPL-TDM adjuvant is used in immunizations. In addition to the above protein and cell-based immunization strategies, a DNA-based immunization protocol is employed in which a mammalian expression vector encoding a 191P4D12(b) variant sequence is used to immunize mice by direct injection of the plasmid DNA. For example, amino acids 31-347 was cloned into the Tag5 mammalian secretion vector and the recombinant vector will then be used as immunogen. In another example the same amino acids are cloned into an Fc-fusion secretion vector in which the 191P4D12(b) variant 1 sequence is fused at the amino-terminus to an IgK leader sequence and at the carboxyl-terminus to the coding sequence of the human or murine IgG Fc region. This recombinant vector is then used as immunogen. The plasmid immunization protocols are used in combination with purified proteins expressed from the same vector and with cells expressing the respective 191P4D12(b) variant.

[0757] During the immunization protocol, test bleeds are taken 7-10 days following an injection to monitor titer and specificity of the immune response. Once appropriate reactivity and specificity is obtained as determined by ELISA, Western blotting, immunoprecipitation, fluorescence microscopy, and flow cytometric analyses, fusion and hybridoma generation is then carried out with established procedures well known in the art (see, e.g., Harlow and Lane, 1988).

[0758] In one embodiment for generating 191P4D12(b) monoclonal antibodies, a Tag5-191P4D12(b) variant 1 antigen encoding amino acids 31-347, was expressed (FIG. 22) and then purified from stably transfected 293T cells. Balb C mice are initially immunized intraperitoneally with 25 &mgr;g of the Tag5-191P4D12(b) variant 1 protein mixed in complete Freund's adjuvant. Mice are subsequently immunized every two weeks with 25 &mgr;g of the antigen mixed in incomplete Freund's adjuvant for a total of three immunizations. ELISA using the Tag5 antigen determines the titer of serum from immunized mice. Reactivity and specificity of serum to full length 191P4D12(b) variant 1 protein is monitored by Western blotting, immunoprecipitation and flow cytometry using 293T cells transfected with an expression vector encoding the 191P4D12(b) variant 1 cDNA (see e.g., the Example entitled “Production of Recombinant 191P4D12(b) (a) & (b) in Eukaryotic Systems” and FIG. 22). Other recombinant 191P4D12(b) variant 1-expressing cells or cells endogenously expressing 191P4D12(b) variant 1 are also used. Mice showing the strongest reactivity are rested and given a final injection of Tag5 antigen in PBS and then sacrificed four days later. The spleens of the sacrificed mice are harvested and fused to SPO/2 myeloma cells using standard procedures (Harlow and Lane, 1988). Supernatants from HAT selected growth wells are screened by ELISA, Western blot, immunoprecipitation, fluorescent microscopy, and flow cytometry to identify 191P4D12(b) specific antibody-producing clones.

[0759] To generate monoclonal antibodies that are specific for each 191P4D12(b) variant protein, immunogens are designed to encode sequences unique for each variant. In one embodiment, a GST-fusion antigen encoding the full sequence of 191P4D12(b) variant 9 (AA 1-137) is produced, purified, and used as immunogen to derive monoclonal antibodies specific to 191P4D12(b) variant 2. In another embodiment, an antigenic peptide composed of amino acids 400-420 of 191P4D12(b) variant 7 is coupled to KLH and used as immunogen. Hybridoma supernatants are then screened on the respective antigen and then further screened on cells expressing the specific variant and cross-screened on cells expressing the other variants to derive variant-specific monoclonal antibodies.

[0760] The binding affinity of a 191P4D12(b) variant monoclonal antibody is determined using standard technologies. Affinity measurements quantify the strength of antibody to epitope binding and are used to help define which 191P4D12(b) variant monoclonal antibodies preferred for diagnostic or therapeutic use, as appreciated by one of skill in the art. The BIAcore system (Uppsala, Sweden) is a preferred method for determining binding affinity. The BIAcore system uses surface plasmon resonance (SPR, Welford K. 1991, Opt. Quant. Elect. 23:1; Morton and Myszka, 1998, Methods in Enzymology 295: 268) to monitor biomolecular interactions in real time. BIAcore analysis conveniently generates association rate constants, dissociation rate constants, equilibrium dissociation constants, and affinity constants.

Example 12 HLA Class I and Class II Binding Assays

[0761] HLA class I and class II binding assays using purified HLA molecules are performed in accordance with disclosed protocols (e.g., PCT publications WO 94/20127 and WO 94/03205; Sidney et al., Current Protocols in Immunology 18.3.1 (1998); Sidney, et al., J. Immunol. 154:247 (1995); Sette, et al., Mol. Immunol. 31:813 (1994)). Briefly, purified MHC molecules (5 to 500 nM) are incubated with various unlabeled peptide inhibitors and 1-10 nM 125I-radiolabeled probe peptides as described. Following incubation, MHC-peptide complexes are separated from free peptide by gel filtration and the fraction of peptide bound is determined. Typically, in preliminary experiments, each MHC preparation is titered in the presence of fixed amounts of radiolabeled peptides to determine the concentration of HLA molecules necessary to bind 10-20% of the total radioactivity. All subsequent inhibition and direct binding assays are performed using these HLA concentrations.

[0762] Since under these conditions [label]<[HLA] and IC50≧[HLA], the measured IC50 values are reasonable approximations of the true KD values. Peptide inhibitors are typically tested at concentrations ranging from 120 &mgr;g/ml to 1.2 ng/ml, and are tested in two to four completely independent experiments. To allow comparison of the data obtained in different experiments, a relative binding figure is calculated for each peptide by dividing the IC50 of a positive control for inhibition by the IC50 for each tested peptide (typically unlabeled versiors of the radiolabeled probe peptide). For database purposes, and inter-experiment comparisons, relative binding values are compiled. These values can subsequently be converted back into IC50 nM values by dividing the IC50 nM of the positive controls for inhibition by the relative binding of the peptide of interest. This method of data compilation is accurate and consistent for comparing peptides that have been tested on different days, or with different lots of purified MHC.

[0763] Binding assays as outlined above may be used to analyze HLA supermotif and/or HLA motif-bearing peptides (see Table IV).

Example 13 Identification of HLA Supermotif- and Motif-Bearing CTL Candidate Epitopes

[0764] HLA vaccine compositions of the invention can include multiple epitopes. The multiple epitopes can comprise multiple HLA supermotifs or motifs to achieve broad population coverage. This example illustrates the identification and confirmation of supermotif- and motif-bearing epitopes for the inclusion in such a vaccine composition. Calculation of population coverage is performed using the strategy described below.

[0765] Computer Searches and Algorithms for Identification of Supermotif and/or Motif-bearing Epitomes

[0766] The searches performed to identify the motif-bearing peptide sequences in the Example entitled “Antigenicity Profiles” and Tables VIII-XXI and XXII-XLIX employ the protein sequence data from the gene product of 191P4D12(b) set forth in FIGS. 2 and 3, the specific search peptides used to generate the tables are listed in Table VII.

[0767] Computer searches for epitopes bearing HLA Class I or Class II supermotifs or motifs are performed as follows. All translated 191P4D12(b) protein sequences are analyzed using a text string search software program to identify potential peptide sequences containing appropriate HLA binding motifs; such programs are readily produced in accordance with information in the art in view of known motif/supermotif disclosures. Furthermore, such calculations can be made mentally.

[0768] Identified A2-, A3-, and DR-supermotif sequences are scored using polynomial algorithms to predict their capacity to bind to specific HLA-Class I or Class II molecules. These polynomial algorithms account for the impact of different amino acids at different positions, and are essentially based on the premise that the overall affinity (or AG) of peptide-HLA molecule interactions can be approximated as a linear polynomial function of the type:

“&Dgr;G”=a1i×a2i×a3i . . . ×ani

[0769] where aji is a coefficient which represents the effect of the presence of a given amino acid (j) at a given position (i) along the sequence of a peptide of n amino acids. The crucial assumption of this method is that the effects at each position are essentially independent of each other (i.e., independent binding of individual side-chains). When residue j occurs at position i in the peptide, it is assumed to contribute a constant amount ji to the free energy of binding of the peptide irrespective of the sequence of the rest of the peptide.

[0770] The method of derivation of specific algorithm coefficients has been described in Gulukota et al., J. Mol. Biol. 267:1258-126, 1997; (see also Sidney et al., Human Immunol. 45:79-93, 1996; and Southwood et al., J. Immunol. 160:3363-3373, 1998). Briefly, for all i positions, anchor and non-anchor alike, the geometric mean of the average relative binding (ARB) of all peptides carrying j is calculated relative to the remainder of the group, and used as the estimate of ji. For Class II peptides, if multiple alignments are possible, only the highest scoring alignment is utilized, following an iterative procedure. To calculate an algorithm score of a given peptide in a test set, the ARB values corresponding to the sequence of the peptide are multiplied. If this product exceeds a chosen threshold, the peptide is predicted to bind. Appropriate thresholds are chosen as a function of the degree of stringency of prediction desired.

[0771] Selection of HLA-A2 Supertype Cross-reactive Peptides

[0772] Protein sequences from 191P4D12(b) are scanned utilizing motif identification software, to identify 8-, 9-10- and 11-mer sequences containing the HLA-A2-supermotif main anchor specificity. Typically, these sequences are then scored using the protocol described above and the peptides corresponding to the positive-scoring sequences are synthesized and tested for their capacity to bind purified HLA-A*0201 molecules in vitro (HLA-A*0201 is considered a prototype A2 supertype molecule).

[0773] These peptides are then tested for the capacity to bind to additional A2-supertype molecules (A*0202, A*0203, A*0206, and A*6802). Peptides that bind to at least three of the five A2-supertype alleles tested are typically deemed A2- supertype cross-reactive binders. Preferred peptides bind at an affinity equal to or less than 500 nM to three or more HLA-A2 supertype molecules.

[0774] Selection of HLA-A3 Supermotif-beaning Epitopes

[0775] The 191P4D12(b) protein sequence(s) scanned above is also examined for the presence of peptides with the HLA-A3-supermotif primary anchors. Peptides corresponding to the HLA A3 supermotif-bearing sequences are then synthesized and tested for binding to HLA-A*0301 and HLA-A*L1101 molecules, the molecules encoded by the two most prevalent A3-supertype alleles. The peptides that bind at least one of the two alleles with binding affinities of ≦500 nM, often ≦200 nM, are then tested for binding cross-reactivity to the other common A3-supertype alleles (e.g., A*3101, A*3301, and A*6801) to identify those that can bind at least three of the five HLA-A3-supertype molecules tested.

[0776] Selection of HLA-B7 Supermotif Bearing Epitopes

[0777] The 191P4D12(b) protein(s) scanned above is also analyzed for the presence of 8-, 9-10-, or 11-mer peptides with the HLA-B7-supermotif. Corresponding peptides are synthesized and tested for binding to HLA-B*0702, the molecule encoded by the most common B7-supertype allele (i.e., the prototype B7 supertype allele). Peptides binding B*0702 with IC50 of ≦500 nM are identified using standard methods. These peptides are then tested for binding to other common B7-supertype molecules (e.g., B*3501, B*5101, B*5301, and B*5401). Peptides capable of binding to three or more of the five B7-supertype alleles tested are thereby identified.

[0778] Selection of A1 and A24 Motif-bearing Epitopes

[0779] To further increase population coverage, HLA-A1 and -A24 epitopes can also be incorporated into vaccine compositions. An analysis of the 191P4D12(b) protein can also be performed to identify HLA-A1- and A24-motif-containing sequences.

[0780] High affinity and/or cross-reactive binding epitopes that bear other motif and/or supermotifs are identified using analogous methodology.

Example 14 Confirmation of Immunogenicity

[0781] Cross-reactive candidate CTL A2-supermotif-bearing peptides that are identified as described herein are selected to confirm in vitro immunogenicity. Confirmation is performed using the following methodology:

[0782] Target Cell Lines for Cellular Screening:

[0783] The 0.221A2.1 cell line, produced by transferring the HLA-A2.1 gene into the HLA-A, -B, -C null mutant human B-lymphoblastoid cell line 721.221, is used as the peptide-loaded target to measure activity of HLA-A2.1-restricted CTL. This cell line is grown in RPMI-1640 medium supplemented with antibiotics, sodium pyruvate, nonessential amino acids and 10% (v/v) heat inactivated FCS. Cells that express an antigen of interest, or transfectants comprising the gene encoding the antigen of interest, can be used as target cells to confirm the ability of peptide-specific CTLs to recognize endogenous antigen.

[0784] Primary CTL Induction Cultures:

[0785] Generation of Dendritic Cells (DC): PBMCs are thawed in RPMI with 30 &mgr;g/ml DNAse, washed twice and resuspended in complete medium (RPMI-1640 plus 5% AB human serum, non-essential amino acids, sodium pyruvate, L-glutamine and penicillin/streptomycin). The monocytes are purified by plating 10×106 PBMC/well in a 6-well plate. After 2 hours at 37° C., the non-adherent cells are removed by gently shaking the plates and aspirating the supernatants. The wells are washed a total of three times with 3 ml RPMI to remove most of the non-adherent and loosely adherent cells. Three ml of complete medium containing 50 ng/ml of GM-CSF and 1,000 U/ml of IL-4 are then added to each well. TNF&agr; is added to the DCs on day 6 at 75 ng/ml and the cells are used for CTL induction cultures on day 7.

[0786] Induction of CTL with DC and Peptide: CD8+ T-cells are isolated by positive selection with Dynal immunomagnetic beads (Dynabeads® M-450) and the detacha-bead® reagent. Typically about 200-250×106 PBMC are processed to obtain 24×106 CD8+ T-cells (enough for a 48-well plate culture). Briefly, the PBMCs are thawed in RPMI with 30 &mgr;g/ml DNAse, washed once with PBS containing 1% human AB serum and resuspended in PBS/1% AB serum at a concentration of 20×106 cells/ml. The magnetic beads are washed 3 times with PBS/AB serum, added to the cells (140 &mgr;l beads/20×106 cells) and incubated for 1 hour at 4° C. with continuous mixing. The beads and cells are washed 4× with PBS/AB serum to remove the nonadherent cells and resuspended at 100×106 cells/ml (based on the original cell number) in PBS/AB serum containing 100 &mgr;l/ml detacha-bead® reagent and 30 &mgr;g/ml DNAse. The mixture is incubated for 1 hour at room temperature with continuous mixing. The beads are washed again with PBS/AB/DNAse to collect the CD8+ T-cells. The DC are collected and centrifuged at 1300 rpm for 5-7 minutes, washed once with PBS with 1% BSA, counted and pulsed with 40 &mgr;g/ml of peptide at a cell concentration of 1-2×106/ml in the presence of 3 &mgr;g/ml &bgr;2-microglobulin for 4 hours at 20° C. The DC are then irradiated (4,200 rads), washed 1 time with medium and counted again.

[0787] Setting up induction cultures: 0.25 ml cytokine-generated DC (at 1×105 cells/ml) are co-cultured with 0.25 ml of CD8+ T-cells (at 2×106 cell/ml) in each well of a 48-well plate in the presence of 10 ng/ml of IL-7. Recombinant human IL-10 is added the next day at afinal concentration of 10 ng/ml and rhuman IL-2 is added 48 hours later at 10 U/ml.

[0788] Restimulation of the induction cultures with peptide-pulsed adherent cells: Seven and fourteen days after the primary induction, the cells are restimulated with peptide-pulsed adherent cells. The PBMCs are thawed and washed twice with RPMI and DNAse. The cells are resuspended at 5×106 cells/ml and irradiated at −4200 rads. The PBMCs are plated at 2×106 in 0.5 ml complete medium per well and incubated for 2 hours at 37° C. The plates are washed twice with RPMI by tapping the plate gently to remove the nonadherent cells and the adherent cells pulsed with 10 &mgr;g/ml of peptide in the presence of 3 &mgr;g/ml &bgr;2 microglobulin in 0.25 ml RPMI/5%AB per well for 2 hours at 37° C. Peptide solution from each well is aspirated and the wells are washed once with RPMI. Most of the media is aspirated from the induction cultures (CD8+ cells) and brought to 0.5 ml with fresh media. The cells are then transferred to the wells containing the peptide-pulsed adherent cells. Twenty four hours later recombinant human IL-10 is added at a final concentration of 10 ng/ml and recombinant human IL2 is added the next day and again 2-3 days later at 501 U/ml (Tsai et al., Critical Reviews in Immunology 18(1-2):65-75, 1998). Seven days later, the cultures are assayed for CTL activity in a 51Cr release assay. In some experiments the cultures are assayed for peptide-specific recognition in the in situ IFN&ggr; ELISA at the time of the second restimulation followed by assay of endogenous recognition 7 days later. After expansion, activity is measured in both assays for a side-by-side comparison.

[0789] Measurement of CTL Lytic Activity by 51Cr Release.

[0790] Seven days after the second restimulation, cytotoxicity is determined in a standard (5 hr) 51Cr release assay by assaying individual wells at a single E:T. Peptide-pulsed targets are prepared by incubating the cells with 10 &mgr;g/ml peptide overnight at 37° C.

[0791] Adherent target cells are removed from culture flasks with trypsin-EDTA. Target cells are labeled with 200 &mgr;Ci of 51Cr sodium chromate (Dupont, Wilmington, Del.) for 1 hour at 37° C. Labeled target cells are resuspended at 106 per ml and diluted 1:10 with K562 cells at a concentration of 3.3×106/ml (an NK-sensitive erythroblastoma cell line used to reduce non-specific lysis). Target cells (100 &mgr;l) and effectors (100 &mgr;l) are plated in 96 well round-bottom plates and incubated for 5 hours at 37° C. At that time, 100 &mgr;l of supernatant are collected from each well and percent lysis is determined according to the formula:

[(cpm of the test sample−cpm of the spontaneous 51Cr release sample)/(cpm of the maximal 51Cr release sample−cpm of the spontaneous 51Cr release sample)]×100.

[0792] Maximum and spontaneous release are determined by incubating the labeled targets with 1% Triton X-100 and media alone, respectively. A positive culture is defined as one in which the specific lysis (sample-background) is 10% or higher in the case of individual wells and is 15% or more at the two highest E:T ratios when expanded cultures are assayed.

[0793] In situ Measurement of Human IFN&ggr; Production as an Indicator of Peptide-specific and Endogenous Recognition

[0794] Immulon 2 plates are coated with mouse anti-human IFN&ggr; monoclonal antibody (4 &mgr;g/ml 0.1M NaHCO3, pH8.2) overnight at 4° C. The plates are washed with Ca2+, Mg2+-free PBS/0.05% Tween 20 and blocked with PBS/10% FCS for two hours, after which the CTLs (100 &mgr;l/well) and targets (100 &mgr;l/well) are added to each well, leaving empty wells for the standards and blanks (which received media only). The target cells, either peptide-pulsed or endogenous targets, are used at a concentration of 1×106 cells/ml. The plates are incubated for 48 hours at 37° C. with 5% CO2.

[0795] Recombinant human IFN-gamma is added to the standard wells starting at 400 pg or 1200 pg/100 microliter/well and the plate incubated for two hours at 37° C. The plates are washed and 100 &rgr;l of biotinylated mouse anti-human IFN-gamma monoclonal antibody (2 microgram/ml in PBS/3%FCS/0.05% Tween 20) are added and incubated for 2 hours at room temperature. After washing again, 100 microliter HRP-streptavidin (1:4000) are added and the plates incubated for one hour at room temperature. The plates are then washed 6× with wash buffer, 100 microliter/well developing solution (TMB 1:1) are added, and the plates allowed to develop for 5-15 minutes. The reaction is stopped with 50 microliter/well 1M H3PO4 and read at OD450. A culture is considered positive if it measured at least 50 pg of IFN-gamma/well above background and is twice the background level of expression.

[0796] CTL Expansion.

[0797] Those cultures that demonstrate specific lytic activity against peptide-pulsed targets and/or tumor targets are expanded over a two week period with anti-CD3. Briefly, 5×104 CD8+ cells are added to a T25 flask containing the following: 1×106 irradiated (4,200 rad) PBMC (autologous or allogeneic) per ml, 2×105 irradiated (8,000 rad) EBV-transformed cells per ml, and OKT3 (anti-CD3) at 30 ng per ml in RPMI-1640 containing 10% (v/v) human AB serum, non-essential amino acids, sodium pyruvate, 25 &mgr;M 2-mercaptoethanol, L-glutamine and penicillin/streptomycin. Recombinanthuman IL2 is added 24 hours later at a final concentration of 2001 U/ml and every three days thereafter with fresh media at 501 U/ml. The cells are split if the cell concentration exceeds 1×106/ml and the cultures are assayed between days 13 and 15 at E:T ratios of 30, 10, 3 and 1:1 in the 51Cr release assay or at 1×106/ml in the in situ IFN&ggr; assay using the same targets as before the expansion.

[0798] Cultures are expanded in the absence of anti-CD3+ as follows. Those cultures that demonstrate specific lytic activity against peptide and endogenous targets are selected and 5×104 CD8+ cells are added to a T25 flask containing the following: 1×106 autologous PBMC per ml which have been peptide-pulsed with 10 &mgr;g/ml peptide for two hours at 37° C. and irradiated (4,200 rad); 2×105 irradiated (8,000 rad) EBV-transformed cells per ml RPMI-1640 containing 10%(v/v) human AB serum, non-essential AA, sodium pyruvate, 25 mM 2-ME, L-glutamine and gentamicin.

[0799] Immunogenicity of A2 Supermotif-bearing Peptides

[0800] A2-supermotif cross-reactive binding peptides are tested in the cellular assay for the ability to induce peptide-specific CTL in normal individuals. In this analysis, a peptide is typically considered to be an epitope if it induces peptide-specific CTLs in at least individuals, and preferably, also recognizes the endogenously expressed peptide.

[0801] Immunogenicity can also be confirmed using PBMCs isolated from patients bearing a tumor that expresses 191P4D12(b). Briefly, PBMCs are isolated from patients, re-stimulated with peptide-pulsed monocytes and assayed for the ability to recognize peptide-pulsed target cells as well as transfected cells endogenously expressing the antigen.

[0802] Evaluation of A*03/A11 Immunogenicity

[0803] HLA-A3 supermotif-bearing cross-reactive binding peptides are also evaluated for immunogenicity using methodology analogous for that used to evaluate the immunogenicity of the HLA-A2 supermotif peptides.

[0804] Evaluation of B7 Immunogenicity

[0805] Immunogenicity screening of the B7-supertype cross-reactive binding peptides identified as set forth herein are confirmed in a manner analogous to the confirmation of A2-and A3-supermotif-bearing peptides.

[0806] Peptides bearing other supermotifs/motifs, e.g., HLA-A1, HLA-A24 etc. are also confirmed using similar methodology

Example 15 Implementation of the Extended Supermotif to Improve the Binding Capacity of Native Epitopes by Creating Analogs

[0807] HLA motifs and supermotifs (comprising primary and/or secondary residues) are useful in the identification and preparation of highly cross-reactive native peptides, as demonstrated herein. Moreover, the definition of HLA motifs and supermotifs also allows one to engineer highly cross-reactive epitopes by identifying residues within a native peptide sequence which can be analoged to confer upon the peptide certain characteristics, e.g. greater cross-reactivity within the group of HLA molecules that comprise a supertype, and/or greater binding affinity for some or all of those HLA molecules. Examples of analoging peptides to exhibit modulated binding affinity are set forth in this example.

[0808] Analoging at Primary Anchor Residues

[0809] Peptide engineering strategies are implemented to further increase the cross-reactivity of the epitopes. For example, the main anchors of A2-supermotif-bearing peptides are altered, for example, to introduce a preferred L, I, V, or M at position 2, and I or V at the C-terminus.

[0810] To analyze the cross-reactivity of the analog peptides, each engineered analog is initially tested for binding to the prototype A2 supertype allele A*0201, then, if A*0201 binding capacity is maintained, for A2-supertype cross-reactivity.

[0811] Alternatively, a peptide is confirmed as binding one or all supertype members and then analoged to modulate binding affinity to any one (or more) of the supertype members to add population coverage.

[0812] The selection of analogs for immunogenicity in a cellular screening analysis is typically further restricted by the capacity of the parent wild type (WT) peptide to bind at least weakly, i.e., bind at an IC50 of 5000 nM or less, to three of more A2 supertype alleles. The rationale for this requirement is that the WT peptides must be present endogenously in sufficient quantity to be biologically relevant. Analoged peptides have been shown to have increased immunogenicity and cross-reactivity by T cells specific for the parent epitope (see, e.g., Parkhurst et al., J. Immunol. 157:2539, 1996; and Pogue et al., Proc. Natl. Acad. Sci. USA 92:8166, 1995).

[0813] In the cellular screening of these peptide analogs, it is important to confirm that analog-specific CTLs are also able to recognize the wild-type peptide and, when possible, target cells that endogenously express the epitope.

[0814] Analoging of HLA-A3 and B7-Supermotif-bearing Peptides

[0815] Analogs of HLA-A3 supermotif-bearing epitopes are generated using strategies similar to those employed in analoging HLA-A2 supermotif-bearing peptides. For example, peptides binding to 3/5 of the A3-supertype molecules are engineered at primary anchor residues to possess a preferred residue (V, S, M, or A) at position 2.

[0816] The analog peptides are then tested for the ability to bind A*03 and A*11 (prototype A3 supertype alleles). Those peptides that demonstrate ≦500 nM binding capacity are then confirmed as having A3-supertype cross-reactivity.

[0817] Similarly to the A2- and A3-motif bearing peptides, peptides binding 3 or more B7-supertype alleles can be improved, where possible, to achieve increased cross-reactive binding or greater binding affinity or binding half life. B7 supermotif-bearing peptides are, for example, engineered to possess a preferred residue (V, I, L, or F) at the C-terminal primary anchor position, as demonstrated by Sidney et al. (J. Immunol. 157:3480-3490, 1996).

[0818] Analoging at primary anchor residues of other motif and/or supermotif-bearing epitopes is performed in a like manner.

[0819] The analog peptides are then be confirmed for immunogenicity, typically in a cellular screening assay. Again, it is generally important to demonstrate that analog-specific CTLs are also able to recognize the wild-type peptide and, when possible, targets that endogenously express the epitope.

[0820] Analoging at Secondary Anchor Residues

[0821] Moreover, HLA supermotifs are of value in engineering highly cross-reactive peptides and/or peptides that bind HLA molecules with increased affinity by identifying particular residues at secondary anchor positions that are associated with such properties. For example, the binding capacity of a B7 supermotif-bearing peptide with an F residue at position 1 is analyzed. The peptide is then analoged to, for example, substitute L for F at position 1. The analoged peptide is evaluated for increased binding affinity, binding half life and/or increased cross-reactivity. Such a procedure identifies analoged peptides with enhanced properties.

[0822] Engineered analogs with sufficiently improved binding capacity or cross-reactivity can also be tested for immunogenicity in HLA-B7-transgenic mice, following for example, IFA immunization or lipopeptide immunization. Analoged peptides are additionally tested for the ability to stimulate a recall response using PBMC from patients with 191P4D12(b)-expressing tumors.

[0823] Other Analoging Strategies

[0824] Another form of peptide analoging, unrelated to anchor positions, involves the substitution of a cysteine with &agr;-amino butyric acid. Due to its chemical nature, cysteine has the propensity to form disulfide bridges and sufficiently alter the peptide structurally so as to reduce binding capacity. Substitution of &agr;-amino butyric acid for cysteine not only alleviates this problem, but has been shown to improve binding and crossbinding capabilities in some instances (see, e.g., the review by Sette et al., In: Persistent Viral Infections, Eds. R. Ahmed and I. Chen, John Wiley & Sons, England, 1999).

[0825] Thus, by the use of single amino acid substitutions, the binding properties and/or cross-reactivity of peptide ligands for HLA supertype molecules can be modulated.

Example 16 Identification and Confirmation of 191P4D12(b)-derived Sequences with HLA-DR Binding Motifs

[0826] Peptide epitopes bearing an HLA class II supermotif or motif are identified and confirmed as outlined below using methodology similar to that described for HLA Class I peptides.

[0827] Selection of HLA-DR-supermotif-bearing Epitopes.

[0828] To identify 191P4D12(b)-derived, HLA class II HTL epitopes, a 191P4D12(b) antigen is analyzed for the presence of sequences bearing an HLA-DR-motif or supermotif. Specifically, 15-mer sequences are selected comprising a DR-supermotif, comprising a 9-mer core, and three-residue N- and C-terminal flanking regions (15 amino acids total).

[0829] Protocols for predicting peptide binding to DR molecules have been developed (Southwood et al., J. Immunol. 160:3363-3373, 1998). These protocols, specific for individual DR molecules, allow the scoring, and ranking, of 9-mer core regions. Each protocol not only scores peptide sequences for the presence of DR-supermotif primary anchors (i.e., at position 1 and position 6) within a 9-mer core, but additionally evaluates sequences for the presence of secondary anchors. Using allele-specific selection tables (see, e.g., Southwood et al., ibid.), it has been found that these protocols efficiently select peptide sequences with a high probability of binding a particular DR molecule. Additionally, it has been found that performing these protocols in tandem, specifically those for DR1, DR4w4, and DR7, can efficiently select DR cross-reactive peptides.

[0830] The 191P4D12(b)-derived peptides identified above are tested for their binding capacity for various common HLA-DR molecules. All peptides are initially tested for binding to the DR molecules in the primary panel: DR1, DR4w4, and DR7. Peptides binding at least two of these three DR molecules are then tested for binding to DR2w2 &bgr;1, DR2w2 &bgr;2, DR6w19, and DR9 molecules in secondary assays. Finally, peptides binding at least two of the four secondary panel DR molecules, and thus cumulatively at least four of seven different DR molecules, are screened for binding to DR4w15, DR5w11, and DR8w2 molecules in tertiary assays. Peptides binding at least seven of the ten DR molecules comprising the primary, secondary, and tertiary screening assays are considered cross-reactive DR binders. 191P4D12(b)-derived peptides found to bind common HLA-DR alleles are of particular interest.

[0831] Selection of DR3 Motif Peptides

[0832] Because HLA-DR3 is an allele that is prevalent in Caucasian, Black, and Hispanic populations, DR3 binding capacity is a relevant criterion in the selection of HTL epitopes. Thus, peptides shown to be candidates may also be assayed for their DR3 binding capacity. However, in view of the binding specificity of the DR3 motif, peptides binding only to DR3 can also be considered as candidates for inclusion in a vaccine formulation.

[0833] To efficiently identify peptides that bind DR3, target 191P4D12(b) antigens are analyzed for sequences carrying one of the two DR3-specific binding motifs reported by Geluk et al. (J. Immunol. 152:5742-5748, 1994). The corresponding peptides are then synthesized and confirmed as having the ability to bind DR3 with an affinity of 1 &mgr;M or better, i.e., less than 1 &mgr;M. Peptides are found that meet this binding criterion and qualify as HLA class II high affinity binders.

[0834] DR3 binding epitopes identified in this manner are included in vaccine compositions with DR supermotif-bearing peptide epitopes.

[0835] Similarly to the case of HLA class I motif-bearing peptides, the class II motif-bearing peptides are analoged to improve affinity or cross-reactivity. For example, aspartic acid at position 4 of the 9-mer core sequence is an optimal residue for DR3 binding, and substitution for that residue often improves DR 3 binding.

Example 17 Immunogenicity of 191P4D12(b)-derived HTL Epitopes

[0836] This example determines immunogenic DR supermotif- and DR3 motif-bearing epitopes among those identified using the methodology set forth herein.

[0837] Immunogenicity of HTL epitopes are confirmed in a manner analogous to the determination of immunogenicity of CTL epitopes, by assessing the ability to stimulate HTL responses and/or by using appropriate transgenic mouse models. Immunogenicity is determined by screening for: 1.) in vitro primary induction using normal PBMC or 2.) recall responses from patients who have 191P4D12(b)-expressing tumors.

Example 18 Calculation of Phenotypic Frequencies of HLA-supertypes in Various Ethnic Backgrounds to Determine Breadth of Population Coverage

[0838] This example illustrates the assessment of the breadth of population coverage of a vaccine composition comprised of multiple epitopes comprising multiple supermotifs and/or motifs.

[0839] In order to analyze population coverage, gene frequencies of HLA alleles are determined. Gene frequencies for each HLA allele are calculated from antigen or allele frequencies utilizing the binomial distribution formulae gf=1-(SQRT(1-af)) (see, e.g., Sidney et al., Human Immunol. 45:79-93, 1996). To obtain overall phenotypic frequencies, cumulative gene frequencies are calculated, and the cumulative antigen frequencies derived by the use of the inverse formula [af=1−(1−Cgf)2].

[0840] Where frequency data is not available at the level of DNA typing, correspondence to the serologically defined antigen frequencies is assumed. To obtain total potential supertype population coverage no linkage disequilibrium is assumed, and only alleles confirmed to belong to each of the supertypes are included (minimal estimates). Estimates of total potential coverage achieved by inter-loci combinations are made by adding to the A coverage the proportion of the non-A covered population that could be expected to be covered by the B alleles considered (e.g., total=A+B*(1−A)). Confirmed members of the A3-like supertype are A3, A11, A31, A*3301, and A*6801. Although the A3-like supertype may also include A34, A66, and A*7401, these alleles were not included in overall frequency calculations. Likewise, confirmed members of the A2-like supertype family are A*0201, A*0202, A*0203, A*0204, A*0205, A*0206, A*0207, A*6802, and A*6901. Finally, the B7-like supertype-confirmed alleles are: B7, B*3501-03, B51, B*5301, B*5401, B*5501-2, B*5601, B*6701, and B*7801 (potentially also B*1401, B*3504-06, B*4201, and B*5602).

[0841] Population coverage achieved by combining the A2-, A3- and B7-supertypes is approximately 86% in five major ethnic groups. Coverage may be extended by including peptides bearing the A1 and A24 motifs. On average, A1 is present in 12% and A24 in 29% of the population across five different major ethnic groups (Caucasian, North American Black, Chinese, Japanese, and Hispanic). Together, these alleles are represented with an average frequency of 39% in these same ethnic populations. The total coverage across the major ethnicities when A1 and A24 are combined with the coverage of the A2-, A3- and B7-supertype alleles is >95%, see, e.g., Table IV (G). An analogous approach can be used to estimate population coverage achieved with combinations of class II motif-bearing epitopes.

[0842] Immunogenicity studies in humans (e.g., Bertoni et al., J. Clin. Invest. 100:503, 1997; Doolan et al., Immunity 7:97, 1997; and Threlkeld et al., J. Immunol. 159:1648, 1997) have shown that highly cross-reactive binding peptides are almost always recognized as epitopes. The use of highly cross-reactive binding peptides is an important selection criterion in identifying candidate epitopes for inclusion in a vaccine that is immunogenic in a diverse population.

[0843] With a sufficient number of epitopes (as disclosed herein and from the art), an average population coverage is predicted to be greater than 95% in each of five major ethnic populations. The game theory Monte Carlo simulation analysis, which is known in the art (see e.g., Osborne, M. J. and Rubinstein, A. “A course in game theory” MIT Press, 1994), can be used to estimate what percentage of the individuals in a population comprised of the Caucasian, North American Black, Japanese, Chinese, and Hispanic ethnic groups would recognize the vaccine epitopes described herein. A preferred percentage is 90%. A more preferred percentage is 95%.

Example 19 CTL Recognition Of Endogenously Processed Antigens After Priming

[0844] This example confirms that CTL induced by native or analoged peptide epitopes identified and selected as described herein recognize endogenously synthesized, i.e., native antigens.

[0845] Effector cells isolated from transgenic mice that are immunized with peptide epitopes, for example HLA-A2 supermotif-bearing epitopes, are re-stimulated in vitro using peptide-coated stimulator cells. Six days later, effector cells are assayed for cytotoxicity and the cell lines that contain peptide-specific cytotoxic activity are further re-stimulated. An additional six days later, these cell lines are tested for cytotoxic activity on 51Cr labeled Jurkat-A2.1/Kb target cells in the absence or presence of peptide, and also tested on 51Cr labeled target cells bearing the endogenously synthesized antigen, i.e. cells that are stably transfected with 191P4D12(b) expression vectors.

[0846] The results demonstrate that CTL lines obtained from animals primed with peptide epitope recognize endogenously synthesized 191P4D12(b) antigen. The choice of transgenic mouse model to be used for such an analysis depends upon the epitope(s) that are being evaluated. In addition to HLA-A*0201/Kb transgenic mice, several other transgenic mouse models including mice with human A11, which may also be used to evaluate A3 epitopes, and B7 alleles have been characterized and others (e.g., transgenic mice for HLA-A1 and A24) are being developed. HLA-DR1 and HLA-DR3 mouse models have also been developed, which may be used to evaluate HTL epitopes.

Example 20 Activity Of CTL-HTL Coniugated Epitopes In Transgenic Mice

[0847] This example illustrates the induction of CTLs and HTLs in transgenic mice, by use of a 191P4D12(b)-derived CTL and HTL peptide vaccine compositions. The vaccine composition used herein comprise peptides to be administered to a patient with a 191P4D12(b)-expressing tumor. The peptide composition can comprise multiple CTL and/or HTL epitopes. The epitopes are identified using methodology as described herein. This example also illustrates that enhanced immunogenicity can be achieved by inclusion of one or more HTL epitopes in a CTL vaccine composition; such a peptide composition can comprise an HTL epitope conjugated to a CTL epitope. The CTL epitope can be one that binds to multiple HLA family members at an affinity of 500 nM or less, or analogs of that epitope. The peptides may be lipidated, if desired.

[0848] Immunization procedures: Immunization of transgenic mice is performed as described (Alexander et al., J. Immunol. 159:4753-4761, 1997). For example, A2/Kb mice, which are transgenic for the human HLA A2.1 allele and are used to confirm the immunogenicity of HLA-A*0201 motif- or HLA-A2 supermotif-bearing epitopes, and are primed subcutaneously (base of the tail) with a 0.1 ml of peptide in Incomplete Freund's Adjuvant, or if the peptide composition is a lipidated CTL/HTL conjugate, in DMSO/saline, or if the peptide composition is a polypeptide, in PBS or incomplete Freund's Adjuvant. Seven days after priming, splenocytes obtained from these animals are restimulated with syngenic irradiated LPS-activated lymphoblasts coated with peptide.

[0849] Cell lines: Target cells for peptide-specific cytotoxicity assays are Jurkat cells transfected with the HLA-A2.1/Kb chimeric gene (e.g., Vitiello et al., J. Exp. Med. 173:1007, 1991)

[0850] In vitro CTL activation: One week after priming, spleen cells (30×106 cells/flask) are co-cultured at 37° C. with syngeneic, irradiated (3000 rads), peptide coated lymphoblasts (10×106 cells/flask) in 10 ml of culture medium/T25 flask. After six days, effector cells are harvested and assayed for cytotoxic activity.

[0851] Assay for cytotoxic activty: Target cells (1.0 to 1.5×106) are incubated at 37°60 C. in the presence of 200 &mgr;l of 51Cr. After 60 minutes, cells are washed three times and resuspended in R10 medium. Peptide is added where required at a concentration of 1 &mgr;g/ml. For the assay, 104 51Cr-labeled target cells are added to different concentrations of effector cells (final volume of 200 &mgr;l) in U-bottom 96-well plates. After a six hour incubation period at 37° C., a 0.1 ml aliquot of supernatant is removed from each well and radioactivity is determined in a Micromedic automatic gamma counter. The percent specific lysis is determined by the formula: percent specific release=100×(experimental release-spontaneous release)/(maximum release-spontaneous release). To facilitate comparison between separate CTL assays run under the same conditions, % 51Cr release data is expressed as lytic units/106 cells. One lytic unit is arbitrarily defined as the number of effector cells required to achieve 30% lysis of 10,000 target cells in a six hour 51Cr release assay. To obtain specific lytic units/106, the lytic units/106 obtained in the absence of peptide is subtracted from the lytic units/106 obtained in the presence of peptide. For example, if 30% 51Cr release is obtained at the effector (E): target (T) ratio of 50:1 (i.e., 5×105 effector cells for 10,000 targets) in the absence of peptide and 5:1 (i.e., 5×104 effector cells for 10,000 targets) in the presence of peptide, the specific lytic units would be: [(1/50,000)−(1/500,000)]×106=18 LU.

[0852] The results are analyzed to assess the magnitude of the CTL responses of animals injected with the immunogenic CTL/HTL conjugate vaccine preparation and are compared to the magnitude of the CTL response achieved using, for example, CTL epitopes as outlined above in the Example entitled “Confirmation of Immunogenicity.” Analyses similar to this may be performed to confirm the immunogenicity of peptide conjugates containing multiple CTL epitopes and/or multiple HTL epitopes. In accordance with these procedures, it is found that a CTL response is induced, and concomitantly that an HTL response is induced upon administration of such compositions.

Example 21 Selection of CTL and HTL Epitopes for Inclusion in a 191P4D12(b)-Specific Vaccine

[0853] This example illustrates a procedure for selecting peptide epitopes for vaccine compositions of the invention. The peptides in the composition can be in the form of a nucleic acid sequence, either single or one or more sequences (i.e., minigene) that encodes peptide(s), or can be single and/or polyepitopic peptides.

[0854] The following principles are utilized when selecting a plurality of epitopes for inclusion in a vaccine composition. Each of the following principles is balanced in order to make the selection.

[0855] Epitopes are selected which, upon administration, mimic immune responses that are correlated with 191P4D12(b) clearance. The number of epitopes used depends on observations of patients who spontaneously clear 191P4D12(b). For example, if it has been observed that patients who spontaneously clear 191P4D12(b)-expressing cells generate an immune response to at least three (3) epitopes from 191P4D12(b) antigen, then at least three epitopes should be included for HLA class I. A similar rationale is used to determine HLA class II epitopes.

[0856] Epitopes are often selected that have a binding affinity of an IC50 of 500 nM or less for an HLA class I molecule, or for class II, an IC50 of 1000 nM or less, or HLA Class I peptides with high binding scores from the BIMAS web site, at URL bimas.dcrt.nih.gov/.

[0857] In order to achieve broad coverage of the vaccine through out a diverse population, sufficient supermotif bearing peptides, or a sufficient array of allele-specific motif bearing peptides, are selected to give broad population coverage. In one embodiment, epitopes are selected to provide at least 80% population coverage. A Monte Carlo analysis, a statistical evaluation known in the art, can be employed to assess breadth, or redundancy, of population coverage.

[0858] When creating polyepitopic compositions, or a minigene that encodes same, it is typically desirable to generate the smallest peptide possible that encompasses the epitopes of interest. The principles employed are similar, if not the same, as those employed when selecting a peptide comprising nested epitopes. For example, a protein sequence for the vaccine composition is selected because it has maximal number of epitopes contained within the sequence, i.e., it has a high concentration of epitopes. Epitopes may be nested or overlapping (i.e., frame shifted relative to one another). For example, with overlapping epitopes, two 9-mer epitopes and one 10-mer epitope can be present in a 10 amino acid peptide. Each epitope can be exposed and bound by an HLA molecule upon administration of such a peptide. A multi-epitopic, peptide can be generated synthetically, recombinantly, or via cleavage from the native source. Alternatively, an analog can be made of this native sequence, whereby one or more of the epitopes comprise substitutions that alter the cross-reactivity and/or binding affinity properties of the polyepitopic peptide. Such a vaccine composition is administered for therapeutic or prophylactic purposes. This embodiment provides for the possibility that an as yet undiscovered aspect of immune system processing will apply to the native nested sequence and thereby facilitate the production of therapeutic or prophylactic immune response-inducing vaccine compositions. Additionally such an embodiment provides for the possibility of motif-bearing epitopes for an HLA makeup that is presently unknown. Furthermore, this embodiment (absent the creating of any analogs) directs the immune response to multiple peptide sequences that are actually present in 191P4D12(b), thus avoiding the need to evaluate any junctional epitopes. Lastly, the embodiment provides an economy of scale when producing nucleic acid vaccine compositions. Related to this embodiment, computer programs can be derived in accordance with principles in the art, which identify in a target sequence, the greatest number of epitopes per sequence length.

[0859] A vaccine composition comprised of selected peptides, when administered, is safe, efficacious, and elicits an immune response similar in magnitude to an immune response that controls or clears cells that bear or overexpress 191P4D12(b).

Example 22 Construction of “Minigene” Multi-Epitope DNA Plasmids

[0860] This example discusses the construction of a minigene expression plasmid. Minigene plasmids may, of course, contain various configurations of B cell, CTL and/or HTL epitopes or epitope analogs as described herein.

[0861] A minigene expression plasmid typically includes multiple CTL and HTL peptide epitopes. In the present example, HLA-A2, -A3, -B7 supermotif-bearing peptide epitopes and HLA-A1 and -A24 motif-bearing peptide epitopes are used in conjunction with DR supermotif-bearing epitopes and/or DR3 epitopes. HLA class I supermotif or motif-bearing peptide epitopes derived 191P4D12(b), are selected such that multiple supermotifs/motifs are represented to ensure broad population coverage. Similarly, HLA class II epitopes are selected from 191P4D12(b) to provide broad population coverage, i.e. both HLA DR-1-4-7 supermotif-bearing epitopes and HLA DR-3 motif-bearing epitopes are selected for inclusion in the minigene construct. The selected CTL and HTL epitopes are then incorporated into a minigene for expression in an expression vector.

[0862] Such a construct may additionally include sequences that direct the HTL epitopes to the endoplasmic reticulum. For example, the Ii protein may be fused to one or more HTL epitopes as described in the art, wherein the CLIP sequence of the Ii protein is removed and replaced with an HLA class II epitope sequence so that HLA class II epitope is directed to the endoplasmic reticulum, where the epitope binds to an HLA class II molecules.

[0863] This example illustrates the methods to be used for construction of a minigene-bearing expression plasmid. Other expression vectors that may be used for minigene compositions are available and known to those of skill in the art.

[0864] The minigene DNA plasmid of this example contains a consensus Kozak sequence and a consensus murine kappa Ig-light chain signal sequence followed by CTL and/or HTL epitopes selected in accordance with principles disclosed herein. The sequence encodes an open reading frame fused to the Myc and His antibody epitope tag coded for by the pcDNA 3.1 Myc-His vector.

[0865] Overlapping oligonucleotides that can, for example, average about 70 nucleotides in length with 15 nucleotide overlaps, are synthesized and HPLC-purified. The oligonucleotides encode the selected peptide epitopes as well as appropriate linker nucleotides, Kozak sequence, and signal sequence. The final multiepitope minigene is assembled by extending the overlapping oligonucleotides in three sets of reactions using PCR. A Perkin/Elmer 9600 PCR machine is used and a total of 30 cycles are performed using the following conditions: 95° C. for 15 sec, annealing temperature (5° below the lowest calculated Tm of each primer pair) for 30 sec, and 72° C. for 1 min.

[0866] For example, a minigene is prepared as follows. For a first PCR reaction, 5 &mgr;g of each of two oligonucleotides are annealed and extended: In an example using eight oligonucleotides, i.e., four pairs of primers, oligonucleotides 1+2, 3+4, 5+6, and 7+8 are combined in 100 &mgr;l reactions containing Pfu polymerase buffer (1x=10 mM KCL, 10 mM (NH4)2SO4, 20 mM Tris-chloride, pH 8.75, 2 mM MgSO4, 0.1% Triton X-100, 100 &mgr;g/ml BSA), 0.25 mM each dNTP, and 2.5 U of Pfu polymerase. The full-length dimer products are gel-purified, and two reactions containing the product of 1+2 and 3+4, and the product of 5+6 and 7+8 are mixed, annealed, and extended for 10 cycles. Half of the two reactions are then mixed, and 5 cycles of annealing and extension carried out before flanking primers are added to amplify the full length product. The full-length product is gel-purified and cloned into pCR-blunt (Invitrogen) and individual clones are screened by sequencing.

Example 23 The Plasmid Construct and the Degree to Which It Induces Immunogenicity

[0867] The degree to which a plasmid construct, for example a plasmid constructed in accordance with the previous Example, is able to induce immunogenicity is confirmed in vitro by determining epitope presentation by APC following transduction or transfection of the APC with an epitope-expressing nucleic acid construct. Such a study determines “antigenicity” and allows the use of human APC. The assay determines the ability of the epitope to be presented by the APC in a context that is recognized by a T cell by quantifying the density of epitope-HLA class I complexes on the cell surface. Quantitation can be performed by directly measuring the amount of peptide eluted from the APC (see, e.g., Sijts et al., J. Immunol. 156:683-692, 1996; Demotz et al., Nature 342:682-684, 1989); or the number of peptide-HLA class I complexes can be estimated by measuring the amount of lysis or lymphokine release induced by diseased or transfected target cells, and then determining the concentration of peptide necessary to obtain equivalent levels of lysis or lymphokine release (see, e.g., Kageyama et al., J. Immunol. 154:567-576, 1995).

[0868] Alternatively, immunogenicity is confirmed through in vivo injections into mice and subsequent in vitro assessment of CTL and HTL activity, which are analyzed using cytotoxicity and proliferation assays, respectively, as detailed e.g., in Alexander et al., Immunity 1:751-761, 1994.

[0869] For example, to confirm the capacity of a DNA minigene construct containing at least one HLA-A2 supermotif peptide to induce CTLs in vivo, HLA-A2.1/Kb transgenic mice, for example, are immunized intramuscularly with 100 &mgr;g of naked cDNA. As a means of comparing the level of CTLs induced by cDNA immunization, a control group of animals is also immunized with an actual peptide composition that comprises multiple epitopes synthesized as a single polypeptide as they would be encoded by the minigene.

[0870] Splenocytes from immunized animals are stimulated twice with each of the respective compositions (peptide epitopes encoded in the minigene or the polyepitopic peptide), then assayed for peptide-specific cytotoxic activity in a 51Cr release assay. The results indicate the magnitude of the CTL response directed against the A2-restricted epitope, thus indicating the in vivo immunogenicity of the minigene vaccine and polyepitopic vaccine.

[0871] It is, therefore, found that the minigene elicits immune responses directed toward the HLA-A2 supermotif peptide epitopes as does the polyepitopic peptide vaccine. A similar analysis is also performed using other HLA-A3 and HLA-B7 transgenic mouse models to assess CTL induction by HLA-A3 and HLA-B7 motif or supermotif epitopes, whereby it is also found that the minigene elicits appropriate immune responses directed toward the provided epitopes.

[0872] To confirm the capacity of a class II epitope-encoding minigene to induce HTLs in vivo, DR transgenic mice, or for those epitopes that cross react with the appropriate mouse MHC molecule, I-Ab-restricted mice, for example, are immunized intramuscularly with 100 &mgr;g of plasmid DNA. As a means of comparing the level of HTLs induced by DNA immunization, a group of control animals is also immunized with an actual peptide composition emulsified in complete Freund's adjuvant. CD4+ T cells, i.e. HTLs, are purified from splenocytes of immunized animals and stimulated with each of the respective compositions (peptides encoded in the minigene). The HTL response is measured using a 3H-thymidine incorporation proliferation assay, (see, e.g., Alexander et al. Immunity 1:751-761, 1994). The results indicate the magnitude of the HTL response, thus demonstrating the in vivo immunogenicity of the minigene.

[0873] DNA minigenes, constructed as described in the previous Example, can also be confirmed as a vaccine in combination with a boosting agent using a prime boost protocol. The boosting agent can consist of recombinant protein (e.g., Barnett et al., Aids Res. and Human Retroviruses 14, Supplement 3:S299-S309, 1998) or recombinant vaccinia, for example, expressing a minigene or DNA encoding the complete protein of interest (see, e.g., Hanke et al., Vaccine 16:439-445,1998; Sedegah et al., Proc. Natl. Acad. Sci USA 95:7648-53, 1998; Hanke and McMichael, Immunol. Letters 66:177-181, 1999; and Robinson et al., Nature Med. 5:526-34, 1999).

[0874] For example, the efficacy of the DNA minigene used in a prime boost protocol is initially evaluated in transgenic mice. In this example, A2.1/Kb transgenic mice are immunized IM with 100 &mgr;g of a DNA minigene encoding the immunogenic peptides including at least one HLA-A2 supermotif-bearing peptide. After an incubation period (ranging from 3-9 weeks), the mice are boosted IP with 107 pfu/mouse of a recombinant vaccinia virus expressing the same sequence encoded by the DNA minigene. Control mice are immunized with 100 &mgr;g of DNA or recombinant vaccinia without the minigene sequence, or with DNA encoding the minigene, but without the vaccinia boost. After an additional incubation period of two weeks, splenocytes from the mice are immediately assayed for peptide-specific activity in an ELISPOT assay. Additionally, splenocytes are stimulated in vitro with the A2- restricted peptide epitopes encoded in the minigene and recombinant vaccinia, then assayed for peptide-specific activity in an alpha, beta and/or gamma IFN ELISA.

[0875] It is found that the minigene utilized in a prime-boost protocol elicits greater immune responses toward the HLA-A2 supermotif peptides than with DNA alone. Such an analysis can also be performed using HLA-A11 or HLA-B7 transgenic mouse models to assess CTL induction by HLA-A3 or HLA-B7 motif or supermotif epitopes. The use of prime boost protocols in humans is described below in the Example entitled “Induction of CTL Responses Using a Prime Boost Protocol.”

Example 24 Peptide Compositions for Prophylactic Uses

[0876] Vaccine compositions of the present invention can be used to prevent 191P4D12(b) expression in persons who are at risk for tumors that bear this antigen. For example, a polyepitopic peptide epitope composition (or a nucleic acid comprising the same) containing multiple CTL and HTL epitopes such as those selected in the above Examples, which are also selected to target greater than 80% of the population, is administered to individuals at risk for a 191P4D12(b)-associated tumor.

[0877] For example, a peptide-based composition is provided as a single polypeptide that encompasses multiple epitopes. The vaccine is typically administered in a physiological solution that comprises an adjuvant, such as Incomplete Freunds Adjuvant. The dose of peptide for the initial immunization is from about 1 to about 50,000 &mgr;g, generally 100-5,000 &mgr;g, for a 70 kg patient. The initial administration of vaccine is followed by booster dosages at 4 weeks followed by evaluation of the magnitude of the immune response in the patient, by techniques that determine the presence of epitope-specific CTL populations in a PBMC sample. Additional booster doses are administered as required. The composition is found to be both safe and efficacious as a prophylaxis against 191P4D12(b)-associated disease.

[0878] Alternatively, a composition typically comprising transfecting agents is used for the administration of a nucleic acid-based vaccine in accordance with methodologies known in the art and disclosed herein.

Example 25 Polyepitopic Vaccine Compositions Derived from Native 191P4D12(b) Sequences

[0879] A native 191P4D12(b) polyprotein sequence is analyzed, preferably using computer algorithms defined for each class I and/or class II supermotif or motif, to identify “relatively short” regions of the polyprotein that comprise multiple epitopes. The “relatively short” regions are preferably less in length than an entire native antigen. This relatively short sequence that contains multiple distinct or overlapping, “nested” epitopes can be used to generate a minigene construct. The construct is engineered to express the peptide, which corresponds to the native protein sequence. The “relatively short” peptide is generally less than 250 amino acids in length, often less than 100 amino acids in length, preferably less than 75 amino acids in length, and more preferably less than 50 amino acids in length. The protein sequence of the vaccine composition is selected because it has maximal number of epitopes contained within the sequence, i.e., it has a high concentration of epitopes. As noted herein, epitope motifs may be nested or overlapping (i.e., frame shifted relative to one another). For example, with overlapping epitopes, two 9-mer epitopes and one 10-mer epitope can be present in a 10 amino acid peptide. Such a vaccine composition is administered for therapeutic or prophylactic purposes.

[0880] The vaccine composition will include, for example, multiple CTL epitopes from 191P4D12(b) antigen and at least one HTL epitope. This polyepitopic native sequence is administered either as a peptide or as a nucleic acid sequence which encodes the peptide. Alternatively, an analog can be made of this native sequence, whereby one or more of the epitopes comprise substitutions that alter the cross-reactivity and/or binding affinity properties of the polyepitopic peptide.

[0881] The embodiment of this example provides for the possibility that an as yet undiscovered aspect of immune system processing will apply to the native nested sequence and thereby facilitate the production of therapeutic or prophylactic immune response-inducing vaccine compositions. Additionally, such an embodiment provides for the possibility of motif-bearing epitopes for an HLA makeup(s) that is presently unknown. Furthermore, this embodiment (excluding an analoged embodiment) directs the immune response to multiple peptide sequences that are actually present in native 191P4D12(b), thus avoiding the need to evaluate any junctional epitopes. Lastly, the embodiment provides an economy of scale when producing peptide or nucleic acid vaccine compositions.

[0882] Related to this embodiment, computer programs are available in the art which can be used to identify in a target sequence, the greatest number of epitopes per sequence length.

Example 26 Polyepitopic Vaccine Compositions from Multiple Antigens

[0883] The 191P4D12(b) peptide epitopes of the present invention are used in conjunction with epitopes from other target tumor-associated antigens, to create a vaccine composition that is useful for the prevention or treatment of cancer that expresses 191P4D12(b) and such other antigens. For example, a vaccine composition can be provided as a single polypeptide that incorporates multiple epitopes from 191P4D12(b) as well as tumor-associated antigens that are often expressed with a target cancer associated with 191P4D12(b) expression, or can be administered as a composition comprising a cocktail of one or more discrete epitopes. Alternatively, the vaccine can be administered as a minigene construct or as dendritic cells which have been loaded with the peptide epitopes in vitro.

Example 27 Use of Peptides to Evaluate an Immune Response

[0884] Peptides of the invention may be used to analyze an immune response for the presence of specific antibodies, CTL or HTL directed to 191P4D12(b). Such an analysis can be performed in a manner described by Ogg et al., Science 279:2103-2106, 1998. In this Example, peptides in accordance with the invention are used as a reagent for diagnostic or prognostic purposes, not as an immunogen.

[0885] In this example highly sensitive human leukocyte antigen tetrameric complexes (“tetramers”) are used for a cross-sectional analysis of, for example, 191P4D12(b) HLA-A*0201-specific CTL frequencies from HLA A*0201 -positive individuals at different stages of disease or following immunization comprising a 191P4D12(b) peptide containing an A*0201 motif. Tetrameric complexes are synthesized as described (Musey et al., N. Engl. J. Med. 337:1267, 1997). Briefly, purified HLA heavy chain (A*0201 in this example) and &bgr;2-microglobulin are synthesized by means of a prokaryotic expression system. The heavy chain is modified by deletion of the transmembrane-cytosolic tail and COOH-terminal addition of a sequence containing a BirA enzymatic biotinylation site. The heavy chain, &bgr;2-microglobulin, and peptide are refolded by dilution. The 45-kD refolded product is isolated by fast protein liquid chromatography and then biotinylated by BirA in the presence of biotin (Sigma, St. Louis, Mo.), adenosine 5′ triphosphate and magnesium. Streptavidin-phycoerythrin conjugate is added in a 1:4 molar ratio, and the tetrameric product is concentrated to 1 mg/ml. The resulting product is referred to as tetramer-phycoerythrin.

[0886] For the analysis of patient blood samples, approximately one million PBMCs are centrifuged at 300 g for 5 minutes and resuspended in 50 &mgr;l of cold phosphate-buffered saline. Tri-color analysis is performed with the tetramer-phycoerythrin, along with anti-CD8-Tricolor, and anti-CD38. The PBMCs are incubated with tetramer and antibodies on ice for 30 to 60 min and then washed twice before formaldehyde fixation. Gates are applied to contain >99.98% of control samples. Controls for the tetramers include both A*0201-negative individuals and A*0201-positive non-diseased donors. The percentage of cells stained with the tetramer is then determined by flow cytometry. The results indicate the number of cells in the PBMC sample that contain epitope-restricted CTLs, thereby readily indicating the extent of immune response to the 191P4D12(b) epitope, and thus the status of exposure to 191P4D12(b), or exposure to a vaccine that elicits a protective or therapeutic response.

Example 28 Use of Peptide Epitopes to Evaluate Recall Responses

[0887] The peptide epitopes of the invention are used as reagents to evaluate T cell responses, such as acute or recall responses, in patients. Such an analysis may be performed on patients who have recovered from 191P4D12(b)-associated disease or who have been vaccinated with a 191P4D12(b) vaccine.

[0888] For example, the class I restricted CTL response of persons who have been vaccinated may be analyzed. The vaccine may be any 191P4D12(b) vaccine. PBMC are collected from vaccinated individuals and HLA typed. Appropriate peptide epitopes of the invention that, optimally, bear supermotifs to provide cross-reactivity with multiple HLA supertype family members, are then used for analysis of samples derived from individuals who bear that HLA type.

[0889] PBMC from vaccinated individuals are separated on Ficoll-Histopaque density gradients (Sigma Chemical Co., St. Louis, Mo.), washed three times in HBSS (GIBCO Laboratories), resuspended in RPMI-1640 (GIBCO Laboratories) supplemented with L-glutamine (2mM), penicillin (50 U/ml), streptomycin (50 &mgr;g/ml), and Hepes (10 mM) containing 10% heat-inactivated human AB serum (complete RPMI) and plated using microculture formats. A synthetic peptide comprising an epitope of the invention is added at 10 &mgr;g/ml to each well and HBV core 128-140 epitope is added at 1 &mgr;g/ml to each well as a source of T cell help during the first week of stimulation.

[0890] In the microculture format, 4×105 PBMC are stimulated with peptide in 8 replicate cultures in 96-well round bottom plate in 100 &mgr;l/well of complete RPMI. On days 3 and 10, 100 &mgr;l of complete RPMI and 20 U/ml final concentration of rlL-2 are added to each well. On day 7 the cultures are transferred into a 96-well flat-bottom plate and restimulated with peptide, rlL-2 and 105 irradiated (3,000 rad) autologous feeder cells. The cultures are tested for cytotoxic activity on day 14. A positive CTL response requires two or more of the eight replicate cultures to display greater than 10% specific 51Cr release, based on comparison with non-diseased control subjects as previously described (Rehermann, et al., Nature Med. 2:1104,1108, 1996; Rehermann et al., J. Clin. Invest. 97:1655-1665, 1996; and Rehermann et al. J. Clin. Invest. 98:1432-1440, 1996).

[0891] Target cell lines are autologous and allogeneic EBV-transformed B-LCL that are either purchased from the American Society for Histocompatibility and Immunogenetics (ASHI, Boston, Mass.) or established from the pool of patients as described (Guilhot, et al. J. Virol. 66:2670-2678, 1992).

[0892] Cytotoxicity assays are performed in the following manner. Target cells consist of either allogeneic HLA-matched or autologous EBV-transformed B lymphoblastoid cell line that are incubated overnight with the synthetic peptide epitope of the invention at 10 &mgr;M, and labeled with 100 &mgr;Ci of 51Cr (Amersham Corp., Arlington Heights, Ill.) for 1 hour after which they are washed four times with HBSS.

[0893] Cytolytic activity is determined in a standard 4-h, split well 51Cr release assay using U-bottomed 96 well plates containing 3,000 targets/well. Stimulated PBMC are tested at effector/target (E/T) ratios of 20-50:1 on day 14. Percent cytotoxicity is determined from the formula: 100×[(experimental release-spontaneous release)/maximum release-spontaneous release)]. Maximum release is determined by lysis of targets by detergent (2% Triton X-100; Sigma Chemical Co., St. Louis, Mo.). Spontaneous release is <25% of maximum release for all experiments.

[0894] The results of such an analysis indicate the extent to which HLA-restricted CTL populations have been stimulated by previous exposure to 191P4D12(b) or a 191P4D12(b) vaccine.

[0895] Similarly, Class II restricted HTL responses may also be analyzed. Purified PBMC are cultured in a 96-well flat bottom plate at a density of 1.5×105 cells/well and are stimulated with 10 &mgr;g/ml synthetic peptide of the invention, whole 191P4D12(b) antigen, or PHA. Cells are routinely plated in replicates of 4-6 wells for each condition. After seven days of culture, the medium is removed and replaced with fresh medium containing 10 U/ml IL-2. Two days later, 1 &mgr;Ci 3H-thymidine is added to each well and incubation is continued for an additional 18 hours. Cellular DNA is then harvested on glass fiber mats and analyzed for 3H-thymidine incorporation. Antigen-specific T cell proliferation is calculated as the ratio of 3H-thymidine incorporation in the presence of antigen divided by the 3H-thymidine incorporation in the absence of antigen.

Example 29 Induction of Specific CTL Response in Humans

[0896] A human clinical trial for an immunogenic composition comprising CTL and HTL epitopes of the invention is set up as an IND Phase I, dose escalation study and carried out as a randomized, double-blind, placebo-controlled trial. Such a trial is designed, for example, as follows:

[0897] A total of about 27 individuals are enrolled and divided into 3 groups:

[0898] Group I: 3 subjects are injected with placebo and 6 subjects are injected with 5 &mgr;g of peptide composition;

[0899] Group II: 3 subjects are injected with placebo and 6 subjects are injected with 50 &mgr;g peptide composition;

[0900] Group III: 3 subjects are injected with placebo and 6 subjects are injected with 500 &mgr;g of peptide composition.

[0901] After 4 weeks following the first injection, all subjects receive a booster inoculation at the same dosage.

[0902] The endpoints measured in this study relate to the safety and tolerability of the peptide composition as well as its immunogenicity. Cellular immune responses to the peptide composition are an index of the intrinsic activity of this the peptide composition, and can therefore be viewed as a measure of biological efficacy. The following summarize the clinical and laboratory data that relate to safety and efficacy endpoints.

[0903] Safety: The incidence of adverse events is monitored in the placebo and drug treatment group and assessed in terms of degree and reversibility.

[0904] Evaluation of Vaccine Efficacy: For evaluation of vaccine efficacy, subjects are bled before and after injection. Peripheral blood mononuclear cells are isolated from fresh heparinized blood by Ficoll-Hypaque density gradient centrifugation, aliquoted in freezing media and stored frozen. Samples are assayed for CTL and HTL activity.

[0905] The vaccine is found to be both safe and efficacious.

Example 30 Phase II Trials in Patients Expressing 191P4D12(b)

[0906] Phase II trials are performed to study the effect of administering the CTL-HTL peptide compositions to patients having cancer that expresses 191P4D12(b). The main objectives of the trial are to determine an effective dose and regimen for inducing CTLs in cancer patients that express 191P4D12(b), to establish the safety of inducing a CTL and HTL response in these patients, and to see to what extent activation of CTLs improves the clinical picture of these patients, as manifested, e.g., by the reduction and/or shrinking of lesions. Such a study is designed, for example, as follows:

[0907] The studies are performed in multiple centers. The trial design is an open-label, uncontrolled, dose escalation protocol wherein the peptide composition is administered as a single dose followed six weeks later by a single booster shot of the same dose. The dosages are 50, 500 and 5,000 micrograms per injection. Drug-associated adverse effects (severity and reversibility) are recorded.

[0908] There are three patient groupings. The first group is injected with 50 micrograms of the peptide composition and the second and third groups with 500 and 5,000 micrograms of peptide composition, respectively. The patients within each group range in age from 21-65 and represent diverse ethnic backgrounds. All of them have a tumor that expresses 191P4D12(b).

[0909] Clinical manifestations or antigen-specific T-cell responses are monitored to assess the effects of administering the peptide compositions. The vaccine composition is found to be both safe and efficacious in the treatment of 191P4D12(b)-associated disease.

Example 31 Induction of CTL Responses Using a Prime Boost Protocol

[0910] A prime boost protocol similar in its underlying principle to that used to confirm the efficacy of a DNA vaccine in transgenic mice, such as described above in the Example entitled “The Plasmid Construct and the Degree to Which It Induces Immunogenicity,” can also be used for the administration of the vaccine to humans. Such a vaccine regimen can include an initial administration of, for example, naked DNA followed by a boost using recombinant virus encoding the vaccine, or recombinant protein/polypeptide or a peptide mixture administered in an adjuvant.

[0911] For example, the initial immunization may be performed using an expression vector, such as that constructed in the Example entitled “Construction of “Minigene” Multi-Epitope DNA Plasmids” in the form of naked nucleic acid administered IM (or SC or ID) in the amounts of 0.5-5 mg at multiple sites. The nucleic acid (0.1 to 1000 &mgr;g) can also be administered using a gene gun. Following an incubation period of 3-4 weeks, a booster dose is then administered. The booster can be recombinant fowlpox virus administered at a dose of 5-107 to 5×109 pfu. An alternative recombinant virus, such as an MVA, canarypox, adenovirus, or adeno-associated virus, can also be used for the booster, or the polyepitopic protein or a mixture of the peptides can be administered. For evaluation of vaccine efficacy, patient blood samples are obtained before immunization as well as at intervals following administration of the initial vaccine and booster doses of the vaccine. Peripheral blood mononuclear cells are isolated from fresh heparinized blood by Ficoll-Hypaque density gradient centrifugation, aliquoted in freezing media and stored frozen. Samples are assayed for CTL and HTL activity.

[0912] Analysis of the results indicates that a magnitude of response sufficient to achieve a therapeutic or protective immunity against 191P4D12(b) is generated.

Example 32 Administration of Vaccine Compositions Using Dendritic Cells (DC)

[0913] Vaccines comprising peptide epitopes of the invention can be administered using APCs, or “professional” APCs such as DC. In this example, peptide-pulsed DC are administered to a patient to stimulate a CTL response in vivo. In this method, dendritic cells are isolated, expanded, and pulsed with a vaccine comprising peptide CTL and HTL epitopes of the invention. The dendritic cells are infused back into the patient to elicit CTL and HTL responses in vivo. The induced CTL and HTL then destroy or facilitate destruction, respectively, of the target cells that bear the 191P4D12(b) protein from which the epitopes in the vaccine are derived.

[0914] For example, a cocktail of epitope-comprising peptides is administered ex vivo to PBMC, or isolated DC therefrom. A pharmaceutical to facilitate harvesting of DC can be used, such as Progenipoietin™ (Monsanto, St. Louis, Mo.) or GM-CSF/IL-4. After pulsing the DC with peptides, and prior to reinfusion into patients, the DC are washed to remove unbound peptides.

[0915] As appreciated clinically, and readily determined by one of skill based on clinical outcomes, the number of DC reinfused into the patient can vary (see, e.g., Nature Med. 4:328, 1998; Nature Med. 2:52, 1996 and Prostate 32:272, 1997). Although 2-50×106 DC per patient are typically administered, larger number of DC, such as 107 or 108 can also be provided. Such cell populations typically contain between 50-90% DC.

[0916] In some embodiments, peptide-loaded PBMC are injected into patients without purification of the DC. For example, PBMC generated after treatment with an agent such as Progenipoietin™ are injected into patients without purification of the DC. The total number of PBMC that are administered often ranges from 108 to 1010. Generally, the cell doses injected into patients is based on the percentage of DC in the blood of each patient, as determined, for example, by immunofluorescence analysis with specific anti-DC antibodies. Thus, for example, if Progenipoietin™ mobilizes 2% DC in the peripheral blood of a given patient, and that patient is to receive 5×106 DC, then the patient will be injected with a total of 2.5×108 peptide-loaded PBMC. The percent DC mobilized by an agent such as Progenipoietin™ is typically estimated to be between 2-10%, but can vary as appreciated by one of skill in the art.

[0917] Ex vivo Activation of CTL/HTL Responses

[0918] Alternatively, ex vivo CTL or HTL responses to 191P4D12(b) antigens can be induced by incubating, in tissue culture, the patient's, or genetically compatible, CTL or HTL precursor cells together with a source of APC, such as DC, and immunogenic peptides. After an appropriate incubation time (typically about 7-28 days), in which the precursor cells are activated and expanded into effector cells, the cells are infused into the patient, where they will destroy (CTL) or facilitate destruction (HTL) of their specific target cells, ie., tumor cells.

Example 33 An Alternative Method of Identifying and Confirming Motif-Bearing Peptides

[0919] Another method of identifying and confirming motif-bearing peptides is to elute them from cells bearing defined MHC molecules. For example, EBV transformed B cell lines used for tissue typing have been extensively characterized to determine which HLA molecules they express. In certain cases these cells express only a single type of HLA molecule. These cells can be transfected with nucleic acids that express the antigen of interest, e.g. 191P4D12(b). Peptides produced by endogenous antigen processing of peptides produced as a result of transfection will then bind to HLA molecules within the cell and be transported and displayed on the cell's surface. Peptides are then eluted from the HLA molecules by exposure to mild acid conditions and their amino acid sequence determined, e.g., by mass spectral analysis (e.g., Kubo et al., J. Immunol. 152:3913, 1994). Because the majority of peptides that bind a particular HLA molecule are motif-bearing, this is an alternative modality for obtaining the motif-bearing peptides correlated with the particular HLA molecule expressed on the cell.

[0920] Alternatively, cell lines that do not express endogenous HLA molecules can be transfected with an expression construct encoding a single HLA allele. These cells can then be used as described, i.e., they can then be transfected with nucleic acids that encode 191P4D12(b) to isolate peptides corresponding to 191P4D12(b) that have been presented on the cell surface. Peptides obtained from such an analysis will bear motif(s) that correspond to binding to the single HLA allele that is expressed in the cell.

[0921] As appreciated by one in the art, one can perform a similar analysis on a cell bearing more than one HLA allele and subsequently determine peptides specific for each HLA allele expressed. Moreover, one of skill would also recognize that means other than transfection, such as loading with a protein antigen, can be used to provide a source of antigen to the cell.

Example 34 Complementary Polynucleotides

[0922] Sequences complementary to the 191P4D12(b)-encoding sequences, or any parts thereof, are used to detect, decrease, or inhibit expression of naturally occurring 191P4D12(b). Although use of oligonucleotides comprising from about 15 to 30 base pairs is described, essentially the same procedure is used with smaller or with larger sequence fragments. Appropriate oligonucleotides are designed using, e.g., OLIGO 4.06 software (National Biosciences) and the coding sequence of 191P4D12(b). To inhibit transcription, a complementary oligonucleotide is designed from the most unique 5′ sequence and used to prevent promoter binding to the coding sequence. To inhibit translation, a complementary oligonucleotide is designed to prevent ribosomal binding to a 191P4D12(b)-encoding transcript.

Example 35 Purification of Naturally-occurring or Recombinant 191P4D12(b) Using 191P4D12(b)-Specific Antibodies

[0923] Naturally occurring or recombinant 191P4D12(b) is substantially purified by immunoaffinity chromatography using antibodies specific for 191P4D12(b). An immunoaffinity column is constructed by covalently coupling anti-191P4D12(b) antibody to an activated chromatographic resin, such as CNBr-activated SEPHAROSE (Amersham Pharmacia Biotech). After the coupling, the resin is blocked and washed according to the manufacturer's instructions.

[0924] Media containing 191P4D12(b) are passed over the immunoaffinity column, and the column is washed under conditions that allow the preferential absorbance of 191P4D12(b) (e.g., high ionic strength buffers in the presence of detergent). The column is eluted under conditions that disrupt antibody/191P4D12(b) binding (e.g., a buffer of pH 2 to pH 3, or a high concentration of a chaotrope, such as urea or thiocyanate ion), and GCR.P is collected.

Example 36 Identification of Molecules Which Interact with 191P4D12(b)

[0925] 191P4D12(b), or biologically active fragments thereof, are labeled with 121 1 Bolton-Hunter reagent. (See, e.g., Bolton et al. (1973) Biochem. J. 133:529.) Candidate molecules previously arrayed in the wells of a multi-well plate are incubated with the labeled 191P4D12(b), washed, and any wells with labeled 191P4D12(b) complex are assayed. Data obtained using different concentrations of 191P4D12(b) are used to calculate values for the number, affinity, and association of 191P4D12(b) with the candidate molecules.

Example 37 In Vivo Assay for 191P4D12(b) Tumor Growth Promotion

[0926] The effect of the 191P4D12(b) protein on tumor cell growth is evaluated in vivo by evaluating tumor development and growth of cells expressing or lacking 191P4D12(b). For example, SCID mice are injected subcutaneously on each flank with 1×106 of either 3T3, prostate (e.g. PC3 cells), bladder (e.g. UM-UC3 cells), kidney (e.g. CaKi cells), or lung (e.g. A427 cells) cancer cell lines containing tkNeo empty vector or 191P4D12(b). At least two strategies may be used: (1) Constitutive 191P4D12(b) expression under regulation of a promoter such as a constitutive promoter obtained from the genomes of viruses such as polyoma virus, fowlpox virus (UK 2,211,504 published 5 Jul. 1989), adenovirus (such as Adenovirus 2), bovine papilloma virus, avian sarcoma virus, cytomegalovirus, a retrovirus, hepatitis-B virus and Simian Virus 40 (SV40), or from heterologous mammalian promoters, e.g., the actin promoter or an immunoglobulin promoter, provided such promoters are compatible with the host cell systems, and (2) Regulated expression under control of an inducible vector system, such as ecdysone, tetracycline, etc., provided such promoters are compatible with the host cell systems. Tumor volume is then monitored by caliper measurement at the appearance of palpable tumors and followed over time to determine if 191P4D12(b)-expressing cells grow at a faster rate and whether tumors produced by 191P4D12(b)-expressing cells demonstrate characteristics of altered aggressiveness (e.g. enhanced metastasis, vascularization, reduced responsiveness to chemotherapeutic drugs).

[0927] Additionally, mice can be implanted with 1×105 of the same cells orthotopically to determine if 191P4D12(b) has an effect on local growth in the prostate, and whether 191P4D12(b) affects the ability of the cells to metastasize, specifically to lymph nodes, and bone (Miki T et al, Oncol Res. 2001;12:209; Fu X et al, Int J Cancer. 1991, 49:938). The effect of 191P4D12(b) on bone tumor formation and growth may be assessed by injecting tumor cells intratibially.

[0928] The assay is also useful to determine the 191P4D12(b) inhibitory effect of candidate therapeutic compositions, such as for example, 191P4D12(b) intrabodies, 191P4D12(b) antisense molecules and ribozymes.

Example 38 191P4D12(b) Monoclonal Antibody-mediated Inhibition of Tumors In Vivo

[0929] The significant expression of 191P4D12(b) in cancer tissues and surface localization, together with its restrictive expression in normal tissues makes 191P4D12(b) a good target for antibody therapy. Similarly, 191P4D12(b) is a target for T cell-based immunotherapy. Thus, the therapeutic efficacy of anti-191P4D12(b) mAbs in human cancer xenograft mouse models, including prostate, lung, bladder, kidney and other -191P4D12(b)cancers listed in table 1, is evaluated by using recombinant cell lines such as PC3-191P4D12(b), UM-UC3-191P4D12(b), CaKi—191P4D12(b), A427-191P4D12(b) and 3T3-191P4D12(b) (see, e.g., Kaighn, M. E., et al., Invest Urol, 1979. 17(1): 16-23), as well as human prostate, kidney and bladder xenograft models such as LAPC 9AD, AGS-K3 and AGS-B1 (Saffran et al PNAS 1999, 10:1073-1078).

[0930] Antibody efficacy on tumor growth and metastasis formation is studied, e.g., in a mouse orthotopic prostate, kidney, bladder, and lung cancer xenograft models. The antibodies can be unconjugated, as discussed in this Example, or can be conjugated to a therapeutic modality, as appreciated in the art. Anti-191P4D12(b) mAbs inhibit formation of tumors in prostate kidney, bladder and lung xenografts. Anti-191P4D12(b) mAbs also retard the growth of established orthotopic tumors and prolonged survival of tumor-bearing mice. These results indicate the utility of anti-191P4D12(b) mAbs in the treatment of local and advanced stages several solid tumors. (See, e.g., Saffran, D., et al., PNAS 10:1073-1078 or world wide web URL pnas.org/cgi/doi/10.1073/pnas.051624698).

[0931] Administration of the anti-191P4D12(b) mAbs led to retardation of established orthotopic tumor growth and inhibition of metastasis to distant sites, resulting in a significant prolongation in the survival of tumor-bearing mice. These studies indicate that 191P4D12(b) as an attractive target for immunotherapy and demonstrate the therapeutic potential of anti-191P4D12(b) mAbs for the treatment of local and metastatic prostate cancer. This example indicates that unconjugated 191P4D12(b) monoclonal antibodies are effective to inhibit the growth of human prostate, kidney, bladder and lung tumor xenografts grown in SCID mice; accordingly a combination of such efficacious monoclonal antibodies is also effective.

[0932] Tumor Inhibition Using Multiple Unconjugated 191P4D12(b) mAbs

[0933] Materials and Methods

[0934] 191P4D12(b) Monoclonal Antibodies:

[0935] Monoclonal antibodies are raised against 191P4D12(b) as described in the Example entitled “Generation of 191P4D12(b) Monoclonal Antibodies (mAbs).” The antibodies are characterized by ELISA, Western blot, FACS, and immunoprecipitation for their capacity to bind 191P4D12(b). Epitope mapping data for the anti-191P4D12(b) mAbs, as determined by ELISA and Western analysis, recognize epitopes on the 191P4D12(b) protein. Immunohistochemical analysis of prostate, kidney, bladder and lung cancer tissues and cells with these antibodies is performed.

[0936] The monoclonal antibodies are purified from ascites or hybridoma tissue culture supernatants by Protein-G Sepharose chromatography, dialyzed against PBS, filter sterilized, and stored at −20° C. Protein determinations are performed by a Bradford assay (Bio-Rad, Hercules, Calif.). A therapeutic monoclonal antibody or a cocktail comprising a mixture of individual monoclonal antibodies is prepared and used for the treatment of mice receiving subcutaneous or orthotopic injections of PC3, UM-UC3, CaKi and A427 tumor xenografts.

[0937] Cell Lines and Xenografts

[0938] The cancer cell lines, PC3, UM-UC3, CaKi, and A427 cell line as well as the fibroblast line NIH 3T3 (American Type Culture Collection) are maintained in RPMI (PC3) and DMEM (UM-UC3, CaKi, and A427, 3T3) respectively, supplemented with L-glutamine and 10% FBS.

[0939] PC3-191P4D12(b), UM-UC3-191P4D12(b), CaKi-191P4D12(b), A427-191P4D12(b) and 3T3-191P4D12(b) cell populations are generated by retroviral gene transfer as described in Hubert, R. S., et al., Proc Natl Acad Sci U S A, 1999. 96(25): 14523. The LAPC-9 xenograft, which expresses a wild-type androgen receptor and produces prostate-specific antigen (PSA), is passaged in 6- to 8-week-old male ICR-severe combined immunodeficient (SCID) mice (Taconic Farms) by s.c. trocar implant (Craft, N., et al., Nat Med. 1999, 5:280). Single-cell suspensions of LAPC-9 tumor cells are prepared as described in Craft, et al. Similarly, kidney (AGS-K3) and bladder (AGS-B1) patient-derived xenografts are passaged in 6- to 8-week-old male ICR-SCID mice.

[0940] Xenograft Mouse Models.

[0941] Subcutaneous (s.c.) tumors are generated by injection of 2×106 cancer cells mixed at a 1:1 dilution with Matrigel (Collaborative Research) in the right flank of male SCID mice. To test antibody efficacy on tumor formation, i.e. antibody injections are started on the same day as tumor-cell injections. As a control, mice are injected with either purified mouse IgG (ICN) or PBS; or a purified monoclonal antibody that recognizes an irrelevant antigen not expressed in human cells. In preliminary studies, no difference is found between mouse IgG or PBS on tumor growth. Tumor sizes are determined by caliper measurements, and the tumor volume is calculated as length×width×height. Mice with Subcutaneous tumors greater than 1.5 cm in diameter are sacrificed.

[0942] Orthotopic injections are performed under anesthesia by using ketamine/xylazine. For prostate orthotopic studies, an incision is made through the abdomen to expose the prostate and LAPC or PC3 tumor cells (5×105) mixed with Matrigel are injected into the prostate capsule in a 10-&mgr;l volume. To monitor tumor growth, mice are palpated and blood is collected on a weekly basis to measure PSA levels. For kidney orthotopic models, an incision is made through the abdominal muscles to expose the kidney. AGS-K3 cells mixed with Matrigel are injected under the kidney capsule. The mice are segregated into groups for the appropriate treatments, with anti-191P4D12(b) or control mAbs being injected i.p.

[0943] Anti-191P4D12(b) mAbs Inhibit Growth of 191P4D12(b)-Expressinq Xenograft-Cancer Tumors

[0944] The effect of anti-191P4D12(b) mAbs on tumor formation is tested by using cell line (e.g. PC3, UM-UC3, CaKi, A427, and 3T3) and patient-derived tumor (e.g. LAPC9, AGS-K3, AGS-B1) orthotopic models. As compared with the s.c. tumor model, the orthotopic model, which requires injection of tumor cells directly in the mouse organ, such as prostate, bladder, kidney or lung, results in a local tumor growth, development of metastasis in distal sites, deterioration of mouse health, and subsequent death (Saffran, D., et al., PNAS supra). The features make the orthotopic model more representative of human disease progression and allowed us to follow the therapeutic effect of mAbs on clinically relevant end points. For example, tumor cells are injected into the mouse prostate, and 2 days later, the mice are segregated into two groups and treated with either: a) 200-500 &mgr;g, of anti-191P4D12(b) Ab, or b) PBS three times per week for two to five weeks.

[0945] A major advantage of the orthotopic cancer models is the ability to study the development of metastases. Formation of metastasis in mice bearing established orthotopic tumors is studies by IHC analysis on lung sections using an antibody against a tumor-specific cell-surface protein such as anti-CK20 for prostate cancer (Lin S et al, Cancer Detect Prev. 2001;25:202).

[0946] Another advantage of xenograft cancer models is the ability to study neovascularization and angiogenesis. Tumor growth is partly dependent on new blood vessel development. Although the capillary system and developing blood network is of host origin, the initiation and architecture of the neovascular is regulated by the xenograft tumor (Davidoff A M et al, Clin Cancer Res. 2001;7:2870; Solesvik O et al,, Eur J Cancer Clin Oncol. 1984, 20:1295). The effect of antibody and small molecule on neovascularization is studied in accordance with procedures known in the art, such as by IHC analysis of tumor tissues and their surrounding microenvironment.

[0947] Mice bearing established orthotopic tumors are administered 1000 &mgr;g injections of either anti-191P4D12(b) mAb or PBS over a 4-week period. Mice in both groups are allowed to establish a high tumor burden, to ensure a high frequency of metastasis formation in mouse lungs. Mice then are killed and their bladders, livers, bone and lungs are analyzed for the presence of tumor cells by IHC analysis. These studies demonstrate a broad anti-tumor efficacy of anti-191P4D12(b) antibodies on initiation and progression of prostate cancer in xenograft mouse models. Anti-191P4D12(b) antibodies inhibit tumor formation of tumors as well as retarding the growth of already established tumors and prolong the survival of treated mice. Moreover, anti-191P4D12(b) mAbs demonstrate a dramatic inhibitory effect on the spread of local prostate tumor to distal sites, even in the presence of a large tumor burden. Thus, anti-191P4D12(b) mAbs are efficacious on major clinically relevant end points (tumor growth), prolongation of survival, and health.

Example 39 Therapeutic and Diagnostic use of Anti-191P4D12(b) Antibodies in Humans

[0948] Anti-191 P4D12(b) monoclonal antibodies are safely and effectively used for diagnostic, prophylactic, prognostic and/or therapeutic purposes in humans. Western blot and immunohistochemical analysis of cancer tissues and cancer xenografts with anti-191P4D12(b) mAb show strong extensive staining in carcinoma but significantly lower or undetectable levels in normal tissues. Detection of 191P4D12(b) in carcinoma and in metastatic disease demonstrates the usefulness of the mAb as a diagnostic and/or prognostic indicator. Anti-191P4D12(b) antibodies are therefore used in diagnostic applications such as immunohistochemistry of kidney biopsy specimens to detect cancer from suspect patients.

[0949] As determined by flow cytometry, anti-191P4D12(b) mAb specifically binds to carcinoma cells. Thus, anti-191P4D12(b) antibodies are used in diagnostic whole body imaging applications, such as radioimmunoscintigraphy and radioimmunotherapy, (see, e.g., Potamianos S., et. al. Anticancer Res 20(2A):925-948 (2000)) for the detection of localized and metastatic cancers that exhibit expression of 191P4D12(b). Shedding or release of an extracellular domain of 191P4D12(b) into the extracellular milieu, such as that seen for alkaline phosphodiesterase B10 (Meerson, N. R., Hepatology 27:563-568 (1998)), allows diagnostic detection of 191P4D12(b) by anti-191P4D12(b) antibodies in serum and/or urine samples from suspect patients.

[0950] Anti-191P4D12(b) antibodies that specifically bind 191P4D12(b) are used in therapeutic applications for the treatment of cancers that express 191P4D12(b). Anti-191P4D12(b) antibodies are used as an unconjugated modality and as conjugated form in which the antibodies are attached to one of various therapeutic or imaging modalities well known in the art, such as a prodrugs, enzymes or radioisotopes. In preclinical studies, unconjugated and conjugated anti-191P4D12(b) antibodies are tested for efficacy of tumor prevention and growth inhibition in the SCID mouse cancer xenograft models, e.g., kidney cancer models AGS-K3 and AGS-K6, (see, e.g., the Example entitled “191P4D12(b) Monoclonal Antibody-mediated Inhibition of Bladder and Lung Tumors In Vivo”). Either conjugated and unconjugated anti-191P4D12(b) antibodies are used as a therapeutic modality in human clinical trials either alone or in combination with other treatments as described in following Examples.

Example 40 Human Clinical Trials for the Treatment and Diagnosis of Human Carcinomas through use of Human Anti-191P4D12(b) Antibodies In vivo

[0951] Antibodies are used in accordance with the present invention which recognize an epitope on 191P4D12(b), and are used in the treatment of certain tumors such as those listed in Table I. Based upon a number of factors, including 191P4D12(b) expression levels, tumors such as those listed in Table I are presently preferred indications. In connection with each of these indications, three clinical approaches are successfully pursued.

[0952] I.) Adjunctive therapy: In adjunctive therapy, patients are treated with anti-191P4D12(b) antibodies in combination with a chemotherapeutic or antineoplastic agent and/or radiation therapy. Primary cancer targets, such as those listed in Table I, are treated under standard protocols by the addition anti-191P4D12(b) antibodies to standard first and second line therapy. Protocol designs address effectiveness as assessed by reduction in tumor mass as well as the ability to reduce usual doses of standard chemotherapy. These dosage reductions allow additional and/or prolonged therapy by reducing dose-related toxicity of the chemotherapeutic agent. Anti-191P4D12(b) antibodies are utilized in several adjunctive clinical trials in combination with the chemotherapeutic or antineoplastic agents adriamycin (advanced prostrate carcinoma), cisplatin (advanced head and neck and lung carcinomas), taxol (breast cancer), and doxorubicin (preclinical).

[0953] II.) Monotherapy: In connection with the use of the anti-191P4D12(b) antibodies in monotherapy of tumors, the antibodies are administered to patients without a chemotherapeutic or antineoplastic agent. In one embodiment, monotherapy is conducted clinically in end stage cancer patients with extensive metastatic disease. Patients show some disease stabilization. Trials demonstrate an effect in refractory patients with cancerous tumors.

[0954] III.) Imaging Agent: Through binding a radionuclide (e.g., iodine or yttrium (I131, Y90) to anti-191P4D12(b) antibodies, the radiolabeled antibodies are utilized as a diagnostic and/or imaging agent. In such a role, the labeled antibodies localize to both solid tumors, as well as, metastatic lesions of cells expressing 191P4D12(b). In connection with the use of the anti-191P4D12(b) antibodies as imaging agents, the antibodies are used as an adjunct to surgical treatment of solid tumors, as both a pre-surgical screen as well as a post-operative follow-up to determine what tumor remains and/or returns. In one embodiment, a (111In)-191P4D12(b) antibody is used as an imaging agent in a Phase I human clinical trial in patients having a carcinoma that expresses 191P4D12(b) (by analogy see, e.g., Divgi et al. J. Natl. Cancer Inst. 83:97-104 (1991)). Patients are followed with standard anterior and posterior gamma camera. The results indicate that primary lesions and metastatic lesions are identified.

[0955] Dose and Route of Administration

[0956] As appreciated by those of ordinary skill in the art, dosing considerations can be determined through comparison with the analogous products that are in the clinic. Thus, anti-191P4D12(b) antibodies can be administered with doses in the range of 5 to 400 mg/m2, with the lower doses used, e.g., in connection with safety studies. The affinity of anti-191P4D12(b) antibodies relative to the affinity of a known antibody for its target is one parameter used by those of skill in the art for determining analogous dose regimens. Further, anti-191P4D12(b) antibodies that are fully human antibodies, as compared to the chimeric antibody, have slower clearance; accordingly, dosing in patients with such fully human anti-191P4D12(b) antibodies can be lower, perhaps in the range of 50 to 300 mg/m2, and still remain efficacious. Dosing in mg/m2, as opposed to the conventional measurement of dose in mg/kg, is a measurement based on surface area and is a convenient dosing measurement that is designed to include patients of all sizes from infants to adults.

[0957] Three distinct delivery approaches are useful for delivery of anti-191P4D12(b) antibodies. Conventional intravenous delivery is one standard delivery technique for many tumors. However, in connection with tumors in the peritoneal cavity, such as tumors of the ovaries, biliary duct, other ducts, and the like, intraperitoneal administration may prove favorable for obtaining high dose of antibody at the tumor and to also minimize antibody clearance. In a similar manner, certain solid tumors possess vasculature that is appropriate for regional perfusion. Regional perfusion allows for a high dose of antibody at the site of a tumor and minimizes short term clearance of the antibody.

[0958] Clinical Development Plan (CDP)

[0959] Overview: The CDP follows and develops treatments of anti-191P4D12(b) antibodies in connection with adjunctive therapy, monotherapy, and as an imaging agent. Trials initially demonstrate safety and thereafter confirm efficacy in repeat doses. Trails are open label comparing standard chemotherapy with standard therapy plus anti-191P4D12(b) antibodies. As will be appreciated, one criteria that can be utilized in connection with enrollment of patients is 191P4D12(b) expression levels in their tumors as determined by biopsy.

[0960] As with any protein or antibody infusion-based therapeutic, safety concerns are related primarily to (i) cytokine release syndrome, i.e., hypotension, fever, shaking, chills; (ii) the development of an immunogenic response to the material (i.e., development of human antibodies by the patient to the antibody therapeutic, or HAHA response); and, (iii) toxicity to normal cells that express 191P4D12(b). Standard tests and follow-up are utilized to monitor each of these safety concerns. Anti-191P4D12(b) antibodies are found to be safe upon human administration.

Example 41 Human Clinical Trial Adjunctive Therapy with Human Anti-191P4D12(b) Antibody and Chemotherapeutic Agent

[0961] A phase I human clinical trial is initiated to assess the safety of six intravenous doses of a human anti-191P4D12(b) antibody in connection with the treatment of a solid tumor, e.g., a cancer of a tissue listed in Table I. In the study, the safety of single doses of anti-191P4D12(b) antibodies when utilized as an adjunctive therapy to an antineoplastic or chemotherapeutic agent as defined herein, such as, without limitation: cisplatin, topotecan, doxorubicin, adriamycin, taxol, or the like, is assessed. The trial design includes delivery of six single doses of an anti-191P4D12(b) antibody with dosage of antibody escalating from approximately about 25 mg/m2 to about 275 mg/m2 over the course of the treatment in accordance with the following schedule: 4 Day 0 Day 7 Day 14 Day 21 Day 28 Day 35 mAb Dose 25 75 125 175 225 275 mg/m2 mg/m2 mg/m2 mg/m2 mg/m2 mg/m2 Chemotherapy + + + + + + (standard dose)

[0962] Patients are closely followed for one-week following each administration of antibody and chemotherapy. In particular, patients are assessed for the safety concerns mentioned above: (i) cytokine release syndrome, i.e., hypotension, fever, shaking, chills; (ii) the development of an immunogenic response to the material (i.e., development of human antibodies by the patient to the human antibody therapeutic, or HAHA response); and, (iii) toxicity to normal cells that express 191P4D12(b). Standards tests and follow-up are utilized to monitor each of these safety concerns. Patients are also assessed for clinical outcome, and particularly reduction in tumor mass as evidenced by MRI or other imaging.

[0963] The anti-191P4D12(b) antibodies are demonstrated to be safe and efficacious, Phase II trials confirm the efficacy and refine optimum dosing.

Example 42 Human Clinical Trial: Monotherapy with Human Anti-191P4D12(b) Antibody

[0964] Anti-191P4D12(b) antibodies are safe in connection with the above-discussed adjunctive trial, a Phase II human clinical trial confirms the efficacy and optimum dosing for monotherapy. Such trial is accomplished, and entails the same safety and outcome analyses, to the above-described adjunctive trial with the exception being that patients do not receive chemotherapy concurrently with the receipt of doses of anti-191P4D12(b) antibodies.

Example 43 Human Clinical Trial: Diagnostic Imaging with Anti-191P4D12(b) Antibody

[0965] Once again, as the adjunctive therapy discussed above is safe within the safety criteria discussed above, a human clinical trial is conducted concerning the use of anti-191P4D12(b) antibodies as a diagnostic imaging agent. The protocol is designed in a substantially similar manner to those described in the art, such as in Divgi et al. J. Natl. Cancer Inst. 83:97-104 (1991). The antibodies are found to be both safe and efficacious when used as a diagnostic modality.

Example 44 Homology Comparison of 191P4D12(b) to Known Sequences

[0966] The human 191P4D12(b) protein exhibit a high degree of homology to a known human protein, namely Ig superfamily receptor LNIR (gi 14714574), also known as human nectin 4 (gi 16506807). Human LNIR shows 100% identity to 191P4D12(b) at the protein level. The mouse homolog of 191P4D12(b) has been identified as murine nectin 4 (gi 18874521). It shows strong homology to 191P4D12(b), exhibiting 92% identity and 95% homology to 191P4D12(b). (See, FIG. 4).

[0967] The prototype member of the 191P4D12(b) family, 191P4D12(b)v.1, is a 510 amino acids protein, with the N-terminus located extracellulary and intracellular C-terminus. Initial bioinformatics analysis using topology prediction programs suggested that 191P2D14 may contain 2 transmembranes based on hydrophobicity profile. However, the first hydrophobic domain was identified as a signal sequence, rendering 191P2D12 a type I membrane protein, with an extracellular N-terminus.

[0968] The 191P4D12(b) gene has several variants, including one SNP represented in 191P4D12(b) v.2, an N-terminal deletion variant represented in 191P4D12(b) v.6 and 191P4D12(b) v.7 which lacks 25 amino acids between amino acids 411 and 412 of 191P4D12(b) v.1.

[0969] Motif analysis revealed the presence of several protein functional motifs in the 191P4D12(b) protein (Table L). Two immunoglobulin domains have been identified at positions 45-129 and 263-317. In addition, 191P4D12(b) contains a cadherin signature which includes and RGD sequence. Immunoglobulin domains are found in numerous proteins and participate in protein-protein such including protein-ligand interactions (Weismann et al, J Mol Med 2000, 78:247). In addition, Ig-domains function in cell adhesion, allowing the interaction of leukocytes and blood-born cells with the endothelium (Wang and Springer, Immunol Rev 1998, 163:197). Cadherins are single transmembrane proteins containing immunoglobulin like domains, and are involved in cell adhesion and sorting (Shan et al, Biophys Chem 1999, 82:157). They mediate tissue-specific cell adhesion, such as adhesion of lymphocytes to the surface of epithelial cells. Finally, the closest homolog to 191P4D12(b) is Nectin4, a known adhesion molecule that regulates epithelial and endothelial junctions, strongly suggesting that 191P4D12(b) participates in cell adhesion (Reymond N et al, J Biol Chem 2001, 276:43205).

[0970] The motifs found in 191P4D12(b) can participate in tumor growth and progression by enhancing the initial stages of tumorigenesis, such as tumor take or establishment of a tumor, by allowing adhesion to basement membranes and surrounding cells, by mediating cell communication and survival.

[0971] Accordingly, when 191P4D12(b) functions as a regulator of tumor establishment, tumor formation, tumor growth, cell signaling or as a modulator of transcription involved in activating genes associated with survival, invasion, tumorigenesis or proliferation, 191P4D12(b) is used for therapeutic, diagnostic, prognostic and/or preventative purposes. In addition, when a molecule, such as a variant or SNP of 191P4D12(b) is expressed in cancerous tissues, such as those listed in Table I, they are used for therapeutic, diagnostic, prognostic and/or preventative purposes.

Example 45 Regulation of Transcription

[0972] The cell surface localization of 191P4D12(b) coupled to the presence of Ig-domains within its sequence indicate that 191P4D12(b) modulates signal transduction and the transcriptional regulation of eukaryotic genes. Regulation of gene expression is confirmed, e.g., by studying gene expression in cells expressing or lacking 191P4D12(b). For this purpose, two types of experiments are performed.

[0973] In the first set of experiments, RNA from parental and 191P4D12(b)-expressing cells are extracted and hybridized to commercially available gene arrays (Clontech) (Smid-Koopman E et al. Br J Cancer. 2000. 83:246). Resting cells as well as cells treated with FBS, androgen or growth factors are compared. Differentially expressed genes are identified in accordance with procedures known in the art. The differentially expressed genes are then mapped to biological pathways (Chen K et al. Thyroid. 2001. 11:41.).

[0974] In the second set of experiments, specific transcriptional pathway activation is evaluated using commercially available (Stratagene) luciferase reporter constructs including: NFkB-luc, SRE-luc, ELK1-luc, ARE-luc, p53-luc, and CRE-luc. These transcriptional reporters contain consensus binding sites for known transcription factors that lie downstream of well-characterized signal transduction pathways, and represent a good tool to ascertain pathway activation and screen for positive, and negative modulators of pathway activation.

[0975] Thus, 191P4D12(b) plays a role in gene regulation, and it is used as a target for diagnostic, prognostic, preventative and/or therapeutic purposes.

Example 46 Identification and Confirmation of Potential Signal Transduction Pathways

[0976] Many mammalian proteins have been reported to interact with signaling molecules and to participate in regulating signaling pathways. (J Neurochem. 2001; 76:217-223). Immunoglobulin-like molecules in particular has been associated with several tyrpsine kinases including Lyc, Blk, syk(), the MAPK signaling cascade that control cell mitogenesis and calcium flux (Vilen J et al, J Immunol 1997, 159:231; Jiang F, Jia Y, Cohen I. Blood. 2002, 99:3579). In addition, the 191P4D12(b) protein contains several phosphorylation sites (see Table VI) indicating an association with specific signaling cascades. Using immunoprecipitation and Western blotting techniques, proteins are identified that associate with 191P4D12(b) and mediate signaling events. Several pathways known to play a role in cancer biology can be regulated by 191P4D12(b), including phospholipid pathways such as PI3K, AKT, etc, adhesion and migration pathways, including FAK, Rho, Rac-1, catenin, etc, as well as mitogenic/survival cascades such as ERK, p38, etc (Cell Growth Differ. 2000,11:279; J Biol Chem. 1999, 274:801; Oncogene. 2000, 19:3003, J. Cell Biol. 1997, 138:913.).). In order to determine whether expression of 191P4D12(b) is sufficient to regulate specific signaling pathways not otherwise active in resting PC3 cells, the effect of these genes on the activation of the p38 MAPK cascade was investigated in the prostate cancer cell line PC3 (FIGS. 21A-B). Activation of the p38 kinase is dependent on its phosphorylation on tyrosine and serine residues. Phosphorylated p38 can be distinguished from the non-phosphorylated state by a Phospho-p38 mAb. This phospho-specific Ab was used to study the phosphorylation state of p38 in engineered PC3 cell lines.

[0977] PC3 cells stably expressing 191P4D12(b) neo were grown overnight in either 1% or 10% FBS. Whole cell lysates were analyzed by western blotting. PC3 cells treated with the known p38 activators, NaSal or TNF, were used as a positive control. The results show that while expression of the control neo gene has no effect on p38 phosphorylation, expression of 191P4D12(b) in PC3 cells is sufficient to induce the activation of the p38 pathway (FIG. 21A). The results were verified using western blotting with an anti-p38 Ab, which shows equal protein loading on the gels (FIG. 21B). In another set of experiments, the sufficiency of expression of 191P4D12(b) in the prostate cancer cell line PC3 to activate the mitogenic MAPK pathway, namely the ERK cascade, was examined (FIGS. 22A-B). Activation of ERK is dependent on its phosphorylation on tyrosine and serine residues. Phosphorylated ERK can be distinguished from the non-phosphorylated state by a Phospho-ERK mAb. This phospho-specific Ab was used to study the phosphorylation state of ERK in engineered PC3 cell lines. PC3 cells, expressing an activated form of Ras, were used as a positive control. The results show that while expression of the control neo gene has no effect on ERK phosphorylation, expression of 191P4D12(b) in PC3 cells is sufficient to induce an increase in ERK phosphorylation (FIG. 22A). These results were verified using anti-ERK western blotting (FIG. 22B) and confirm the activation of the ERK pathway by 191P4D12(b) and STEAP-2.

[0978] Since FBS contains several components that may contribute to receptor-mediated ERK activation, we examined the effect of 191P4D12(b) in low and optimal levels of FBS. PC3 cells expressing neo or 191P4D12(b) were grown in either 0.1% or 10% FBS overnight. The cells were analyzed by anti-Phospho-ERK western blotting. This experiment shows that 191P4D12(b) induces the phosphorylation of ERK in 0.1% FBS, and confirms that expression of 191P4D12(b) is sufficient to induce activation of the ERK signaling cascade in the absence of additional stimuli.

[0979] To confirm that 191P4D12(b) directly or indirectly activates known signal transduction pathways in cells, luciferase (luc) based transcriptional reporter assays are carried out in cells expressing individual genes. These transcriptional reporters contain consensus-binding sites for known transcription factors that lie downstream of well-characterized signal transduction pathways. The reporters and examples of these associated transcription factors, signal transduction pathways, and activation stimuli are listed below.

[0980] 1. NFkB-luc, NFkB/Rel; Ik-kinase/SAPK; growth/apoptosis/stress

[0981] 2. SRE-luc, SRF/TCF/ELK1; MAPK/SAPK; growth/differentiation

[0982] 3. AP-1-luc, FOS/JUN; MAPK/SAPK/PKC; growth/apoptosis/stress

[0983] 4. ARE-luc, androgen receptor; steroids/MAPK; growth/differentiation/apoptosis

[0984] 5. p53-luc, p53; SAPK; growth/differentiation/apoptosis

[0985] 6. CRE-luc, CREB/ATF2; PKA/p38; growth/apoptosis/stress

[0986] 7. TCF-luc, TCF/Lef; -catenin, Adhesion/invasion

[0987] Gene-mediated effects can be assayed in cells showing mRNA expression. Luciferase reporter plasmids can be introduced by lipid-mediated transfection (TFX-50, Promega). Luciferase activity, an indicator of relative transcriptional activity, is measured by incubation of cell extracts with luciferin substrate and luminescence of the reaction is monitored in a luminometer.

[0988] Signaling pathways activated by 191P4D12(b) are mapped and used for the identification and validation of therapeutic targets. When 191P4D12(b) is involved in cell signaling, it is used as target for diagnostic, prognostic, preventative and/or therapeutic purposes.

Example 47 Involvement in Tumor Progression

[0989] Based on the role of Ig-domains and cadherin motifs in cell growth and signal transduction, the 191P4D12(b) gene can contribute to the growth, invasion and transformation of cancer cells. The role of 191P4D12(b) in tumor growth is confirmed in a variety of primary and transfected cell lines including prostate cell lines, as well as NIH 3T3 cells engineered to stably express 191P4D12(b). Parental cells lacking 191P4D12(b) and cells expressing 191P4D12(b) are evaluated for cell growth using a well-documented proliferation assay (Fraser S P, Grimes J A, Djamgoz M B. Prostate. 2000;44:61, Johnson D E, Ochieng J, Evans S L. Anticancer Drugs. 1996, 7:288).

[0990] To confirm the role of 191P4D12(b) in the transformation process, its effect in colony forming assays is investigated. Parental NIH-3T3 cells lacking 191P4D12(b) are compared to NIH-3T3 cells expressing 191P4D12(b), using a soft agar assay under stringent and more permissive conditions (Song Z. et al. Cancer Res. 2000;60:6730).

[0991] To confirm the role of 191P4D12(b) in invasion and metastasis of cancer cells, a well-established assay is used, e.g., a Transwell Insert System assay (Becton Dickinson) (Cancer Res. 1999; 59:6010). Control cells, including prostate, breast and kidney cell lines lacking 191P4D12(b) are compared to cells expressing 191P4D12(b). Cells are loaded with the fluorescent dye, calcein, and plated in the top well of the Transwell insert coated with a basement membrane analog. Invasion is determined by fluorescence of cells in the lower chamber relative to the fluorescence of the entire cell population.

[0992] 191P4D12(b) can also play a role in cell cycle and apoptosis. Parental cells and cells expressing 191P4D12(b) are compared for differences in cell cycle regulation using a well-established BrdU assay (Abdel-Malek Z A. J Cell Physiol. 1988, 136:247). In short, cells are grown under both optimal (full serum) and limiting (low serum) conditions are labeled with BrdU and stained with anti-BrdU Ab and propidium iodide. Cells are analyzed for entry into the G1, S, and G2M phases of the cell cycle. Alternatively, the effect of stress on apoptosis is evaluated in control parental cells and cells expressing 191P4D12(b), including normal and tumor prostate cells. Engineered and parental cells are treated with various chemotherapeutic agents, such as etoposide, taxol, etc, and protein synthesis inhibitors, such as cycloheximide. Cells are stained with annexin V-FITC and cell death is measured by FACS analysis. The modulation of cell death by 191P4D12(b) can play a critical role in regulating tumor progression and tumor load.

[0993] When 191P4D12(b) plays a role in cell growth, transformation, invasion or apoptosis, it is used as a target for diagnostic, prognostic, preventative and/or therapeutic purposes.

Example 48 Involvement in Angiogenesis

[0994] Angiogenesis or new capillary blood vessel formation is necessary for tumor growth (Hanahan D, Folkman J. Cell. 1996, 86:353; Folkman J. Endocrinology. 1998 139:441). Based on the effect of cadherins on tumor cell adhesion and their interaction with endothelial cells, 191P4D12(b) plays a role in angiogenesis (Mareel and Leroy: Physiol Rev, 83:337; DeFouw L et al, Microvasc Res 2001, 62:263). Several assays have been developed to measure angiogenesis in vitro and in vivo, such as the tissue culture assays endothelial cell tube formation and endothelial cell proliferation. Using these assays as well as in vitro neovasculanization, the role of 191P4D12(b) in angiogenesis, enhancement or inhibition, is confirmed.

[0995] For example, endothelial cells engineered to express 191P4D12(b) are evaluated using tube formation and proliferation assays. The effect of 191P4D12(b) is also confirmed in animal models in vivo. For example, cells either expressing or lacking 191P4D12(b) are implanted subcutaneously in immunocompromised mice. Endothelial cell migration and angiogenesis are evaluated 5-15 days later using immunohistochemistry techniques. 191P4D12(b) affects angiogenesis, and it is used as a target for diagnostic, prognostic, preventative and/or therapeutic purposes.

Example 49 Involvement in Protein-Protein Interactions

[0996] Ig-domains and cadherin motifs have been shown to mediate interaction with other proteins, including cell surface protein. Using immunoprecipitation techniques as well as two yeast hybrid systems, proteins are identified that associate with 191P4D12(b). Immunoprecipitates from cells expressing 191P4D12(b) and cells lacking 191P4D12(b) are compared for specific protein-protein associations.

[0997] Studies are performed to confirm the extent of association of 191P4D12(b) with effector molecules, such as nuclear proteins, transcription factors, kinases, phosphates etc. Studies comparing 191P4D12(b) positive and 191P4D12(b) negative cells as well as studies comparing unstimulated/resting cells and cells treated with epithelial cell activators, such as cytokines, growth factors, androgen and anti-integrin Ab reveal unique interactions.

[0998] In addition, protein-protein interactions are confirmed using two yeast hybrid methodology (Curr. Opin. Chem Biol. 1999, 3:64). A vector carrying a library of proteins fused to the activation domain of a transcription factor is introduced into yeast expressing a 191P4D12(b)-DNA-binding domain fusion protein and a reporter construct. Protein-protein interaction is detected by colorimetric reporter activity. Specific association with effector molecules and transcription factors directs one of skill to the mode of action of 191P4D12(b), and thus identifies therapeutic, prognostic, preventative and/or diagnostic targets for cancer. This and similar assays are also used to identify and screen for small molecules that interact with 191P4D12(b). Thus it is found that 191P4D12(b) associates with proteins and small molecules. Accordingly, 191P4D12(b) and these proteins and small molecules are used for diagnostic, prognostic, preventative and/or therapeutic purposes.

Example 50 Involvement of 191P4D12(b) in Cell-Cell Communication

[0999] Cell-cell communication is essential in maintaining organ integrity and homeostasis, both of which become deregulated during tumor formation and progression. Based on the presence of a cadherin motif in 191P4D12(b), a motif known to be involved in cell interaction and cell-cell adhesion, 191P4D12(b) can regulate cell communication. Intercellular communications can be measured using two types of assays (J. Biol. Chem. 2000, 275:25207). In the first assay, cells loaded with a fluorescent dye are incubated in the presence of unlabeled recipient cells and the cell populations are examined under fluorescent microscopy. This qualitative assay measures the exchange of dye between adjacent cells. In the second assay system, donor and recipient cell populations are treated as above and quantitative measurements of the recipient cell population are performed by FACS analysis. Using these two assay systems, cells expressing 191P4D12(b) are compared to controls that do not express 191P4D12(b), and it is found that 191P4D12(b) enhances cell communications. FIG. 19 and FIG. 20 demonstrate that 191P4D12(b) mediates the transfer of the small molecule calcein between adjacent cells, and thereby regulates cell-cell communication in prostate cancer cells. In this experiment, recipient PC3 cells were labeled with dextran-Texas Red and donor PC3 cells were labeled with calcein AM (green). The donor (green) and recipient (red) cells were co-cultured at 37° C. and analyzed by microscopy for the co-localization of Texas red and calcein. The results demonstrated that while PC3 control cells (no detectable 191P4D12(b) protein expression) exhibit little calcein transfer, the expression of 191P4D12(b) allows the transfer of small molecules between cells (FIG. 19), whereby the initially red recipient cells take on a brownish color, and co-localize the red and green molecules. Small molecules and/or antibodies that modulate cell-cell communication mediated by 191P4D12(b) are used as therapeutics for cancers that express 191P4D12(b). When 191P4D12(b) functions in cell-cell communication and small molecule transport, it is used as a target or marker for diagnostic, prognostic, preventative and/or therapeutic purposes.

Example 51 Modulation of 191P4D12(b) Function

[1000] Knock Down of 191P4D12(b) Expression

[1001] Several techniques can be used to knock down or knock out 191P4D12(b) expression in vitro and in-vivo, including RNA interference (RNAi) and other anti-sense technologies. RNAi makes use of sequence specific double stranded RNA to prevent gene expression. Small interfering RNA (siRNA) are transfected into mammalian cells and thereby mediate sequence specific mRNA degradation. (Elbashir, et al, Nature, 2001; vol. 411: 494-498). Using this approach, 191P4D12(b)-specific RNAi is introduced in 191P4D12(b)-expressing cells by transfection. The effect of knocking down the expression of 191P4D12(b) protein is evaluated using the biological assays mentioned in examples 44 to 50 above.

[1002] Reduction of 191P4D12(b) Protein expression is detected 24-48 hours after transfection by immunostaining and flow cytometry. The introduction of 191P4D12(b) specific RNAi reduced the expression of 191P4D12(b) positive cells and reduce the biological effect of 191P4D12(b) on tumor growth and progression.

[1003] Accordingly, the RNA oligonucleotide sequences are used in therapeutic and prophylactic applications. Moreover, the RNA oligonucleotide sequences are used to assess how modulating the expression of a 191P4D12(b) gene affects function of cancer cells and/or tissues.

[1004] Inhibition Using Small Molecule and Antibodies

[1005] Using control cell lines and cell lines expressing 191P4D12(b), inhibitors of 191P4D12(b) function are identified. For example, PC3 and PC3-191P4D12(b) cells can be incubated in the presence and absence of mAb or small molecule inhibitors. The effect of these mAb or small molecule inhibitors are investigated using the cell communication, proliferation and signaling assays described above.

[1006] Signal transduction and biological output mediated by cadherins can be modulated through various mechanisms, including inhibition of receptor binding, prevention of protein interactions, or affecting the expression of co-receptors and binding partners (Kamei et al, Oncogene 1999, 18:6776). Using control cell lines and cell lines expressing 191P4D12(b), modulators (inhibitors or enhancers) of 191P4D12(b) function are identified. For example, PC3 and PC3-191P4D12(b) cells are incubated in the presence and absence of mAb or small molecule modulators. When mAb and small molecules modulate, e.g., inhibit, the transport and tumorigenic function of 191P4D12(b), they are used for preventative, prognostic, diagnostic and/or therapeutic purposes.

[1007] Throughout this application, various website data content, publications, patent applications and patents are referenced. (Websites are referenced by their Uniform Resource Locator, or URL, addresses on the World Wide Web.) The disclosures of each of these references are hereby incorporated by reference herein in their entireties.

[1008] The present invention is not to be limited in scope by the embodiments disclosed herein, which are intended as single illustrations of individual aspects of the invention, and any that are functionally equivalent are within the scope of the invention. Various modifications to the models and methods of the invention, in addition to those described herein, will become apparent to those skilled in the art from the foregoing description and teachings, and are similarly intended to fall within the scope of the invention. Such modifications or other embodiments can be practiced without departing from the true scope and spirit of the invention.

TABLES

[1009] 5 TABLE I Tissues that Express 191P4D12(b): a Malignant Tissues Prostate Bladder Kidney Colon Lung Pancreas Ovary Breast Uterus Cervix

[1010] 6 TABLE II Amino Acid Abbreviations SINGLE THREE FULL LETTER LETTER NAME F Phe phenylalanine L Leu leucine S Ser serine Y Tyr tyrosine C Cys cysteine W Trp tryptophan P Pro proline H His histidine Q Gln glutamine R Arg arginine I Ile isoleucine M Met methionine T Thr threonine N Asn asparagine K Lys lysine V Val valine A Ala alanine D Asp aspartic acid E Glu glutamic acid G Gly glycine

[1011] 7 TABLE III Amino Acid Substitution Matrix A C D E F G H I K L M N P Q R S T V W Y . 4 0 −2 −1 −2 0 −2 −1 −1 −1 −1 −2 −1 −1 −1 1 0 0 −3 −2 A 9 −3 −4 −2 −3 −3 −1 −3 −1 −1 −3 −3 −3 −3 −1 −1 −1 −2 −2 C 6 2 −3 −1 −1 −3 −1 −4 −3 1 −1 0 −2 0 −1 −3 −4 −3 D 5 −3 −2 0 −3 1 −3 −2 0 −1 2 0 0 −1 −2 −3 −2 E 6 −3 −1 0 −3 0 0 −3 −4 −3 −3 −2 −2 −1 1 3 F 6 −2 −4 −2 −4 −3 0 −2 −2 −2 0 −2 −3 −2 −3 G 8 −3 −1 −3 −2 1 −2 0 0 −1 −2 −3 −2 2 H 4 −3 2 1 −3 −3 −3 −3 −2 −1 3 −3 −1 I 5 −2 −1 0 −1 1 2 0 −1 −2 −3 −2 K 4 2 −3 −3 −2 −2 −2 −1 1 −2 −1 L 5 −2 −2 0 −1 −1 −1 1 −1 −1 M 6 −2 0 0 1 0 −3 −4 −2 N 7 −1 −2 −1 −1 −2 −4 −3 P 5 1 0 −1 −2 −2 −1 Q 5 −1 −1 −3 −3 −2 R 4 1 −2 −3 −2 S 5 0 −2 −2 T 4 −3 −1 V 11 2 W 7 Y Adapted from the GCG Software 9.0 BLOSUM62 amino acid substitution matrix (block substitution matrix). The higher the value, the more likely a substitution is found in related, natural proteins. (See world wide web URL ikp.unibe.ch/manual/blosum62.html)

Table IV HLA Class I/II Motifs/Supermotifs

[1012] 8 TABLE IV (A) HLA Class I Supermotifs/Motifs POSITION POSITION POSITION C Terminus 2 (Primary 3 (Primary (Primary Anchor) Anchor) Anchor) SUPERMOTIF A1 TILVMS FWY A2 LIVMATQ IVMATL A3 VSMATLI RK A24 YFWIVLMT FIYWLM B7 P VILFMWYA B27 RHK FYLWMIVA B44 ED FWYLIMVA B58 ATS FWYLIVMA B62 QLIVMP FWYMIVLA MOTIFS A1 TSM Y A1 DEAS Y A2 1 LMVQIAT VLIMAT A3 LMVISATFCGD KYRHFA A11 VTMLISAGNCDF KRYH A24 YFWM FLIW A*3101 MVTALIS RK A*3301 MVALFIST RK A*6801 AVTMSLI RK B*0702 P LMFWYAIV B*3501 P LMFWYIVA B51 P LIVFWYAM B*5301 P IMFWYALV B*5401 P ATIVLMFWY Bolded residues are preferred, italicized residues are less preferred A peptide is considered motif-bearing if it has primary anchors at each primary anchor position for a motif or supermotif as specified in the above table

[1013] 9 TABLE IV (B) HLA Class II Supermotif 1 6 9 W, F, Y, V, I, L A, V, I, L, P, C, S, T A, V, I, L, C, S, T, M, Y

[1014] 10 TABLE IV (C) HLA Class II Motifs MOTIFS 1° anchor 1 2 3 4 5 1° anchor 6 7 8 9 DR4 preferred FMYLIVW M T I VSTCPALIM MH MH deleterious W R WDE DR1 preferred MFLIVWY PAMQ VMATSPLIC M AVM deleterious C CH FD CWD GDE D DR7 preferred MFLIVWY M W A IVMSACTPL M IV deleterious C G GRD N G DR3 MOTIFS 1° anchor 1 2 3 1° anchor 4 5 1° anchor 6 Motif a preferred LIVMFY D Motif b preferred LIVMFAY DNQEST KRH DR Supermotif MFLIVWY VMSTACPLI Italicized residues indicate less preferred or “tolerated” residues

[1015] 11 TABLE IV (D) HLA Class I Supermotifs POSITION: SUPER- MOTIFS 1 2 3 4 5 6 7 8 C-terminus A1 1° Anchor 1° Anchor TILVMS FWY A2 1° Anchor 1° Anchor {overscore (LIVMATQ)} LIVMAT A3 Preferred 1° Anchor YFW YFW YFW P 1° Anchor {overscore (VSMATLI)} (4/5) (3/5) (4/5) (4/5) RK deleterious DE (3/5); DE P (5/5) (4/5) A24 1° Anchor 1° Anchor {overscore (YFWIVLMT)} FIYWLM B7 Preferred FWY (5/5) 1° Anchor FWY FWY 1° Anchor LIVM (3/5) P (4/5) (3/5) {overscore (VILFMWYA)} deleterious DE (3/5); DE G QN DE P(5/5); (3/5) (4/5) (4/5) (4/5) G(4/5); A(3/5); QN(3/5) B27 1° Anchor 1° Anchor RHK {overscore (FYLWMIVA)} B44 1° Anchor 1° Anchor ED {overscore (FWYLIMVA)} B58 1° Anchor 1° Anchor ATS {overscore (FWYLIVMA)} B62 1° Anchor 1° Anchor QLIVMP {overscore (FWYMIVLA)} Italicized residues indicate less preferred or “tolerated” residues

[1016] 12 TABLE IV (E) HLA Class I Motifs POSITION 1 2 3 4 5 6 A1 preferred GFYW 1° Anchor DEA YFW P 9-mer STM deleterious DE RHKLIVMP A G A A1 preferred GRHK ASTCLIVM 1° Anchor GSTC ASTC 9-mer DEAS deleterious A RHKDEPYFW DE PQN RHK A1 preferred YFW 1° Anchor DEAQN A YFWQN 10-mer STM deleterious GP RHKGLIVM DE RHK QNA A1 preferred YFW STCLIVM 1° Anchor A YFW 10-mer DEAS deleterious RHK RHKDEPYFW P G A2.1 preferred YFW 1° Anchor YFW STC YFW 9-mer {overscore (LMIVQAT)} deleterious DEP DERKH RKH POSITION 9 or 7 8 C-terminus C-terminus A1 preferred DEQN YFW 1° Anchor 9-mer Y deleterious A1 preferred LIVM DE 1° Anchor 9-mer Y deleterious PG GP A1 preferred PASTC GDE P 1° Anchor 10-mer Y deleterious RHKYFW RHK A A1 preferred PG G YFW 1° Anchor 10-mer Y deleterious PRHK QN A2.1 preferred A P 1° Anchor 9-mer VLIMAT deleterious DERKH POSITION: 1 2 3 4 5 6 A2.1 preferred AYFW 1° Anchor LVIM G G 10-mer {overscore (LMIVQAT)} deleterious DEP DE RKHA P A3 preferred RHK 1° Anchor YFW PRHKYF A YFW {overscore (LMVISATFCGD)} W deleterious DEP DE A11 preferred A 1° Anchor YFW YFW A YFW {overscore (VTLMISAGNCDF)} deleterious DEP A24 preferred YFWRHK 1° Anchor STC 9-mer YFWM deleterious DEG DE G QNP DERHK A24 Preferred 1° Anchor P YFWP 10-mer YFWM Deleterious GDE QN RHK DE A3101 Preferred RHK 1° Anchor YFW P YFW {overscore (MVTALIS)} Deleterious DEP DE ADE DE A3301 Preferred 1° Anchor YFW {overscore (MVALFIST)} Deleterious GP DE A6801 Preferred YFWSTC 1° Anchor YFWLIV {overscore (AVTMSLI)} M deleterious GP DEG RHK B0702 Preferred RHKFWY 1° Anchor RHK RHK RHK P deleterious DEQNP DEP DE DE GDE B3501 Preferred FWYLIVM 1° Anchor FWY P POSITION: C- 7 8 9 Terminus A2.1 preferred FYWL 1° Anchor 10-mer VIM VLIMAT deleterious RKH DERKH RKH A3 preferred P 1° Anchor {overscore (KYRHFA)} deleterious A11 preferred YFW P 1° Anchor KRYH deleterious A G A24 preferred YFW YFW 1° Anchor 9-mer FLIW deleterious G AQN A24 Preferred P 1° Anchor 10-mer FLIW Deleterious A QN DEA A3101 Preferred YFW AP 1° Anchor RK Deleterious DE DE A3301 Preferred AYFW 1° Anchor RK Deleterious A6801 Preferred YFW P 1° Anchor RK deleterious A B0702 Preferred RHK PA 1° Anchor {overscore (LMFWYAIV)} deleterious QN DE B3501 Preferred FWY 1° Anchor {overscore (LMFWYIVA)} POSITION 1 2 3 4 5 6 A1 preferred GFYW 1° Anchor DEA YFW P 9-mer STM deleterious DE RHKLIVMP A G A A1 preferred GRHK ASTCLIVM 1° Anchor GSTC ASTC 9-mer DEAS deleterious A RHKDEPYFW DE PQN RHK deleterious AGP G G B51 Preferred LIVMFWY 1° Anchor FWY STC FWY P deleterious AGPDER DE G HKSTC B5301 preferred LIVMFWY 1° Anchor FWY STC FWY P deleterious AGPQN G B5401 preferred FWY 1° Anchor FWYLIVM LIVM P deleterious GPQNDE GDESTC RHKDE DE POSITION 9 or 7 8 C-terminus C-terminus A1 preferred DEQN YFW 1° Anchor 9-mer Y deleterious A1 preferred LIVM DE 1° Anchor 9-mer Y deleterious PG GP deleterious B51 Preferred G FWY 1° Anchor {overscore (LIVFWYAM)} deleterious DEQN GDE B5301 preferred LIVMFWY FWY 1° Anchor {overscore (IMFWYALV)} deleterious RHKQN DE B5401 preferred ALIVM FWYA 1° Anchor P {overscore (ATIVLMFWY)} deleterious QNDGE DE

[1017] 13 TABLE IV (F) Summary of HLA-supertypes Overall phenotypic frequencies of HLA-supertypes in different ethnic populations Specificity Phenotypic frequency Supertype Position 2 C-Terminus Caucasian N.A. Black Japanese Chinese Hispanic Average B7 P AILMVFWY 43.2 55.1 57.1 43.0 49.3 49.5 A3 AILMVST RK 37.5 42.1 45.8 52.7 43.1 44.2 A2 AILMVT AILMVT 45.8 39.0 42.4 45.9 43.0 42.2 A24 YF (WIVLMT) FI (YWLM) 23.9 38.9 58.6 40.1 38.3 40.0 B44 E (D) FWYLIMVA 43.0 21.2 42.9 39.1 39.0 37.0 A1 TI (LVMS) FWY 47.1 16.1 21.8 14.7 26.3 25.2 B27 RHK FYL (WMI) 28.4 26.1 13.3 13.9 35.3 23.4 B62 QL (IVMP) FWY (MIV) 12.6 4.8 36.5 25.4 11.1 18.1 B58 ATS FWY (LIV) 10.0 25.1 1.6 9.0 5.9 10.3

[1018] 14 TABLE IV (G) Calculated population coverage afforded by different HLA-supertype combinations Phenotypic frequency HLA-supertypes Caucasian N.A Blacks Japanese Chinese Hispanic Average A2, A3 and B7 83.0 86.1 87.5 88.4 86.3 86.2 A2, A3, B7, A24, 99.5 98.1 100.0 99.5 99.4 99.3 B44 and A1 99.9 99.6 100.0 99.8 99.9 99.8 A2, A3, B7, A24, B44, A1, B27, B62, and B58 Motifs indicate the residues defining supertype specificites. The motifs incorporate residues determined on the basis of published data to be recognized by multiple alleles within the supertype. Residues within brackets are additional residues also predicted to be tolerated by multiple alleles within the supertype.

[1019] 15 TABLE V Frequently Occurring Motifs avrg. % Name identity Description Potential Function zf-C2H2 34% Zinc finger, C2H2 type Nucleic acid-binding protein functions as transcription factor, nuclear location probable cytochrome_b_N 68% Cytochrome b(N- membrane bound oxidase, generate terminal)/b6/petB superoxide lg 19% Immunoglobulin domain domains are one hundred amino acids long and include a conserved intradomain disulfide bond. WD40 18% WD domain, G-beta repeat tandem repeats of about 40 residues, each containing a Trp-Asp motif. Function in signal transduction and protein interaction PDZ 23% PDZ domain may function in targeting signaling molecules to sub-membranous sites LRR 28% Leucine Rich Repeat short sequence motifs involved in protein-protein interactions Pkinase 23% Protein kinase domain conserved catalytic core common to both serine/threonine and tyrosine protein kinases containing an ATP bindmg site and a catalytic site PH 16% PH domain pleckstrin homology involved in intracellular signaling or as constituents of the cytoskeleton EGF 34% EGF-like domain 30-40 amino acid long found in the extracellular domain of membrane- bound proteins or in secreted proteins Rvt 49% Reverse transcriptase (RNA-dependent DNA polymerase) Ank 25% Ank repeat Cytoplasmic protein, associates integral membrane proteins to the cytoskeleton Oxidored_q1 32% NADH- membrane associated Involved in Ubiquinone/plastoquinone proton translation across the (complex I), various chains membrane Efhand 24% EF hand calcium-binding domain, consists of a12 residue loop flanked on both sides by a 12 residue alpha-helical domain Rvp 79% Retroviral aspartyl Aspartyl or acid proteases, centered on protease a catalytic aspartyl residue Collagen 42% Collagen triple helix repeat extracellular structural proteins involved (20 copies) in formation of connective tissue The sequence consists of the G-X-Y and the polypeptide chains forms a triple helix Fn3 20% Fibronectin type III domain Located in the extracellular ligand- binding region of receptors and is about 200 amino acid residues long with two pairs of cysteines involved in disulfide bonds 7tm_1 19% 7 transmembrane receptor seven hydrophobic transmembrane (rhodopsin family) regions, with the N-terminus located extracellularly while the C-terminus is cytoplasmic Signal through G proteins

Table VI Motifs and Post-Translational Modifications of 191P4D12(b)

[1020] 16 TABLE VI Post-translational modifications of 191P4D12(b) N-glycosylation site 1 281-284 NWTR (SEQ ID NO: 61) 430-433 NSSC (SEQ ID NO: 62) 489-492 NGTL (SEQ ID NO: 63) Tyrosine sulfation site 118-132 VQADEGEYECRVSTF (SEQ ID NO: 64) Protein kinase C phosphorylation site 26-28 TGR 192-194 SSR 195-197 SFK 249-251 SVR 322-324 SSR 339-341 SGK 383-385 TQK 397-399 SIR 426-428 SLK 450-452 TVR 465-467 SGR 491-493 TLR Casein kinase II phosphorylation site 283-286 TRLD (SEQ ID NO: 65) 322-325 SSRD (SEQ ID NO: 66) 410-413 SQPE (SEQ ID NO: 67) 426-429 SLKD (SEQ ID NO: 68) 450-453 TVRE (SEQ ID NO: 69) 456-459 TQTE (SEQ ID NO: 70) N-myristoylation site 135-140 GSFQAR (SEQ ID NO: 71) 162-167 GQGLTL (SEQ ID NO: 72) 164-169 GLTLAA (SEQ ID NO: 73) 189-194 GTTSSR (SEQ ID NO: 74) 218-223 GQPLTC (SEQ ID NO: 75) 311-316 GIYVCH (SEQ ID NO: 76) 354-359 GVIAAL (SEQ ID NO: 77) 464-469 GSGRAE (SEQ ID NO: 78) 477-482 GIKQAM (SEQ ID NO: 79) 490-495 GTLRAK (SEQ ID NO: 80) 500-505 GIYING (SEQ ID NO: 81) RGD Cell attachment sequence 55-57 RGD

[1021] 17 TABLE VII Search Peptides 191P4D12(b) v.1 aa1-510  9-mers, 10-mers and 15-mers MPLSLGAEMW GPEAWLLLLL LLASFTGRCP AGELETSDVV TVVLGQDAKL PCFYRGDSGE (SEQ ID NO: 82) QVGQVAWARV DAGEGAQELA LLHSKYGLHV SPAYEGRVEQ PPPPRN PLDG SVLLRNAVQA DEGEYECRVS TFPAGSFQAR LRLRVLVPPL PSLNPGPALE EGQGLTLAAS CTAEGSPAPS VTWDTEVKGT TSSRSFKHSR SMVTSEFHL VPSRSMNGQP LTCWSHPGL LQDQRITHIL HVSFLAEASV RGLEDQNLWH IGREGAMLKC LSEGQPPPSY NWTRLDGPLP SGVRVDGDTL GFPPLTTEHS GIYVCHVSNE FSSRDSQVTV DVLDPQEDSG KQVDLVSASV VVVGVIAALL FCLLWVVVL MSRYHRRKAQ QMTQKYEEEL TLTRENSIRR LHSHHTDPRS QPEESVGLRA EGHPDSLKDN SSCSVMSEEP EGRSYSTLTT VREIETQTEL LSPGSGRAEE EEDQDEGIKQ AMNHFVQENG TLRAKPTGNG IYINGRGHLV v.2 aa1-510  9-mers 45-61 GQDAKLPCLYRGDSGEQ (SEQ ID NO: 83) 10-mers 44-62 LGQDAKLPCLYRGDSGEQV (SEQ ID NO: 84) 15-mers 39-67 VVTWLGQDAKLPCLYRGDSGEQVGQVAW (SEQ ID NO: 85) v.7 ORF: 264.1721 Frame + 3  9-mers 403-418 SHHTDPRSQSEEPEGR (SEQ ID NO: 86) 10-mers 402-419 HSHHTDPRSQSEEPEGRS (SEQ ID NO: 87) 15-mers 397-424 SIRRLHSHHTDPRSQSEEPEGRSYSTLT (SEQ ID NO: 88) V.9: AA 1-137;  9-mers, 10-mers, 15-mers MRRELLAGIL LRITFNFFLF FFLPFPLVVF FIYFYFYFEL EMESHYVAQA GLELLGSSNP (SEQ ID NO: 89) PASASLVAGT LSVHHCACFE SFTKRKKKLK KAFRFIQCLL LGLLKVRPLQ HQGVNSCDCE RGYFQGIFMQ AAPWEGT v.10 SNP variant  9-mers 27-43 GRCPAGELGTSDVVTVV (SEQ ID NO: 90) 10-mers 26-44 TGRCPAGELGTSDVVTVVL (SEQ ID NO: 91) 15-mers 21-49 LLASFTGRCPAGELGTSDVVTWLGQDAK (SEQ ID NO: 92) v.11 SNP variant  9-mers 138-154 QARLRLRVMVPPLPSLN (SEQ ID NO: 93) 10-mers 137-155 FQARLRLRVMVPPLPSLNP (SEQ ID NO: 94) 15-mers 132-160 FPAGSFQARLRLRVMVPPLPSLNPGPALE (SEQ ID NO: 95) v.12 SNP variant  9-mers 435-451 VMSEEPEGCSYSTLTTV (SEQ ID NO: 96) 10-mers 434-452 SVMSEEPEGGSYSTLTTVRE (SEQ ID NO: 97) 15-mers 429-457 DNSSCSVMSEEPEGCSYSTLTTVREIETQ (SEQ ID NO: 98) v.13 insertion of one AA at 333-4  9-mers 426-442 SQVTVDVLADPQEDSGK (SEQ ID NO: 99) 10-mers 425-443 DSQVTVDVLADPQEDSGKQ (SEQ ID NO: 100) 15-mers 420-448 EFSSRDSQVTVDVLADPQEDSGKQVDLVS (SEQ ID NO: 101) 191 P4012(b) v.14: AA56-72;  9-mers GSSNPPASASLVAGTLS (SEQ ID NO: 102) 191P4012(b)v.14: AA55-73; 10-mers LGSSNPPASASLVAGTLSV (SEQ ID NO: 103) 191P4D12(b) v.14: AA50.78; 15-mers AGLELLGSSNPPASASLVAGTLSVHHCAC (SEQ ID NO: 104)

[1022] 18 TABLE VIII Start Subsequence Score V1-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 294 RVDGDTLGF 25.000 437 SEEPEGRSY 22.500 97 RVEQPPPPR 18.000 306 TTEHSGIYV 11.250 332 VLDPQEDSG 5.000 252 GLEDQNLWH 4.500 457 QTELLSPGS 4.500 271 LSEGQPPPS 2.700 205 TSEFHLVPS 2.700 107 PLDGSVLLR 2.500 386 YEEELTLTR 2.250 411 QPEESVGLR 2.250 184 DTEVKGTTS 2.250 172 TAEGSPAPS 1.800 6 GAEMWGPEA 1.800 33 ELETSDVVT 1.800 36 TSDVVTVVL 1.500 45 GQDAKLPCF 1.500 436 MSEEPEGRS 1.350 305 LTTEHSGIY 1.250 405 HTDPRSQPE 1.250 11 GPEAWLLLL 1.125 119 QADEGEYEC 1.000 89 HVSPAYEGR 1.000 284 RLDGPLPSG 1.000 342 QVDLVSASV 1.000 158 ALEEGQGLT 0.900 245 LAEASVRGL 0.900 419 RAEGHPDSL 0.900 453 EIETQTELL 0.900 486 VQENGTLRA 0.675 76 AQELALLHS 0.675 117 AVQADEGEY 0.500 471 EEDQDEGIK 0.500 236 ITHILHVSF 0.500 365 VVVVVLMSR 0.500 366 VVVVLMSRY 0.500 189 GTTSSRSFK 0.500 78 ELALLHSKY 0.500 69 RVDAGEGAQ 0.500 378 KAQQMTQKY 0.500 124 EYECRVSTF 0.450 120 ADEGEYECR 0.450 439 EPEGRSYST 0.450 130 STFPAGSFQ 0.250 86 YGLHVSPAY 0.250 318 SNEFSSRDS 0.225 72 AGEGAQELA 0.225 122 EGEYECRVS 0.225 159 LEEGQGLTL 0.225 262 GREGAMLKC 0.225 58 SGEQVGQVA 0.225 31 AGELETSDV 0.225 145 VLVPPLPSL 0.200 180 SVTWDTEVK 0.200 368 WLMSRYHR 0.200 41 TVVLGQDAK 0.200 17 LLLLLLASF 0.200 409 RSQPEESVG 0.150 129 VSTFPAGSF 0.150 200 RSAAVTSEF 0.150 423 HPDSLKDNS 0.125 392 LTRENSIRR 0.125 448 LTTVREIET 0.125 55 RGDSGEQVG 0.125 190 TTSSRSFKH 0.125 353 VGVIAALLF 0.125 146 LVPPLPSLN 0.100 369 VLMSRYHRR 0.100 313 YVCHVSNEF 0.100 61 QVGQVAWAR 0.100 459 ELLSPGSGR 0.100 329 TVDVLDPQE 0.100 20 LLLASFTGR 0.100 316 HVSNEFSSR 0.100 209 HLVPSRSMN 0.100 460 LLSPGSGRA 0.100 485 FVQENGTLR 0.100 467 RAEEEEDQD 0.090 3 LSLGAEMWG 0.075 225 VSHPGLLQD 0.075 255 DQNLWHIGR 0.075 135 GSFQARLRL 0.075 231 LQDQRITHI 0.075 473 DQDEGIKQA 0.075 296 DGDTLGFPP 0.062 364 LVVVVVLMS 0.050 354 GVIAALLFC 0.050 224 VVSHPGLLQ 0.050 202 AAVTSEFHL 0.050 210 LVPSRSMNG 0.050 19 LLLLASFTG 0.050 355 VIAALLFCL 0.050 299 TLGFPPLTT 0.050 15 WLLLLLLLA 0.050 298 DTLGFPPLT 0.050 287 GPLPSGVRV 0.050 28 RCPAGELET 0.050 435 VMSEEPEGR 0.050 357 AALLFCLLV 0.050 V2-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 GQDAKLPCL 0.150 3 DAKLPCLYR 0.050 4 AKLPCLYRG 0.010 2 QDAKLPCLY 0.003 6 LPCLYRGDS 0.003 7 PCLYRGDSG 0.001 5 KLPCLYRGD 0.001 8 CLYRGDSGE 0.000 9 LYRGDSGEQ 0.000 V7-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 HTDPRSQSE 1.250 7 RSQSEEPEG 0.030 8 SQSEEPEGR 0.015 1 SHHTDPRSQ 0.001 2 HHTDPRSQS 0.001 5 DPRSQSEEP 0.000 4 TDPRSQSEE 0.000 6 PRSQSEEPE 0.000 V9-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 116 SCDCERGYF 5.000 13 ITFNFFLFF 1.250 76 CACFESFTK 1.000 27 LVVFFIYFY 1.000 97 QCLLLGLLK 1.000 39 FLEMESHYV 0.900 41 EMESHYVAQ 0.900 78 CFESFTKRK 0.900 51 GLELLGSSN 0.900 115 NSCDCERGY 0.750 25 FPLVVFFIY 0.625 23 LPFPLVVFF 0.500 4 ELLAGILLR 0.500 12 RITFNFFLF 0.500 28 VVFFIYFYF 0.500 118 DCERGYFQG 0.450 71 LSVHHCACF 0.300 80 ESFTKRKKK 0.300 22 FLPFPLVVF 0.200 31 FIYFYFYFF 0.200 57 SSNPPASAS 0.150 7 AGILLRITF 0.125 99 LLLGLLKVR 0.100 113 GVNSCDCER 0.100 77 ACFESFTKR 0.100 95 FIQCLLLGL 0.050 9 ILLRITFNF 0.050 98 CLLLGLLKV 0.050 5 LLAGILLRI 0.050 26 PLVVFFIYF 0.050 46 YVAQAGLEL 0.050 49 QAGLELLGS 0.050 29 VFFIYFYFY 0.050 58 SNPPASASL 0.050 65 SLVAGTLSV 0.050 2 RRELLAGIL 0.045 56 GSSNPPASA 0.030 62 ASASLVAGT 0.030 14 TFNFFLFFF 0.025 69 GTLSVHHCA 0.025 30 FFIYFYFYF 0.025 21 FFLPFPLVV 0.025 17 FFLFFFLPF 0.025 38 FFLEMESHY 0.025 67 VAGTLSVHH 0.020 126 GIFMQAAPW 0.020 54 LLGSSNPPA 0.020 43 ESHYVAQAG 0.015 64 ASLVAGTLS 0.015 15 FNFFLFFFL 0.013 121 RGYFQGIFM 0.013 79 FESFTKRKK 0.010 70 TLSVHHCAC 0.010 105 KVRPLQHQG 0.010 66 LVAGTLSVH 0.010 63 SASLVAGTL 0.010 6 LAGILLRIT 0.010 47 VAQAGLELL 0.010 10 LLRITFNFF 0.010 75 HCACFESFT 0.010 8 GILLRITFN 0.010 48 AQAGLELLG 0.007 103 LLKVRPLQH 0.005 128 FMQAAPWEG 0.005 55 LGSSNPPAS 0.005 120 ERGYFQGIF 0.005 74 HHCACFESF 0.005 82 FTKRKKKLK 0.005 87 KKLKKAFRF 0.003 90 KKAFRFIQC 0.003 11 LRITFNFFL 0.003 59 NPPASASLV 0.003 101 LGLLKVRPL 0.003 123 YFQGIFMQA 0.003 36 FYFFLEMES 0.003 34 FYFYFFLEM 0.003 19 LFFFLPFPL 0.003 68 AGTLSVHHC 0.003 93 FRFIQCLLL 0.003 114 VNSCDCERG 0.003 122 GYFQGIFMQ 0.003 50 AGLELLGSS 0.003 32 IYFYFYFFL 0.003 3 RELLAGILL 0.003 107 RPLQHQGVN 0.003 73 VHHCACFES 0.003 94 RFIQCLLLG 0.003 18 FLFFFLPFP 0.002 102 GLLKVRPLQ 0.002 100 LLGLLKVRP 0.002 108 PLQHQGVNS 0.002 61 PASASLVAG 0.002 96 IQCLLLGLL 0.002 111 HQGVNSCDC 0.002 109 LQHQGVNSC 0.002 124 FQGIFMQAA 0.002 129 MQAAPWEGT 0.002 60 PPASASLVA 0.001 86 KKKLKKAFR 0.001 20 FFFLPFPLV 0.001 V10 HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified the length of peptide is 9 ammo acids, and the end position for each peptide is the start position plus eight 5 AGELGTSDV 0.225 2 RCPAGELGT 0.050 9 GTSDVVTVV 0.025 7 ELGTSDVVT 0.020 1 GRCPAGELG 0.005 8 LGTSDVVTV 0.005 3 CPAGELGTS 0.003 6 GELGTSDVV 0.001 4 PAGELGTSD 0.000 V11-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 MVPPLPSLN 0.100 8 VMVPPLPSL 0.100 7 RVMVPPLPS 0.050 5 RLRVMVPPL 0.002 1 QARLRLRVM 0.001 3 RLRLRVMVP 0.001 6 LRVMVPPLP 0.000 2 ARLRLRVMV 0.000 4 LRLRVMVPP 0.000 V12-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 SEEPEGCSY 22.500 2 MSEEPEGCS 1.350 5 EPEGCSYST 0.450 8 GCSYSTLTT 0.050 9 CSYSTLTTV 0.015 1 VMSEEPEGC 0.005 7 EGCSYSTLT 0.003 4 EEPEGCSYS 0.001 6 PEGCSYSTL 0.000 V13-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 LADPQEDSG 5.000 4 TVDVLADPQ 0.500 9 ADPQEDSGK 0.010 7 VLADPQEDS 0.010 3 VTVDVLADP 0.005 2 QVTVDVLAD 0.005 1 SQVTVDVLA 0.003 6 DVLADPQED 0.001 5 VDVLADPQE 0.000 V14-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 SSNPPASAS 0.150 3 SNPPASASL 0.050 1 GSSNPPASA 0.030 7 ASASLVAGT 0.030 9 ASLVAGTLS 0.015 8 SASLVAGTL 0.010 4 NPPASASLV 0.003 6 PASASLVAG 0.002 5 PPASASLVA 0.001

[1023] 19 TABLE IX Start Subsequence Score V1-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 271 LSEGQPPPSY 135.000 332 VLDPQEDSGK 100.000 436 MSEEPEGRSY 67.500 205 TSEFHLVPSR 27.000 419 RAEGHPDSLK 18.000 119 QADEGEYECR 5.000 453 EIETQTELLS 4.500 306 TTEHSGIYVC 4.500 158 ALEEGQGLTL 4.500 45 GQDAKLPCFY 3.750 486 VQENGTLRAK 2.700 76 AQELALLHSK 2.700 405 HTDPRSQPEE 2.500 385 KYEEELTLTR 2.250 457 QTELLSPGSG 2.250 184 DTEVKGTTSS 2.250 33 ELETSDVVTV 1.800 97 RVEQPPPPRN 1.800 172 TAEGSPAPSV 1.800 36 TSDVVTVVLG 1.500 130 STFPAGSFQA 1.250 411 QPEESVGLRA 1.125 11 GPEAWLLLLL 1.125 72 AGEGAQELAL 1.125 470 EEEDQDEGIK 0.900 252 GLEDQNLWHI 0.900 6 GAEMWGPEAW 0.900 116 NAVQADEGEY 0.500 40 VTVVLGQDAK 0.500 493 RAKPTGNGIY 0.500 365 VVVVVLMSRY 0.500 352 VVGVIAALLF 0.500 342 QVDLVSASVV 0.500 209 HLVPSRSMNG 0.500 364 LVVVVVLMSR 0.500 284 RLDGPLPSGV 0.500 122 EGEYECRVST 0.450 437 SEEPEGRSYS 0.450 58 SGEQVGQVAW 0.450 409 RSQPEESVGL 0.300 296 DGDTLGFPPL 0.250 107 PLDGSVLLRN 0.250 390 LTLTRENSIR 0.250 275 QPPPSYNWTR 0.250 55 RGDSGEQVGQ 0.250 318 SNEFSSRDSQ 0.225 31 AGELETSDVV 0.225 439 EPEGRSYSTL 0.225 235 RITHILHVSF 0.200 16 LLLLLLLASF 0.200 367 VVVLMSRYHR 0.200 369 VLMSRYHRRK 0.200 242 VSFLAEASVR 0.150 225 VSHPGLLQDQ 0.150 135 GSFQARLRLR 0.150 443 RSYSTLTTVR 0.150 298 DTLGFPPLTT 0.125 189 GTTSSRSFKH 0.125 423 HPDSLKDNSS 0.125 106 NPLDGSVLLR 0.125 305 LTTEHSGIYV 0.125 471 EEDQDEGIKQ 0.125 400 RLHSHHTDPR 0.100 69 RVDAGEGAQE 0.100 145 VLVPPLPSLN 0.100 434 SVMSEEPEGR 0.100 260 HIGREGAMLK 0.100 89 HVSPAYEGRV 0.100 368 VVLMSRYHRR 0.100 128 RVSTFPAGSF 0.100 19 LLLLASFTGR 0.100 474 QDEGIKQAMN 0.090 467 RAEEEEDQDE 0.090 245 LAEASVRGLE 0.090 473 DQDEGIKQAM 0.075 214 RSMNGQPLTC 0.075 231 LQDQRITHIL 0.075 357 AALLFCLLVV 0.050 43 VLGQDAKLPC 0.050 188 KGTTSSRSFK 0.050 44 LGQDAKLPCF 0.050 217 NGQPLTCVVS 0.050 201 SAAVTSEFHL 0.050 294 RVDGDTLGFP 0.050 18 LLLLLASFTG 0.050 35 ETSDVVTVVL 0.050 171 CTAEGSPAPS 0.050 447 TLTTVREIET 0.050 221 LTCVVSHPGL 0.050 354 GVIAALLFCL 0.050 81 LLHSKYGLHV 0.050 323 SRDSQVTVDV 0.050 329 TVDVLDPQED 0.050 304 PLTTEHSGIY 0.050 273 EGQPPPSYNW 0.050 15 WLLLLLLLAS 0.050 363 LLVVVVVLMS 0.050 85 KYGLHVSPAY 0.050 146 LVPPLPSLNP 0.050 485 FVQENGTLRA 0.050 V2-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 GQDAKLPCLY 3.750 6 KLPCLYRGDS 0.010 1 LGQDAKLPCL 0.005 3 QDAKLPCLYR 0.003 7 LPCLYRGDSG 0.003 4 DAKLPCLYRG 0.002 9 CLYRGDSGEQ 0.001 5 AKLPCLYRGD 0.001 8 PCLYRGDSGE 0.000 10 LYRGDSGEQV 0.000 V7-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 4 HTDPRSQSEE 1.250 8 RSQSEEPEGR 0.150 1 HSHHTDPRSQ 0.015 9 SQSEEPEGRS 0.002 2 SHHTDPRSQS 0.001 7 PRSQSEEPEG 0.000 3 HHTDPRSQSE 0.000 6 DPRSQSEEPE 0.000 5 TDPRSQSEEP 0.000 V9-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 39 FLEMESHYVA 1.800 13 ITFNFFLFFF 1.250 28 VVFFIYFYFY 1.000 116 SCDCERGYFQ 1.000 75 HCACFESFTK 1.000 78 CFESFTKRKK 0.900 41 EMESHYVAQA 0.900 12 RITFNFFLFF 0.500 27 LVVFFIYFYF 0.500 8 GILLRITFNF 0.500 6 LAGILLRITF 0.500 57 SSNPPASASL 0.300 2 RRELLAGILL 0.225 22 FLPFPLVVFF 0.200 70 TLSVHHCACF 0.200 77 ACFESFTKRK 0.200 96 IQCLLLGLLK 0.150 115 NSCDCERGYF 0.150 114 VNSCDCERGY 0.125 23 LPFPLVVFFI 0.125 25 FPLVVFFIYF 0.125 76 CACFESFTKR 0.100 26 PLVVFFIYFY 0.100 21 FFLPFPLVVF 0.100 98 CLLLGLLKVR 0.100 118 DCERGYFQGI 0.090 51 GLELLGSSNP 0.090 64 ASLVAGTLSV 0.075 31 FIYFYFYFFL 0.050 47 VAQAGLELLG 0.050 72 SVHHCACFES 0.050 4 ELLAGILLRI 0.050 97 QCLLLGLLKV 0.050 18 FLFFFLPFPL 0.050 43 ESHYVAQAGL 0.030 58 SNPPASASLV 0.025 3 RELLAGILLR 0.025 112 QGVNSCDCER 0.025 69 GTLSVHHCAC 0.025 11 LRITFNFFLF 0.025 82 FTKRKKKLKK 0.025 29 VFFIYFYFYF 0.025 16 NFFLFFFLPF 0.025 37 YFFLEMESHY 0.025 66 LVAGTLSVHH 0.020 54 LLGSSNPPAS 0.020 53 ELLGSSNPPA 0.020 56 GSSNPPASAS 0.015 62 ASASLVAGTL 0.015 80 ESFTKRKKKL 0.015 24 PFPLVVFFIY 0.013 59 NPPASASLVA 0.013 121 RGYFQGIFMQ 0.013 67 VAGTLSVHHC 0.010 105 KVRPLQHQGV 0.010 9 ILLRITFNFF 0.010 79 FESFTKRKKK 0.010 49 QAGLELLGSS 0.010 46 YVAQAGLELL 0.010 63 SASLVAGTLS 0.010 113 GVNSCDCERG 0.010 95 FIQCLLLGLL 0.010 30 FFIYFYFYFF 0.010 5 LLAGILLRIT 0.010 65 SLVAGTLSVH 0.010 100 LLGLLKVRPL 0.010 48 AQAGLELLGS 0.007 102 GLLKVRPLQH 0.005 55 LGSSNPPASA 0.005 101 LGLLKVRPLQ 0.005 73 VHHCACFESF 0.005 125 QGIFMQAAPW 0.005 10 LLRITFNFFL 0.005 107 RPLQHQGVNS 0.005 128 FMQAAPWEGT 0.005 86 KKKLKKAFRF 0.003 117 CDCERGYFQG 0.003 93 FRFIQCLLLG 0.003 14 TFNFFLFFFL 0.003 33 YFYFYFFLEM 0.003 120 ERGYFQGIFM 0.003 122 GYFQGIFMQA 0.003 35 YFYFFLEMES 0.003 68 AGTLSVHHCA 0.003 45 HYVAQAGLEL 0.003 50 AGLELLGSSN 0.003 7 AGILLRITFN 0.003 20 FFFLPFPLVV 0.003 94 RFIQCLLLGL 0.003 126 GIFMQAAPWE 0.002 99 LLLGLLKVRP 0.002 61 PASASLVAGT 0.002 71 LSVHHCACFE 0.002 15 FNFFLFFFLP 0.001 81 SFTKRKKKLK 0.001 103 LLKVRPLQHQ 0.001 108 PLQHQGVNSC 0.001 40 LEMESHYVAQ 0.001 91 KAFRFIQCLL 0.001 19 LFFFLPFPLV 0.001 V10-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 AGELGTSDVV 0.225 10 GTSDVVTVVL 0.050 2 GRCPAGELGT 0.025 8 ELGTSDVVTV 0.020 3 RCPAGELGTS 0.010 9 LGTSDVVTVV 0.003 7 GELGTSDVVT 0.001 5 PAGELGTSDV 0.001 4 CPAGELGTSD 0.000 1 TGRCPAGELG 0.000 V11-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 VMVPPLPSLN 0.050 10 MVPPLPSLNP 0.050 8 RVMVPPLPSL 0.020 7 LRVMVPPLPS 0.003 2 QARLRLRVMV 0.002 6 RLRVMVPPLP 0.000 4 RLRLRVMVPP 0.000 1 FQARLRLRVM 0.000 5 LRLRVMVPPL 0.000 3 ARLRLRVMVP 0.000 V12-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 MSEEPEGCSY 67.500 4 SEEPEGCSYS 0.450 6 EPEGCSYSTL 0.225 10 CSYSTLTTVR 0.150 8 EGCSYSTLTT 0.013 9 GCSYSTLTTV 0.010 1 SVMSEEPEGC 0.010 2 VMSEEPEGCS 0.005 5 EEPEGCSYST 0.001 11 SYSTLTTVRE 0.000 7 PEGCSYSTLT 0.000 V13-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 LADPQEDSGK 100.000 5 TVDVLADPQE 0.100 1 DSQVTVDVLA 0.030 4 VTVDVLADPQ 0.025 8 VLADPQEDSG 0.010 7 DVLADPQEDS 0.010 3 QVTVDVLADP 0.002 2 SQVTVDVLAD 0.001 10 ADPQEDSGKQ 0.001 6 VDVLADPQED 0.000 V14-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 SSNPPASASL 0.300 10 ASLVAGTLSV 0.075 4 SNPPASASLV 0.025 8 ASASLVAGTL 0.015 2 GSSNPPASAS 0.015 5 NPPASASLVA 0.013 9 SASLVAGTLS 0.010 1 LGSSNPPASA 0.005 7 PASASLVAGT 0.002 6 PPASASLVAG 0.001

[1024] 20 TABLE X Start Subsequence Score V1-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eiqht. 359 LLFCLLVVV 412.546 18 LLLLLASFT 257.802 358 ALLFCLLVV 242.674 15 WLLLLLLLA 194.477 145 VLVPPLPSL 83.527 80 ALLHSKYGL 79.041 362 CLLVVVVVL 74.536 355 VIAALLFCL 66.613 8 EMWGPEAWL 52.823 502 YINGRGHLV 43.992 137 FQARLRLRV 32.438 112 VLLRNAVQA 31.249 363 LLVVVVVLM 19.425 357 AALLFCLLV 13.582 42 VVLGQDAKL 11.757 203 AVTSEFHLV 11.563 345 LVSASVVVV 9.756 410 SQPEESVGL 8.880 299 TLGFPPLTT 7.452 164 GLTLAASCT 7.452 351 VVVGVIAAL 7.309 361 FCLLVVVVV 7.287 354 GVIAALLFC 5.499 34 LETSDVVTV 5.288 10 WGPEAWLLL 4.471 21 LLASFTGRC 4.172 32 GELETSDVV 4.122 142 RLRVLVPPL 3.734 215 SMNGQPLTC 3.588 443 RSYSTLTTV 3.342 352 VVGVIAALL 3.178 242 VSFLAEASV 2.856 19 LLLLASFTG 2.719 342 QVDLVSASV 2.434 253 LEDQNLWHI 2.380 229 GLLQDQRIT 2.261 347 SASVVVVGV 2.222 344 DLVSASVVV 2.139 106 NPLDGSVLL 2.115 123 GEYECRVST 1.901 216 MNGQPLTCV 1.775 202 AAVTSEFHL 1.721 452 REIETQTEL 1.703 350 VVVVGVIAA 1.700 287 GPLPSGVRV 1.680 231 LQDQRITHI 1.654 244 FLAEASVRG 1.405 173 AEGSPAPSV 1.352 62 VGQVAWARV 1.312 495 KPTGNGIYI 1.311 460 LLSPGSGRA 1.098 17 LLLLLLASF 1.078 16 LLLLLLLAS 1.078 356 IAALLFCLL 0.958 263 REGAMLKCL 0.955 V1-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 390 LTLTRENSI 0.911 478 IKQAMNHFV 0.903 230 LLQDQRITH 0.519 135 GSFQARLRL 0.516 238 HILHVSFLA 0.498 60 EQVGQVAWA 0.478 481 AMNHFVQEN 0.470 266 AMLKCLSEG 0.458 110 GSVLLRNAV 0.454 196 FKHSRSAAV 0.444 64 QVAWARVDA 0.435 165 LTLAASCTA 0.434 13 EAWLLLLLL 0.425 121 DEGEYECRV 0.416 73 GEGAQELAL 0.415 275 QPPPSYNWT 0.401 384 QKYEEELTL 0.389 306 TTEHSGIYV 0.340 35 ETSDVVTVV 0.280 4 SLGAEMWGP 0.257 158 ALEEGQGLT 0.254 341 KQVDLVSAS 0.249 343 VDLVSASVV 0.249 382 MTQKYEEEL 0.247 446 STLTTVREI 0.247 223 CVVSHPGLL 0.243 304 PLTTEHSGI 0.230 44 LGQDAKLPC 0.226 1 MPLSLGAEM 0.204 450 TVREIETQT 0.203 237 THILHVSFL 0.188 217 NGQPLTCVV 0.186 214 RSMNGQPLT 0.180 349 SVVVVGVIA 0.178 20 LLLASFTGR 0.178 448 LTTVREIET 0.176 285 LDGPLPSGV 0.164 473 DQDEGIKQA 0.142 322 SSRDSQVTV 0.141 369 VLMSRYHRR 0.141 100 QPPPPRNPL 0.139 222 TCVVSHPGL 0.139 257 NLWHIGREG 0.124 163 QGLTLAASC 0.120 23 ASFTGRCPA 0.120 V2-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 GQDAKLPCL 1.993 8 CLYRGDSGE 0.048 5 KLPCLYRGD 0.016 4 AKLPCLYRG 0.001 6 LPCLYRGDS 0.000 2 QDAKLPCLY 0.000 7 PCLYRGDSG 0.000 3 DAKLPCLYR 0.000 9 LYRGDSGEQ 0.000 V7-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 SQSEEPEGR 0.003 7 RSQSEEPEG 0.000 4 TDPRSQSEE 0.000 2 HHTDPRSQS 0.000 3 HTDPRSQSE 0.000 1 SHHTDPRSQ 0.000 5 DPRSQSEEP 0.000 6 PRSQSEEPE 0.000 V9-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 98 CLLLGLLKV 591.888 15 FNFFLFFFL 143.853 39 FLEMESHYV 112.619 65 SLVAGTLSV 69.552 5 LLAGILLRI 40.792 91 KAFRFIQCL 33.581 95 FIQCLLLGL 31.077 124 FQGIFMQAA 20.251 18 FLFFFLPFP 12.194 46 YVAQAGLEL 8.598 54 LLGSSNPPA 8.446 70 TLSVHHCAC 4.968 32 IYFYFYFFL 3.393 9 ILLRITFNF 2.719 88 KLKKAFRFI 2.671 109 LQHQGVNSC 1.969 28 VVFFIYFYF 1.963 128 FMQAAPWEG 1.857 31 FIYFYFYFF 1.576 20 FFFLPFPLV 1.562 3 RELLAGILL 1.537 21 FFLPFPLVV 1.281 96 IQCLLLGLL 1.101 129 MQAAPWEGT 1.070 40 LEMESHYVA 1.021 11 LRITFNFFL 0.611 121 RGYFQGIFM 0.571 47 VAQAGLELL 0.568 19 LFFFLPFPL 0.541 27 LVVFFIYFY 0.533 8 GILLRITFN 0.480 59 NPPASASLV 0.454 101 LGLLKVRPL 0.403 42 MESHYVAQA 0.378 22 FLPFPLVVF 0.323 13 ITFNFFLFF 0.259 69 GTLSVHHCA 0.255 58 SNPPASASL 0.139 12 RITFNFFLF 0.113 62 ASASLVAGT 0.112 10 LLRITFNFF 0.101 99 LLLGLLKVR 0.088 34 FYFYFFLEM 0.085 68 AGTLSVHHC 0.075 26 PLVVFFIYF 0.065 102 GLLKVRPLQ 0.055 93 FRFIQCLLL 0.050 44 SHYVAQAGL 0.047 90 KKAFRFIQC 0.046 30 FFIYFYFYF 0.043 23 LPFPLVVFF 0.039 63 SASLVAGTL 0.039 126 GIFMQAAPW 0.038 25 FPLVVFFIY 0.037 75 HCACFESFT 0.035 6 LAGILLRIT 0.033 56 GSSNPPASA 0.032 123 YFQGIFMQA 0.030 119 CERGYFQGI 0.029 100 LLGLLKVRP 0.025 111 HQGVNSCDC 0.017 106 VRPLQHQGV 0.016 81 SFTKRKKKL 0.015 14 TFNFFLFFF 0.014 24 PFPLVVFFI 0.012 66 LVAGTLSVH 0.010 4 ELLAGILLR 0.010 87 KKLKKAFRF 0.008 48 AQAGLELLG 0.008 72 SVHHCACFE 0.007 17 FFLFFFLPF 0.006 51 GLELLGSSN 0.005 103 LLKVRPLQH 0.004 53 ELLGSSNPP 0.004 38 FFLEMESHY 0.004 29 VFFIYFYFY 0.003 77 ACFESFTKR 0.003 49 QAGLELLGS 0.002 50 AGLELLGSS 0.002 52 LELLGSSNP 0.002 64 ASLVAGTLS 0.002 1 MRRELLAGI 0.002 67 VAGTLSVHH 0.002 105 KVRPLQHQG 0.002 33 YFYFYFFLE 0.002 108 PLQHQGVNS 0.002 16 NFFLFFFLP 0.002 113 GVNSCDCER 0.001 76 CACFESFTK 0.001 92 AFRFIQCLL 0.001 37 YFFLEMESH 0.001 71 LSVHHCACF 0.001 55 LGSSNPPAS 0.001 35 YFYFFLEME 0.001 73 VHHCACFES 0.001 7 AGILLRITF 0.000 57 SSNPPASAS 0.000 117 CDCERGYFQ 0.000 114 VNSCDCERG 0.000 115 NSCDCERGY 0.000 V10-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 VMVPPLPSL 60.325 5 RLRVMVPPL 3.734 2 ARLRLRVMV 0.036 7 RVMVPPLPS 0.024 9 MVPPLPSLN 0.011 3 RLRLRVMVP 0.001 1 QARLRLRVM 0.001 4 LRLRVMVPP 0.000 6 LRVMVPPLP 0.000 V11-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 GTSDVVTVV 3.735 8 LGTSDVVTV 1.775 6 GELGTSDVV 1.005 7 ELGTSDVVT 0.229 2 RCPAGELGT 0.049 5 AGELGTSDV 0.029 3 CPAGELGTS 0.000 4 PAGELGTSD 0.000 1 GRCPAGELG 0.000 V12-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 VMSEEPEGC 12.254 9 CSYSTLTTV 3.342 8 GCSYSTLTT 0.049 6 PEGCSYSTL 0.014 7 EGCSYSTLT 0.004 4 EEPEGCSYS 0.002 5 EPEGCSYST 0.000 3 SEEPEGCSY 0.000 2 MSEEPEGCS 0.000 V13-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 SQVTVDVLA 0.504 7 VLADPQEDS 0.255 3 VTVDVLADP 0.003 2 QVTVDVLAD 0.003 6 DVLADPQED 0.000 8 LADPQEDSG 0.000 4 TVDVLADPQ 0.000 5 VDVLADPQE 0.000 9 ADPQEDSGK 0.000 V14-HLA-A201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 4 NPPASASLV 0.454 3 SNPPASASL 0.139 7 ASASLVAGT 0.112 8 SASLVAGTL 0.039 1 GSSNPPASA 0.032 9 ASLVAGTLS 0.002 2 SSNPPASAS 0.000 5 PPASASLVA 0.000 6 PASASLVAG 0.000

[1025] 21 TABLE XI Start Subsequence Score V1-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 359 LLFCLLVVVV 412.546 17 LLLLLLASFT 257.802 358 ALLFCLLVVV 242.674 244 FLAEASVRGL 185.332 230 LLQDQRITHI 167.248 81 LLHSKYGLHV 118.238 215 SMNGQPLTCV 115.534 341 KQVDLVSASV 101.193 239 ILHVSFLAEA 73.815 8 EMWGPEAWLL 72.031 252 GLEDQNLWHI 47.223 362 CLLVVVVVLM 42.278 305 LTTEHSGIYV 37.032 284 RLDGPLPSGV 27.821 354 GVIAALLFCL 24.935 257 NLWHIGREGA 20.205 144 RVLVPPLPSL 15.907 20 LLLASFTGRC 15.437 181 VTWDTEVKGT 13.771 61 QVGQVAWARV 10.346 426 SLKDNSSCSV 9.981 355 VIAALLFCLL 9.488 7 AEMWGPEAWL 8.453 43 VLGQDAKLPC 8.446 485 FVQENGTLRA 8.198 381 QMTQKYEEEL 7.560 447 TLTTVREIET 7.452 350 VVVVGVIAAL 7.309 236 ITHILHVSFL 6.381 356 IAALLFCLLV 6.240 274 GQPPPSYNWT 6.233 10 WGPEAWLLLL 6.049 158 ALEEGQGLTL 5.605 319 NEFSSRDSQV 5.004 164 GLTLAASCTA 4.968 344 DLVSASVVVV 4.919 118 VQADEGEYEC 3.511 357 AALLFCLLVV 3.370 351 VVVGVIAALL 3.178 15 WLLLLLLLAS 2.917 18 LLLLLASFTG 2.719 125 YECRVSTFPA 2.577 132 FPAGSFQARL 2.438 361 FCLLVVVVVL 2.238 34 LETSDVVTVV 2.168 321 FSSRDSQVTV 2.088 137 FQARLRLRVL 1.879 41 TVVLGQDAKL 1.869 79 LALLHSKYGL 1.866 477 GIKQAMNHFV 1.841 202 AAVTSEFHLV 1.835 346 VSASVVVVGV 1.775 201 SAAVTSEFHL 1.721 111 SVLLRNAVQA 1.608 130 STFPAGSFQA 1.481 59 GEQVGQVAWA 1.222 500 GIYINGRGHL 1.222 370 LMSRYHRRKA 1.220 16 LLLLLLLASF 1.078 349 SVVVVGVIAA 1.000 342 QVDLVSASVV 0.998 73 GEGAQELALL 0.955 32 GELETSDVVT 0.901 452 REIETQTELL 0.834 389 ELTLTRENSI 0.782 33 ELETSDVVTV 0.768 39 VVTVVLGQDA 0.739 353 VGVIAALLFC 0.697 280 YNWTRLDGPL 0.692 231 LQDQRITHIL 0.604 221 LTCVVSHPGL 0.504 63 GQVAWARVDA 0.504 162 GQGLTLAASC 0.504 178 APSVTWDTEV 0.454 13 EAWLLLLLLL 0.425 176 SPAPSVTWDT 0.365 216 MNGQPLTCVV 0.316 384 QKYEEELTLT 0.312 270 CLSEGQPPPS 0.306 363 LLVVVVVLMS 0.291 229 GLLQDQRITH 0.276 343 VDLVSASVVV 0.249 150 LPSLNPGPAL 0.237 5 LGAEMWGPEA 0.226 112 VLLRNAVQAD 0.216 241 HVSFLAEASV 0.207 163 QGLTLAASCT 0.180 459 ELLSPGSGRA 0.179 19 LLLLASFTGR 0.178 25 FTGRCPAGEL 0.177 336 QEDSGKQVDL 0.166 99 EQPPPPRNPL 0.162 445 YSTLTTVREI 0.144 249 SVRGLEDQNL 0.142 334 DPQEDSGKQV 0.140 105 RNPLDGSVLL 0.139 409 RSQPEESVGL 0.139 134 AGSFQARLRL 0.139 156 GPALEEGQGL 0.139 145 VLVPPLPSLN 0.127 V2-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 LGQDAKLPCL 2.236 6 KLPCLYRGDS 0.034 9 CLYRGDSGEQ 0.006 2 GQDAKLPCLY 0.003 10 LYRGDSGEQV 0.001 7 LPCLYRGDSG 0.000 3 QDAKLPCLYR 0.000 5 AKLPCLYRGD 0.000 8 PCLYRGDSGE 0.000 4 DAKLPCLYRG 0.000 V7-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 SQSEEPEGRS 0.004 2 SHHTDPRSQS 0.000 8 RSQSEEPEGR 0.000 5 TDPRSQSEEP 0.000 4 HTDPRSQSEE 0.000 3 HHTDPRSQSE 0.000 1 HSHHTDPRSQ 0.000 6 DPRSQSEEPE 0.000 7 PRSQSEEPEG 0.000 V9-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 31 FIYFYFYFFL 7861.874 18 FLFFFLPFPL 2108.811 10 LLRITFNFFL 334.570 23 LPFPLVVFFI 31.429 128 FMQAAPWEGT 20.623 38 FFLEMESHYV 18.538 100 LLGLLKVRPL 16.705 46 YVAQAGLELL 9.690 4 ELLAGILLRI 6.659 9 ILLRITFNFF 4.898 22 FLPFPLVVFF 4.336 95 FIQCLLLGLL 4.040 97 QCLLLGLLKV 3.864 91 KAFRFIQCLL 3.842 5 LLAGILLRIT 2.389 13 ITFNFFLFFF 1.815 64 ASLVAGTLSV 1.680 105 KVRPLQHQGV 1.619 53 ELLGSSNPPA 1.379 20 FFFLPFPLVV 1.281 90 KKAFRFIQCL 0.908 14 TFNFFLFFFL 0.899 39 FLEMESHYVA 0.600 19 LFFFLPFPLV 0.577 27 LVVFFIYFYF 0.530 58 SNPPASASLV 0.454 28 VVFFIYFYFY 0.429 12 RITFNFFLFF 0.407 87 KKLKKAFRFI 0.392 33 YFYFYFFLEM 0.367 25 FPLVVFFIYF 0.329 102 GLLKVRPLQH 0.276 67 VAGTLSVHHC 0.270 69 GTLSVHHCAC 0.255 108 PLQHQGVNSC 0.251 8 GILLRITFNF 0.220 57 SSNPPASASL 0.139 123 YFQGIFMQAA 0.139 54 LLGSSNPPAS 0.127 99 LLLGLLKVRP 0.094 26 PLVVFFIYFY 0.079 70 TLSVHHCACF 0.075 65 SLVAGTLSVH 0.070 15 FNFFLFFFLP 0.069 29 VFFIYFYFYF 0.059 55 LGSSNPPASA 0.055 98 CLLLGLLKVR 0.052 126 GIFMQAAPWE 0.042 41 EMESHYVAQA 0.040 80 ESFTKRKKKL 0.039 72 SVHHCACFES 0.038 94 RFIQCLLLGL 0.034 68 AGTLSVHHCA 0.032 62 ASASLVAGTL 0.018 48 AQAGLELLGS 0.017 88 KLKKAFRFIQ 0.016 59 NPPASASLVA 0.013 40 LEMESHYVAQ 0.011 66 LVAGTLSVHH 0.011 43 ESHYVAQAGL 0.010 17 FFLFFFLPFP 0.008 50 AGLELLGSSN 0.007 124 FQGIFMQAAP 0.007 7 AGILLRITFN 0.006 77 ACFESFTKRK 0.006 61 PASASLVAGT 0.005 122 GYFQGIFMQA 0.005 121 RGYFQGIFMQ 0.004 117 CDCERGYFQG 0.004 74 HHCACFESFT 0.004 110 QHQGVNSCDC 0.003 113 GVNSCDCERG 0.003 96 IQCLLLGLLK 0.003 109 LQHQGVNSCD 0.003 30 FFIYFYFYFF 0.002 3 RELLAGILLR 0.002 42 MESHYVAQAG 0.002 127 IFMQAAPWEG 0.002 103 LLKVRPLQHQ 0.002 52 LELLGSSNPP 0.002 107 RPLQHQGVNS 0.002 6 LAGILLRITF 0.002 47 VAQAGLELLG 0.002 115 NSCDCERGYF 0.001 16 NFFLFFFLPF 0.001 79 FESFTKRKKK 0.001 83 TKRKKKLKKA 0.001 92 AFRFIQCLLL 0.001 63 SASLVAGTLS 0.001 51 GLELLGSSNP 0.001 71 LSVHHCACFE 0.001 37 YFFLEMESHY 0.001 21 FFLPFPLVVF 0.001 89 LKKAFRFIQC 0.001 35 YFYFFLEMES 0.001 118 DCERGYFQGI 0.001 101 LGLLKVRPLQ 0.001 125 QGIFMQAAPW 0.000 56 GSSNPPASAS 0.000 93 FRFIQCLLLG 0.000 V10-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 ELGTSDVVTV 11.998 9 LGTSDVVTVV 0.728 10 GTSDVVTVVL 0.499 7 GELGTSDVVT 0.220 5 PAGELGTSDV 0.087 6 AGELGTSDVV 0.006 2 GRCPAGELGT 0.001 3 RCPAGELGTS 0.000 4 CPAGELGTSD 0.000 1 TGRCPAGELG 0.000 V11-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RVMVPPLPSL 15.907 1 FQARLRLRVM 0.437 9 VMVPPLPSLN 0.091 2 QARLRLRVMV 0.073 5 LRLRVMVPPL 0.043 4 RLRLRVMVPP 0.003 10 MVPPLPSLNP 0.002 6 RLRVMVPPLP 0.001 7 LRVMVPPLPS 0.000 3 ARLRLRVMVP 0.000 V12-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 GCSYSTLTTV 1.044 1 SVMSEEPEGC 0.788 2 VMSEEPEGCS 0.049 0 EEPEGCSYST 0.045 8 EGCSYSTLTT 0.004 7 PEGCSYSTLT 0.003 6 EPEGCSYSTL 0.001 4 SEEPEGCSYS 0.001 3 MSEEPEGCSY 0.000 10 CSYSTLTTVR 0.000 11 SYSTLTTVRE 0.000 V13-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 VLADPQEDSG 0.255 2 SQVTVDVLAD 0.003 3 QVTVDVLADP 0.003 1 DSQVTVDVLA 0.002 7 DVLADPQEDS 0.001 4 VTVDVLADPQ 0.001 5 TVDVLADPQE 0.001 9 LADPQEDSGK 0.000 6 VDVLADPQED 0.000 10 ADPQEDSGKQ 0.000 V14-HLA-A201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 ASLVAGTLSV 1.680 4 SNPPASASLV 0.454 3 SSNPPASASL 0.139 1 LGSSNPPASA 0.055 8 ASASLVAGTL 0.018 5 NPPASASLVA 0.013 7 PASASLVAGT 0.005 9 SASLVAGTLS 0.001 2 GSSNPPASAS 0.000 6 PPASASLVAG 0.000

[1026] 22 TABLE XII Start Subsequence Score V1-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 20 LLLASFTGR 18.000 435 VMSEEPEGR 6.000 369 VLMSRYHRR 6.000 370 LMSRYHRRK 6.000 17 LLLLLLASF 4.500 362 CLLVVVVVL 4.050 391 TLTRENSIR 4.000 107 PLDGSVLLR 3.600 145 VLVPPLPSL 3.038 189 GTTSSRSFK 3.000 41 TVVLGQDAK 3.000 80 ALLHSKYGL 2.700 365 VVVVVLMSR 2.700 459 ELLSPGSGR 2.700 8 EMWGPEAWL 2.025 180 SVTWDTEVK 2.000 61 QVGQVAWAR 1.800 368 VVLMSRYHR 1.800 142 RLRVLVPPL 1.800 359 LLFCLLVVV 1.500 363 LLVVVVVLM 1.350 316 HVSNEFSSR 1.200 252 GLEDQNLWH 1.200 78 ELALLHSKY 1.200 366 VVVVLMSRY 0.900 358 ALLFCLLVV 0.900 477 GIKQAMNHF 0.900 15 WLLLLLLLA 0.900 89 HVSPAYEGR 0.600 294 RVDGDTLGF 0.600 485 FVQENGTLR 0.600 97 RVEQPPPPR 0.600 215 SMNGQPLTC 0.600 392 LTRENSIRR 0.600 230 LLQDQRITH 0.400 351 VVVGVIAAL 0.304 313 YVCHVSNEF 0.300 112 VLLRNAVQA 0.300 299 TLGFPPLTT 0.300 164 GLTLAASCT 0.300 354 GVIAALLFC 0.270 45 GQDAKLPCF 0.270 355 VIAALLFCL 0.270 255 DQNLWHIGR 0.216 132 FPAGSFQAR 0.180 350 VVVVGVIAA 0.180 16 LLLLLLLAS 0.180 186 EVKGTTSSR 0.180 292 GVRVDGDTL 0.180 206 SEFHLVPSR 0.180 481 AMNHFVQEN 0.180 21 LLASFTGRC 0.180 11 GPEAWLLLL 0.162 18 LLLLLASFT 0.150 77 QELALLHSK 0.135 42 VVLGQDAKL 0.135 238 HILHVSFLA 0.135 274 GQPPPSYNW 0.121 378 KAQQMTQKY 0.120 239 ILHVSFLAE 0.120 117 AVQADEGEY 0.120 140 RLRLRVLVP 0.120 498 GNGIYINGR 0.108 236 ITHILHVSF 0.100 352 VVGVIAALL 0.090 19 LLLLASFTG 0.090 135 GSFQARLRL 0.090 4 SLGAEMWGP 0.090 344 DLVSASVVV 0.090 305 LTTEHSGIY 0.090 460 LLSPGSGRA 0.090 382 MTQKYEEEL 0.090 420 AEGHPDSLK 0.090 284 RLDGPLPSG 0.068 261 IGREGAMLK 0.060 417 GLRAEGHPD 0.060 81 LLHSKYGLH 0.060 203 AVTSEFHLV 0.060 192 SSRSFKHSR 0.060 260 HIGREGAML 0.060 304 PLTTEHSGI 0.060 113 LLRNAVQAD 0.060 87 GLHVSPAYE 0.060 345 LVSASVVVV 0.060 364 LVVVVVLMS 0.054 495 KPTGNGIYI 0.054 47 DAKLPCFYR 0.054 411 QPEESVGLR 0.054 209 HLVPSRSMN 0.045 229 GLLQDQRIT 0.045 349 SVVVVGVIA 0.045 390 LTLTRENSI 0.045 158 ALEEGQGLT 0.045 266 AMLKCLSEG 0.045 227 HPGLLQDQR 0.040 426 SLKDNSSCS 0.040 276 PPPSYNWTR 0.036 386 YEEELTLTR 0.036 377 RKAQQMTQK 0.030 244 FLAEASVRG 0.030 V2-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight 8 CLYRGDSGE 0.100 1 GQDAKLPCL 0.081 3 DAKLPCLYR 0.036 5 KLPCLYRGD 0.006 2 QDAKLPCLY 0.004 6 LPCLYRGDS 0.000 4 AKLPCLYRG 0.000 7 PCLYRGDSG 0.000 9 LYRGDSGEQ 0.000 V7-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight 8 SQSEEPEGR 0.180 3 HTDPRSQSE 0.002 7 RSQSEEPEG 0.000 2 HHTDPRSQS 0.000 5 DPRSQSEEP 0.000 4 TDPRSQSEE 0.000 6 PRSQSEEPE 0.000 1 SHHTDPRSQ 0.000 V9-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 31 FIYFYFYFF 27.000 9 ILLRITFNF 13.500 13 ITFNFFLFF 9.000 27 LVVFFIYFY 8.100 99 LLLGLLKVR 6.750 10 LLRITFNFF 6.000 26 PLVVFFIYF 5.400 4 ELLAGILLR 5.400 28 VVFFIYFYF 4.500 22 FLPFPLVVF 4.500 5 LLAGILLRI 4.050 12 RITFNFFLF 1.800 113 GVNSCDCER 1.200 98 CLLLGLLKV 0.900 77 ACFESFTKR 0.900 25 FPLVVFFIY 0.810 76 CACFESFTK 0.600 65 SLVAGTLSV 0.600 97 QCLLLGLLK 0.600 88 KLKKAFRFI 0.540 29 VFFIYFYFY 0.540 82 FTKRKKKLK 0.500 23 LPFPLVVFF 0.450 18 FLFFFLPFP 0.450 91 KAFRFIQCL 0.405 103 LLKVRPLQH 0.400 126 GIFMQAAPW 0.300 70 TLSVHHCAC 0.200 54 LLGSSNPPA 0.200 39 FLEMESHYV 0.200 95 FIQCLLLGL 0.180 102 GLLKVRPLQ 0.135 46 YVAQAGLEL 0.120 80 ESFTKRKKK 0.075 69 GTLSVHHCA 0.068 128 FMQAAPWEG 0.060 51 GLELLGSSN 0.060 15 FNFFLFFFL 0.054 17 FFLFFFLPF 0.054 66 LVAGTLSVH 0.045 83 TKRKKKLKK 0.040 78 CFESFTKRK 0.030 30 FFIYFYFYF 0.027 14 TFNFFLFFF 0.027 32 IYFYFYFFL 0.027 124 FQGIFMQAA 0.027 81 KKLKKAFRF 0.027 119 CERGYFQGI 0.024 100 LLGLLKVRP 0.020 109 LQHQGVNSC 0.018 34 FYFYFFLEM 0.018 71 LSVHHCACF 0.015 53 ELLGSSNPP 0.013 8 GILLRITFN 0.013 86 KKKLKKAFR 0.012 38 FFLEMESHY 0.009 47 VAQAGLELL 0.009 105 KVRPLQHQG 0.009 19 LFFFLPFPL 0.009 11 LRITFNFFL 0.008 96 IQCLLLGLL 0.008 74 HHCACFESF 0.006 7 AGILLRITF 0.006 41 EMESHYVAQ 0.006 116 SCDCERGYF 0.006 111 HQGVNSCDC 0.006 93 FRFIQCLLL 0.006 79 FESFTKRKK 0.006 3 RELLAGILL 0.005 42 MESHYVAQA 0.005 56 GSSNPPASA 0.005 20 FFFLPFPLV 0.005 129 MQAAPWEGT 0.005 40 LEMESHYVA 0.004 108 PLQHQGVNS 0.004 90 KKAFRFIQC 0.004 44 SHYVAQAGL 0.003 75 HCACFESFT 0.003 123 YFQGIFMQA 0.003 16 NFFLFFFLP 0.003 21 FFLPFPLVV 0.003 33 YFYFYFFLE 0.003 63 SASLVAGTL 0.003 72 SVHHCACFE 0.002 115 NSCDCERGY 0.002 67 VAGTLSVHH 0.002 121 RGYFQGIFM 0.002 59 NPPASASLV 0.002 58 SNPPASASL 0.002 48 AQAGLELLG 0.002 37 YFFLEMESH 0.002 62 ASASLVAGT 0.002 122 GYFQGIFMQ 0.001 1 MRRELLAGI 0.001 49 QAGLELLGS 0.001 85 RKKKLKKAF 0.001 92 AFRFIQCLL 0.001 24 PFPLVVFFI 0.001 68 AGTLSVHHC 0.001 120 ERGYFQGIF 0.001 V10-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 GTSDVVTVV 0.135 7 ELGTSDVVT 0.030 6 GELGTSDVV 0.004 2 RCPAGELGT 0.002 8 LGTSDVVTV 0.001 3 CPAGELGTS 0.000 5 AGELGTSDV 0.000 1 GRCPAGELG 0.000 4 PAGELGTSD 0.000 V11-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 VMVPPLPSL 3.038 5 RLRVMVPPL 1.800 3 RLRLRVMVP 0.120 7 RVMVPPLPS 0.018 9 MVPPLPSLN 0.003 1 QARLRLRVM 0.000 2 ARLRLRVMV 0.000 4 LRLRVMVPP 0.000 6 LRVMVPPLP 0.000 V13-HLA-A3-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified the length of peptide is 9 amino acids and the end position for each peptide is the start position plus eight. 7 VLADPQEDS 0.060 9 ADPQEDSGK 0.020 1 SQVTVDVLA 0.013 2 QVTVDVLAD 0.012 3 VTVDVLADP 0.003 4 TVDVLADPQ 0.002 6 DVLADPQED 0.001 8 LADPQEDSG 0.000 5 VDVLADPQE 0.000 V14-HLA-A39-mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified the length of peptide is 9 amino acids and the end position for each peptide is the start position plus eight 1 GSSNPPASA 0.005 8 SASLVAGTL 0.003 4 NPPASASLV 0.002 3 SNPPASASL 0.002 7 ASASLVAGT 0.002 2 SSNPPASAS 0.000 5 PPASASLVA 0.000 9 ASLVAGTLS 0.000 6 PASASLVAG 0.000

[1027] 23 TABLE XIII Start Subsequence Score V1-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 332 VLDPQEDSGK 30.000 19 LLLLASFTGR 18.000 369 VLMSRYHRRK 9.000 252 GLEDQNLWHI 8.100 391 TLTRENSIRR 8.000 16 LLLLLLLASF 4.500 8 EMWGPEAWLL 4.050 400 RLHSHHTDPR 4.000 260 HIGREGAMLK 4.000 359 LLFCLLVVVV 3.000 364 LVVVVVLMSR 2.700 381 QMTQKYEEEL 1.800 158 ALEEGQGLTL 1.800 229 GLLQDQRITH 1.800 367 VVVLMSRYHR 1.800 40 VTVVLGQDAK 1.500 362 CLLVVVVVLM 1.350 354 GVIAALLFCL 1.215 81 LLHSKYGLHV 1.200 257 NLWHIGREGA 1.000 76 AQELALLHSK 0.900 365 VVVVVLMSRY 0.900 239 ILHVSFLAEA 0.900 230 LLQDQRITHI 0.900 215 SMNGQPLTCV 0.675 434 SVMSEEPEGR 0.600 164 GLTLAASCTA 0.600 368 VVLMSRYHRR 0.600 363 LLVVVVVLMS 0.540 275 QPPPSYNWTR 0.540 419 RAEGHPDSLK 0.450 358 ALLFCLLVVV 0.450 123 GEYECRVSTF 0.405 43 VLGQDAKLPC 0.400 352 VVGVIAALLF 0.400 60 EQVGQVAWAR 0.364 106 NPLDGSVLLR 0.360 45 GQDAKLPCFY 0.360 390 LTLTRENSIR 0.300 284 RLDGPLPSGV 0.300 244 FLAEASVRGL 0.270 500 GIYINGRGHL 0.270 87 GLHVSPAYEG 0.270 344 DLVSASVVVV 0.270 20 LLLASFTGRC 0.270 130 STFPAGSFQA 0.225 144 RVLVPPLPSL 0.203 351 VVVGVIAALL 0.203 350 VVVVGVIAAL 0.203 426 SLKDNSSCSV 0.200 447 TLTTVREIET 0.200 235 RITHILHVSF 0.200 15 WLLLLLLLAS 0.180 33 ELETSDVVTV 0.180 355 VIAALLFCLL 0.180 349 SVVVVGVIAA 0.180 389 ELTLTRENSI 0.180 410 SQPEESVGLR 0.162 17 LLLLLLASFT 0.150 304 PLTTEHSGIY 0.120 417 GLRAEGHPDS 0.120 49 KLPCFYRGDS 0.108 443 RSYSTLTTVR 0.100 242 VSFLAEASVR 0.100 18 LLLLLASFTG 0.090 249 SVRGLEDQNL 0.090 209 HLVPSRSMNG 0.090 41 TVVLGQDAKL 0.090 80 ALLHSKYGLH 0.090 189 GTTSSRSFKH 0.090 486 VQENGTLRAK 0.090 152 SLNPGPALEE 0.090 112 VLLRNAVQAD 0.090 311 GIYVCHVSNE 0.090 236 ITHILHVSFL 0.090 128 RVSTFPAGSF 0.090 188 KGTTSSRSFK 0.060 270 CLSEGQPPPS 0.060 477 GIKQAMNHFV 0.060 485 FVQENGTLRA 0.060 191 TSSRSFKHSR 0.060 205 TSEFHLVPSR 0.060 119 QADEGEYECR 0.060 11 GPEAWLLLLL 0.054 218 GQPLTCVVSH 0.054 140 RLRLRVLVPP 0.045 299 TLGFPPLTTE 0.045 271 LSEGQPPPSY 0.045 135 GSFQARLRLR 0.045 145 VLVPPLPSLN 0.045 306 TTEHSGIYVC 0.045 96 GRVEQPPPPR 0.041 361 FCLLVVVVVL 0.041 341 KQVDLVSASV 0.041 181 VTWDTEVKGT 0.037 385 KYEEELTLTR 0.036 383 TQKYEEELTL 0.036 376 RRKAQQMTQK 0.030 305 LTTEHSGIYV 0.030 221 LTCVVSHPGL 0.030 V2-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 GQDAKLPCLY 0.360 6 KLPCLYRGDS 0.108 9 CLYRGDSGEQ 0.030 3 QDAKLPCLYR 0.012 1 LGQDAKLPCL 0.001 10 LYRGDSGEQV 0.000 4 DAKLPCLYRG 0.000 7 LPCLYRGDSG 0.000 8 PCLYRGDSGE 0.000 5 AKLPCLYRGD 0.000 V7-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RSQSEEPEGR 0.020 4 HTDPRSQSEE 0.002 9 SQSEEPEGRS 0.001 2 SHHTDPRSQS 0.000 6 DPRSQSEEPE 0.000 5 TDPRSQSEEP 0.000 3 HHTDPRSQSE 0.000 1 HSHHTDPRSQ 0.000 7 PRSQSEEPEG 0.000 V9-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 28 VVFFIYFYFY 54.000 18 FLFFFLPFPL 9.000 9 ILLRITFNFF 9.000 26 PLVVFFIYFY 8.100 13 ITFNFFLFFF 6.750 22 FLPFPLVVFF 6.000 10 LLRITFNFFL 5.400 98 CLLLGLLKVR 4.500 8 GILLRITFNF 4.050 12 RITFNFFLFF 3.600 31 FIYFYFYFFL 2.700 77 ACFESFTKRK 2.250 82 FTKRKKKLKK 2.000 70 TLSVHHCACF 2.000 102 GLLKVRPLQH 1.800 27 LVVFFIYFYF 1.350 4 ELLAGILLRI 1.215 96 IQCLLLGLLK 1.200 23 LPFPLVVFFI 0.608 75 HCACFESFTK 0.600 39 FLEMESHYVA 0.600 25 FPLVVFFIYF 0.540 88 KLKKAFRFIQ 0.540 41 EMESHYVAQA 0.540 65 SLVAGTLSVH 0.450 100 LLGLLKVRPL 0.180 16 NFFLFFFLPF 0.180 128 FMQAAPWEGT 0.150 53 ELLGSSNPPA 0.135 91 KAFRFIQCLL 0.135 76 CACFESFTKR 0.120 105 KVRPLQHQGV 0.090 46 YVAQAGLELL 0.090 29 VFFIYFYFYF 0.090 30 FFIYFYFYFF 0.081 51 GLELLGSSNP 0.060 108 PLQHQGVNSC 0.060 3 RELLAGILLR 0.054 69 GTLSVHHCAC 0.045 99 LLLGLLKVRP 0.045 103 LLKVRPLQHQ 0.045 54 LLGSSNPPAS 0.040 6 LAGILLRITF 0.040 66 LVAGTLSVHH 0.030 79 FESFTKRKKK 0.030 126 GIFMQAAPWE 0.030 122 GYFQGIFMQA 0.027 11 LRITFNFFLF 0.027 95 FIQCLLLGLL 0.027 5 LLAGILLRIT 0.022 37 YFFLEMESHY 0.020 86 KKKLKKAFRF 0.018 33 YFYFYFFLEM 0.018 118 DCERGYFQGI 0.016 72 SVHHCACFES 0.012 21 FFLPFPLVVF 0.010 81 SFTKRKKKLK 0.010 97 QCLLLGLLKV 0.009 90 KKAFRFIQCL 0.008 119 CERGYFQGIF 0.008 112 QGVNSCDCER 0.006 73 VHHCACFESF 0.006 67 VAGTLSVHHC 0.006 113 GVNSCDCERG 0.006 20 FFFLPFPLW 0.006 24 PFPLVVFFIY 0.005 15 FNFFLFFFLP 0.005 48 AQAGLELLGS 0.005 14 TFNFFLFFFL 0.005 19 LFFFLPFPLV 0.005 57 SSNPPASASL 0.005 85 RKKKLKKAFR 0.004 59 NPPASASLVA 0.004 84 KRKKKLKKAF 0.003 64 ASLVAGTLSV 0.003 115 NSCDCERGYF 0.003 94 RFIQCLLLGL 0.003 32 IYFYFYFFLE 0.003 80 ESFTKRKKKL 0.002 78 CFESFTKRKK 0.002 45 HYVAQAGLEL 0.002 36 FYFFLEMESH 0.002 123 YFQGIFMQAA 0.001 62 ASASLVAGTL 0.001 2 RRELLAGILL 0.001 89 LKKAFRFIQC 0.001 92 AFRFIQCLLL 0.001 109 LQHQGVNSCD 0.001 56 GSSNPPASAS 0.001 43 ESHYVAQAGL 0.001 87 KKLKKAFRFI 0.001 114 VNSCDCERGY 0.001 116 SCDCERGYFQ 0.001 111 HQGVNSCDCE 0.001 58 SNPPASASLV 0.001 107 RPLQHQGVNS 0.001 124 FQGIFMQAAP 0.001 38 FFLEMESHYV 0.000 34 FYFYFFLEME 0.000 121 RGYFQGIFMQ 0.000 V10-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 ELGTSDVVTV 0.180 10 GTSDVVTVVL 0.135 7 GELGTSDVVT 0.002 2 GRCPAGELGT 0.001 9 LGTSDVVTVV 0.001 5 PAGELGTSDV 0.000 4 CPAGELGTSD 0.000 6 AGELGTSDVV 0.000 3 RCPAGELGTS 0.000 1 TGRCPAGELG 0.000 V11-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RVMVPPLPSL 0.203 9 VMVPPLPSLN 0.045 4 RLRLRVMVPP 0.045 6 RLRVMVPPLP 0.030 10 MVPPLPSLNP 0.009 5 LRLRVMVPPL 0.003 2 QARLRLRVMV 0.002 1 FQARLRLRVM 0.001 7 LRVMVPPLPS 0.000 3 ARLRLRVMVP 0.000 V12-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 CSYSTLTTVR 0.100 1 SVMSEEPEGC 0.030 3 MSEEPEGCSY 0.030 2 VMSEEPEGCS 0.027 9 GCSYSTLTTV 0.009 6 EPEGCSYSTL 0.003 5 EEPEGCSYST 0.000 4 SEEPEGCSYS 0.000 7 PEGCSYSTLT 0.000 8 EGCSYSTLTT 0.000 11 SYSTLTTVRE 0.000 V13-HLA-A3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 LADPQEDSGK 0.300 8 VLADPQEDSG 0.026 2 SQVTVDVLAD 0.005 3 QVTVDVLADP 0.005 7 DVLADPQEDS 0.003 5 TVDVLADPQE 0.002 4 VTVDVLADPQ 0.002 1 DSQVTVDVLA 0.000 6 VDVLADPQED 0.000 10 ADPQEDSGKQ 0.000 V14-HLA-A3-10mers-191P4D12B Each peptide s a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 SSNPPASASL 0.005 5 NPPASASLVA 0.004 10 ASLVAGTLSV 0.003 8 ASASLVAGTL 0.001 2 GSSNPPASAS 0.001 4 SNPPASASLV 0.001 9 SASLVAGTLS 0.000 1 LGSSNPPASA 0.000 7 PASASLVAGT 0.000 6 PPASASLVAG 0.000

[1028] 24 TABLE XIV Start Subsequence Score V1-HLA-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 41 TVVLGQDAK 3.000 189 GTTSSRSFK 3.000 180 SVTWDTEVK 2.000 365 VVVVVLMSR 1.200 97 RVEQPPPPR 1.200 368 VVLMSRYHR 1.200 61 QVGQVAWAR 0.800 485 FVQENGTLR 0.400 392 LTRENSIRR 0.400 89 HVSPAYEGR 0.400 316 HVSNEFSSR 0.400 369 VLMSRYHRR 0.160 186 EVKGTTSSR 0.120 294 RVDGDTLGF 0.120 20 LLLASFTGR 0.120 77 QELALLHSK 0.090 391 TLTRENSIR 0.080 444 SYSTLTTVR 0.080 435 VMSEEPEGR 0.080 255 DQNLWHIGR 0.072 377 RKAQQMTQK 0.060 292 GVRVDGDTL 0.060 350 VVVVGVIAA 0.060 420 AEGHPDSLK 0.060 243 SFLAEASVR 0.060 370 LMSRYHRRK 0.040 411 QPEESVGLR 0.040 261 IGREGAMLK 0.040 227 HPGLLQDQR 0.040 132 FPAGSFQAR 0.040 459 ELLSPGSGR 0.036 47 DAKLPCFYR 0.036 274 GQPPPSYNW 0.036 42 VVLGQDAKL 0.030 349 SVVVVGVIA 0.030 190 TTSSRSFKH 0.030 366 VVVVLMSRY 0.030 351 VVVGVIAAL 0.030 223 CVVSHPGLL 0.030 498 GNGIYINGR 0.024 386 YEEELTLTR 0.024 206 SEFHLVPSR 0.024 252 GLEDQNLWH 0.024 117 AVQADEGEY 0.020 342 QVDLVSASV 0.020 352 VVGVIAALL 0.020 333 LDPQEDSGK 0.020 306 TTEHSGIYV 0.020 345 LVSASVVVV 0.020 313 YVCHVSNEF 0.020 203 AVTSEFHLV 0.020 415 SVGLRAEGH 0.020 64 QVAWARVDA 0.020 238 HILHVSFLA 0.018 144 RVLVPPLPS 0.018 354 GVIAALLFC 0.018 471 EEDQDEGIK 0.018 45 GQDAKLPCF 0.018 107 PLDGSVLLR 0.016 40 VTVVLGQDA 0.015 390 LTLTRENSI 0.015 165 LTLAASCTA 0.015 75 GAQELALLH 0.012 85 KYGLHVSPA 0.012 358 ALLFCLLVV 0.012 11 GPEAWLLLL 0.012 495 KPTGNGIYI 0.012 486 VQENGTLRA 0.012 15 WLLLLLLLA 0.012 142 RLRVLVPPL 0.012 80 ALLHSKYGL 0.012 477 GIKQAMNHF 0.012 137 FQARLRLRV 0.012 355 VIAALLFCL 0.012 236 ITHILHVSF 0.010 382 MTQKYEEEL 0.010 305 LTTEHSGIY 0.010 287 GPLPSGVRV 0.009 202 AAVTSEFHL 0.009 230 LLQDQRITH 0.008 359 LLFCLLVVV 0.008 276 PPPSYNWTR 0.008 363 LLVVVVVLM 0.006 231 LQDQRITHI 0.006 112 VLLRNAVQA 0.006 410 SQPEESVGL 0.006 419 RAEGHPDSL 0.006 128 RVSTFPAGS 0.006 364 LVVVVVLMS 0.006 378 KAQQMTQKY 0.006 501 IYINGRGHL 0.006 69 RVDAGEGAQ 0.006 362 CLLVVVVVL 0.006 6 GAEMWGPEA 0.006 131 TFPAGSFQA 0.006 357 AALLFCLLV 0.006 17 LLLLLLASF 0.006 493 RAKPTGNGI 0.006 487 QENGTLRAK 0.006 301 GFPPLTTEH 0.006 V2-HLA-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 DAKLPCLYR 0.024 1 GQDAKLPCL 0.018 8 CLYRGDSGE 0.001 9 LYRGDSGEQ 0.000 6 LPCLYRGDS 0.000 2 QDAKLPCLY 0.000 5 KLPCLYRGD 0.000 4 AKLPCLYRG 0.000 7 PCLYRGDSG 0.000 V7-HLA-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 SQSEEPEGR 0.120 3 HTDPRSQSE 0.001 7 RSQSEEPEG 0.000 5 DPRSQSEEP 0.000 4 TDPRSQSEE 0.000 2 HHTDPRSQS 0.000 6 PRSQSEEPE 0.000 1 SHHTDPRSQ 0.000 V9-HLA-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 113 GVNSCDCER 1.200 76 CACFESFTK 0.600 97 QCLLLGLLK 0.600 82 FTKRKKKLK 0.500 28 VVFFIYFYF 0.120 78 CFESFTKRK 0.100 77 ACFESFTKR 0.080 4 ELLAGILLR 0.072 27 LVVFFIYFY 0.060 99 LLLGLLKVR 0.060 69 GTLSVHHCA 0.045 83 TKRKKKLKK 0.040 13 ITFNFFLFF 0.040 46 YVAQAGLEL 0.040 12 RITFNFFLF 0.036 126 GIFMQAAPW 0.024 32 IYFYFYFFL 0.024 66 LVAGTLSVH 0.020 9 ILLRITFNF 0.018 34 FYFYFFLEM 0.016 31 FIYFYFYFF 0.016 86 KKKLKKAFR 0.012 19 LFFFLPFPL 0.012 98 CLLLGLLKV 0.012 91 KAFRFIQCL 0.012 65 SLVAGTLSV 0.012 30 FFIYFYFYF 0.009 25 FPLVVFFIY 0.009 103 LLKVRPLQH 0.008 5 LLAGILLRI 0.008 95 FIQCLLLGL 0.008 29 VFFIYFYFY 0.008 122 GYFQGIFMQ 0.007 21 FFLPFPLVV 0.006 14 TFNFFLFFF 0.006 96 IQCLLLGLL 0.006 80 ESFTKRKKK 0.006 17 FFLFFFLPF 0.006 124 FQGIFMQAA 0.006 79 FESFTKRKK 0.006 105 KVRPLQHQG 0.006 3 RELLAGILL 0.005 37 YFFLEMESH 0.004 123 YFQGIFMQA 0.004 39 FLEMESHYV 0.004 10 LLRITFNFF 0.004 23 LPFPLVVFF 0.004 20 FFFLPFPLV 0.004 54 LLGSSNPPA 0.004 22 FLPFPLVVF 0.004 38 FFLEMESHY 0.003 87 KKLKKAFRF 0.003 15 FNFFLFFFL 0.002 121 RGYFQGIFM 0.002 40 LEMESHYVA 0.002 47 VAQAGLELL 0.002 92 AFRFIQCLL 0.002 116 SCDCERGYF 0.002 67 VAGTLSVHH 0.002 72 SVHHCACFE 0.002 59 NPPASASLV 0.002 63 SASLVAGTL 0.002 102 GLLKVRPLQ 0.002 94 RFIQCLLLG 0.002 8 GILLRITFN 0.002 36 FYFFLEMES 0.002 26 PLVVFFIYF 0.001 33 YFYFYFFLE 0.001 48 AQAGLELLG 0.001 88 KLKKAFRFI 0.001 16 NFFLFFFLP 0.001 51 GLELLGSSN 0.001 81 SFTKRKKKL 0.001 11 LRITFNFFL 0.001 107 RPLQHQGVN 0.001 128 FMQAAPWEG 0.001 18 FLFFFLPFP 0.001 93 FRFIQCLLL 0.001 2 RRELLAGIL 0.001 24 PFPLVVFFI 0.001 109 LQHQGVNSC 0.001 129 MQAAPWEGT 0.001 111 HQGVNSCDC 0.001 7 AGILLRITF 0.001 56 GSSNPPASA 0.001 45 HYVAQAGLE 0.001 119 CERGYFQGI 0.001 42 MESHYVAQA 0.001 44 SHYVAQAGL 0.000 100 LLGLLKVRP 0.000 70 TLSVHHCAC 0.000 35 YFYFFLEME 0.000 49 QAGLELLGS 0.000 127 IFMQAAPWE 0.000 58 SNPPASASL 0.000 60 PPASASLVA 0.000 71 LSVHHCACF 0.000 85 RKKKLKKAF 0.000 84 KRKKKLKKA 0.000 1 MRRELLAGI 0.000 V10-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 GTSDVVTVV 0.030 6 GELGTSDVV 0.003 2 RCPAGELGT 0.001 8 LGTSDVVTV 0.000 5 AGELGTSDV 0.000 3 CPAGELGTS 0.000 7 ELGTSDVVT 0.000 1 GRCPAGELG 0.000 4 PAGELGTSD 0.000 V11-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified,the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 RVMVPPLPS 0.024 5 RLRVMVPPL 0.012 8 VMVPPLPSL 0.006 3 RLRLRVMVP 0.002 9 MVPPLPSLN 0.002 2 ARLRLRVMV 0.000 1 QARLRLRVM 0.000 4 LRLRVMVPP 0.000 6 LRVMVPPLP 0.000 V12-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified,the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 GCSYSTLTT 0.001 3 SEEPEGCSY 0.001 9 CSYSTLTTV 0.000 1 VMSEEPEGC 0.000 5 EPEGCSYST 0.000 6 PEGCSYSTL 0.000 2 MSEEPEGCS 0.000 4 EEPEGCSYS 0.000 7 EGCSYSTLT 0.000 V13-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 ADPQEDSGK 0.020 1 SQVTVDVLA 0.009 2 QVTVDVLAD 0.004 4 TVDVLADPQ 0.002 3 VTVDVLADP 0.002 6 DVLADPQED 0.001 7 VLADPQEDS 0.000 8 LADPQEDSG 0.000 5 VDVLADPQE 0.000 V14-A1101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 SASLVAGTL 0.002 4 NPPASASLV 0.002 1 GSSNPPASA 0.001 5 PPASASLVA 0.000 3 SNPPASASL 0.000 9 ASLVAGTLS 0.000 7 ASASLVAGT 0.000 2 SSNPPASAS 0.000 6 PASASLVAG 0.000

[1029] 25 TABLE XV Start Subsequence Score V1-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 40 VTVVLGQDAK 1.500 364 LVVVVVLMSR 1.200 367 VVVLMSRYHR 1.200 260 HIGREGAMLK 0.800 434 SVMSEEPEGR 0.800 76 AQELALLHSK 0.600 419 RAEGHPDSLK 0.600 368 VVLMSRYHRR 0.600 385 KYEEELTLTR 0.480 332 VLDPQEDSGK 0.400 390 LTLTRENSIR 0.300 354 GVIAALLFCL 0.270 400 RLHSHHTDPR 0.240 391 TLTRENSIRR 0.160 19 LLLLASFTGR 0.120 106 NPLDGSVLLR 0.120 410 SQPEESVGLR 0.120 60 EQVGQVAWAR 0.108 189 GTTSSRSFKH 0.090 144 RVLVPPLPSL 0.090 369 VLMSRYHRRK 0.080 275 QPPPSYNWTR 0.080 486 VQENGTLRAK 0.060 188 KGTTSSRSFK 0.060 376 RRKAQQMTQK 0.060 349 SVVVVGVIAA 0.060 128 RVSTFPAGSF 0.060 484 HFVQENGTLR 0.060 130 STFPAGSFQA 0.060 119 QADEGEYECR 0.040 352 VVGVIAALLF 0.040 485 FVQENGTLRA 0.040 131 TFPAGSFQAR 0.040 229 GLLQDQRITH 0.036 41 TVVLGQDAKL 0.030 365 VVVVVLMSRY 0.030 350 VVVVGVIAAL 0.030 111 SVLLRNAVQA 0.030 351 VVVGVIAALL 0.030 63 GQVAWARVDA 0.027 341 KQVDLVSASV 0.027 443 RSYSTLTTVR 0.024 500 GIYINGRGHL 0.024 252 GLEDQNLWHI 0.024 342 QVDLVSASVV 0.020 61 QVGQVAWARV 0.020 249 SVRGLEDQNL 0.020 305 LTTEHSGIYV 0.020 241 HVSFLAEASV 0.020 89 HVSPAYEGRV 0.020 39 VVTVVLGQDA 0.020 96 GRVEQPPPPR 0.018 470 EEEDQDEGIK 0.018 185 TEVKGTTSSR 0.018 218 GQPLTCVVSH 0.018 458 TELLSPGSGR 0.018 45 GQDAKLPCFY 0.018 46 QDAKLPCFYR 0.012 11 GPEAWLLLLL 0.012 477 GIKQAMNHFV 0.012 235 RITHILHVSF 0.012 164 GLTLAASCTA 0.012 85 KYGLHVSPAY 0.012 383 TQKYEEELTL 0.012 284 RLDGPLPSGV 0.012 373 RYHRRKAQQM 0.012 25 FTGRCPAGEL 0.010 221 LTCVVSHPGL 0.010 236 ITHILHVSFL 0.010 359 LLFCLLVVVV 0.008 242 VSFLAEASVR 0.008 158 ALEEGQGLTL 0.008 257 NLWHIGREGA 0.008 81 LLHSKYGLHV 0.008 315 CHVSNEFSSR 0.006 88 LHVSPAYEGR 0.006 156 GPALEEGQGL 0.006 358 ALLFCLLVVV 0.006 501 IYINGRGHLV 0.006 201 SAAVTSEFHL 0.006 79 LALLHSKYGL 0.006 80 ALLHSKYGLH 0.006 231 LQDQRITHIL 0.006 493 RAKPTGNGIY 0.006 357 AALLFCLLVV 0.006 97 RVEQPPPPRN 0.006 362 CLLVVVVVLM 0.006 294 RVDGDTLGFP 0.006 16 LLLLLLLASF 0.006 312 IYVCHVSNEF 0.006 69 RVDAGEGAQE 0.006 6 GAEMWGPEAW 0.006 292 GVRVDGDTLG 0.006 223 CVVSHPGLLQ 0.006 8 EMWGPEAWLL 0.005 490 GTLRAKPTGN 0.005 239 ILHVSFLAEA 0.004 426 SLKDNSSCSV 0.004 411 QPEESVGLRA 0.004 146 LVPPLPSLNP 0.004 V2-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 GQDAKLPCLY 0.018 3 QDAKLPCLYR 0.008 10 LYRGDSGEQV 0.004 6 KLPCLYRGDS 0.001 9 CLYRGDSGEQ 0.001 7 LPCLYRGDSG 0.000 1 LGQDAKLPCL 0.000 4 DAKLPCLYRG 0.000 8 PCLYRGDSGE 0.000 5 AKLPCLYRGD 0.000 V7-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RSQSEEPEGR 0.012 4 HTDPRSQSEE 0.001 9 SQSEEPEGRS 0.001 6 DPRSQSEEPE 0.000 5 TDPRSQSEEP 0.000 3 HHTDPRSQSE 0.000 2 SHHTDPRSQS 0.000 7 PRSQSEEPEG 0.000 1 HSHHTDPRSQ 0.000 V9-HLA-A1101- 10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 82 FTKRKKKLKK 2.000 96 IQCLLLGLLK 1.200 75 HCACFESFTK 0.600 77 ACFESFTKRK 0.200 3 RELLAGILLR 0.108 81 SFTKRKKKLK 0.100 27 LVVFFIYFYF 0.090 28 VVFFIYFYFY 0.080 98 CLLLGLLKVR 0.060 105 KVRPLQHQGV 0.060 13 ITFNFFLFFF 0.060 8 GILLRITFNF 0.054 122 GYFQGIFMQA 0.048 76 CACFESFTKR 0.040 102 GLLKVRPLQH 0.036 79 FESFTKRKKK 0.030 12 RITFNFFLFF 0.024 31 FIYFYFYFFL 0.024 18 FLFFFLPFPL 0.024 46 YVAQAGLELL 0.020 78 CFESFTKRKK 0.020 66 LVAGTLSVHH 0.020 94 RFIQCLLLGL 0.018 85 RKKKLKKAFR 0.012 91 KAFRFIQCLL 0.012 29 VFFIYFYFYF 0.012 10 LLRITFNFFL 0.012 45 HYVAQAGLEL 0.012 23 LPFPLVVFFI 0.012 20 FFFLPFPLVV 0.008 16 NFFLFFFLPF 0.008 33 YFYFYFFLEM 0.008 36 FYFFLEMESH 0.008 39 FLEMESHYVA 0.008 112 QGVNSCDCER 0.006 9 LLRITFNFF 0.006 72 SVHHCACFES 0.006 65 SLVAGTLSVH 0.006 25 FPLVVFFIYF 0.006 113 GVNSCDCERG 0.006 30 FFIYFYFYFF 0.006 97 QCLLLGLLKV 0.006 14 TFNFFLFFFL 0.006 69 GTLSVHHCAC 0.005 6 LAGILLRITF 0.004 37 YFFLEMESHY 0.004 59 NPPASASLVA 0.004 22 FLPFPLVVFF 0.004 19 LFFFLPFPLV 0.004 70 TLSVHHCACF 0.004 92 AFRFIQCLLL 0.004 95 FIQCLLLGLL 0.004 88 KLKKAFRFIQ 0.004 4 ELLAGILLRI 0.004 21 FFLPFPLVVF 0.003 38 FFLEMESHYV 0.003 32 IYFYFYFFLE 0.002 126 GIFMQAAPWE 0.002 123 YFQGIFMQAA 0.002 86 KKKLKKAFRF 0.002 53 ELLGSSNPPA 0.002 51 GLELLGSSNP 0.001 2 RRELLAGILL 0.001 48 AQAGLELLGS 0.001 26 PLVVFFIYFY 0.001 41 EMESHYVAQA 0.001 11 LRITFNFFLF 0.001 107 RPLQHQGVNS 0.001 34 FYFYFFLEME 0.001 127 IFMQAAPWEG 0.001 35 YFYFFLEMES 0.001 24 PFPLVVFFIY 0.001 64 ASLVAGTLSV 0.001 99 LLLGLLKVRP 0.001 90 KKAFRFIQCL 0.001 111 HQGVNSCDCE 0.001 124 FQGIFMQAAP 0.001 109 LQHQGVNSCD 0.001 119 CERGYFQGIF 0.001 118 DCERGYFQGI 0.001 128 FMQAAPWEGT 0.000 116 SCDCERGYFQ 0.000 47 VAQAGLELLG 0.000 54 LLGSSNPPAS 0.000 100 LLGLLKVRPL 0.000 58 SNPPASASLV 0.000 103 LLKVRPLQHQ 0.000 121 RGYFQGIFMQ 0.000 125 QGIFMQAAPW 0.000 84 KRKKKLKKAF 0.000 17 FFLFFFLPFP 0.000 15 FNFFLFFFLP 0.000 115 NSCDCERGYF 0.000 63 SASLVAGTLS 0.000 68 AGTLSVHHCA 0.000 73 VHHCACFESF 0.000 49 QAGLELLGSS 0.000 1 MRRELLAGIL 0.000 67 VAGTLSVHHC 0.000 62 ASASLVAGTL 0.000 V10-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified,the length of peptide is 10 amino acids and the end position for each peptide is the start position plus nine. 10 GTSDVVTVVL 0.030 8 ELGTSDVVTV 0.001 3 RCPAGELGTS 0.001 7 GELGTSDVVT 0.000 9 LGTSDVVTVV 0.000 6 AGELGTSDVV 0.000 4 CPAGELGTSD 0.000 5 PAGELGTSDV 0.000 2 GRCPAGELGT 0.000 1 TGRCPAGELG 0.000 V11-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified,the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RVMVPPLPSL 0.120 10 MVPPLPSLNP 0.004 2 QARLRLRVMV 0.002 6 RLRVMVPPLP 0.001 4 RLRLRVMVPP 0.001 9 VMVPPLPSLN 0.001 1 FQARLRLRVM 0.001 5 LRLRVMVPPL 0.000 3 ARLRLRVMVP 0.000 7 LRVMVPPLPS 0.000 V12-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids and the end position for each peptide is the start position plus nine. 10 CSYSTLTTVR 0.008 9 GCSYSTLTTV 0.006 1 SVMSEEPEGC 0.004 6 EPEGCSYSTL 0.001 11 SYSTLTTVRE 0.000 2 VMSEEPEGCS 0.000 3 MSEEPEGCSY 0.000 4 SEEPEGCSYS 0.000 5 EEPEGCSYST 0.000 8 EGCSYSTLTT 0.000 7 PEGCSYSTLT 0.000 V13-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 LADPQEDSGK 0.200 5 TVDVLADPQE 0.002 3 QVTVDVLADP 0.002 2 SQVTVDVLAD 0.002 4 VTVDVLADPQ 0.002 7 DVLADPQEDS 0.001 8 VLADPQEDSG 0.000 1 DSQVTVDVLA 0.000 6 VDVLADPQED 0.000 10 ADPQEDSGKQ 0.000 V14-HLA-A1101-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids and the end position for each peptide is the start position plus nine. 5 NPPASASLVA 0.004 10 ASLVAGTLSV 0.001 4 SNPPASASLV 0.000 8 ASASLVAGTL 0.000 9 SASLVAGTLS 0.000 1 LGSSNPPASA 0.000 3 SSNPPASASL 0.000 2 GSSNPPASAS 0.000 6 PPASASLVAG 0.000 7 PASASLVAGT 0.000

[1030] 26 TABLE XVI Start Subsequence Score V1-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids and the end position for each peptide is the start position plus eight. 501 IYINGRGHL 300.000 124 EYECRVSTF 150.000 484 HFVQENGTL 30.000 385 KYEEELTLT 18.000 105 RNPLDGSVL 12.000 419 RAEGHPDSL 12.000 85 KYGLHVSPA 10.000 142 RLRVLVPPL 9.600 100 QPPPPRNPL 8.640 362 CLLVVVVVL 8.400 351 VVVGVIAAL 8.400 14 AWLLLLLLL 7.200 410 SQPEESVGL 7.200 145 VLVPPLPSL 7.200 106 NPLDGSVLL 7.200 10 WGPEAWLLL 7.200 42 VVLGQDAKL 6.600 382 MTQKYEEEL 6.600 71 DAGEGAQEL 6.336 200 RSAAVTSEF 6.160 222 TCVVSHPGL 6.000 223 CVVSHPGLL 6.000 325 DSQVTVDVL 6.000 453 EIETQTELL 6.000 80 ALLHSKYGL 6.000 202 AAVTSEFHL 6.000 11 GPEAWLLLL 6.000 245 LAEASVRGL 6.000 356 IAALLFCLL 5.760 352 VVGVIAALL 5.600 36 TSDVVTVVL 5.600 281 NWTRLDGPL 4.800 13 EAWLLLLLL 4.800 355 VIAALLFCL 4.800 9 MWGPEAWLL 4.800 26 TGRCPAGEL 4.400 8 EMWGPEAWL 4.000 294 RVDGDTLGF 4.000 135 GSFQARLRL 4.000 138 QARLRLRVL 4.000 292 GVRVDGDTL 4.000 260 HIGREGAML 4.000 74 EGAQELALL 4.000 188 KGTTSSRSF 4.000 313 YVCHVSNEF 3.696 17 LLLLLLASF 3.600 353 VGVIAALLF 3.000 493 RAKPTGNGI 2.880 236 ITHILHVSF 2.400 477 GIKQAMNHF 2.400 348 ASVVVVGVI 2.100 45 GQDAKLPCF 2.000 129 VSTFPAGSF 2.000 495 KPTGNGIYI 2.000 390 LTLTRENSI 1.800 446 STLTTVREI 1.650 452 REIETQTEL 1.584 363 LLVVVVVLM 1.050 231 LQDQRITHI 1.000 373 RYHRRKAQQ 1.000 1 MPLSLGAEM 0.990 157 PALEEGQGL 0.864 232 QDQRITHIL 0.840 263 REGAMLKCL 0.800 93 AYEGRVEQP 0.750 312 IYVCHVSNE 0.750 279 SYNWTRLDG 0.750 131 TFPAGSFQA 0.750 207 EFHLVPSRS 0.700 360 LFCLLVVVV 0.600 151 PSLNPGPAL 0.600 444 SYSTLTTVR 0.600 393 TRENSIRRL 0.600 159 LEEGQGLTL 0.600 237 THILHVSFL 0.600 53 FYRGDSGEQ 0.550 320 EFSSRDSQV 0.500 195 SFKHSRSAA 0.500 213 SRSMNGQPL 0.480 297 GDTLGFPPL 0.480 250 VRGLEDQNL 0.480 384 QKYEEELTL 0.480 251 RGLEDQNLW 0.432 341 KQVDLVSAS 0.432 73 GEGAQELAL 0.400 277 PPSYNWTRL 0.400 337 EDSGKQVDL 0.400 133 PAGSFQARL 0.400 378 KAQQMTQKY 0.396 28 RCPAGELET 0.330 144 RVLVPPLPS 0.300 214 RSMNGQPLT 0.300 235 RITHILHVS 0.280 58 SGEQVGQVA 0.252 146 LVPPLPSLN 0.216 110 GSVLLRNAV 0.216 217 NGQPLTCVV 0.216 275 QPPPSYNWT 0.216 40 VTVVLGQDA 0.216 349 SVVVVGVIA 0.210 V2-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 GQDAKLPCL 4.000 9 LYRGDSGEQ 0.550 6 LPCLYRGDS 0.100 5 KLPCLYRGD 0.036 2 QDAKLPCLY 0.012 8 CLYRGDSGE 0.010 3 DAKLPCLYR 0.010 4 AKLPCLYRG 0.002 7 PCLYRGDSG 0.002 V7-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 RSQSEEPEG 0.033 3 HTDPRSQSE 0.014 8 SQSEEPEGR 0.012 2 HHTDPRSQS 0.012 5 DPRSQSEEP 0.011 4 TDPRSQSEE 0.002 1 SHHTDPRSQ 0.001 6 PRSQSEEPE 0.000 V9-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 32 IYFYFYFFL 200.000 34 FYFYFFLEM 33.000 92 AFRFIQCLL 28.000 19 LFFFLPFPL 24.000 81 SFTKRKKKL 22.000 17 FFLFFFLPF 18.000 30 FFIYFYFYF 15.000 14 TFNFFLFFF 15.000 91 KAFRFIQCL 9.600 95 FIQCLLLGL 7.200 58 SNPPASASL 7.200 36 FYFFLEMES 6.600 47 VAQAGLELL 6.000 101 LGLLKVRPL 6.000 15 FNFFLFFFL 5.760 63 SASLVAGTL 5.600 96 IQCLLLGLL 4.800 12 RITFNFFLF 4.800 46 YVAQAGLEL 4.400 9 ILLRITFNF 4.200 7 AGILLRITF 3.600 22 FLPFPLVVF 3.000 71 LSVHHCACF 3.000 10 LLRITFNFF 2.880 23 LPFPLVVFF 2.880 28 VVFFIYFYF 2.800 31 FIYFYFYFF 2.400 13 ITFNFFLFF 2.400 88 KLKKAFRFI 2.400 116 SCDCERGYF 2.000 2 RRELLAGIL 1.440 5 LLAGILLRI 1.400 123 YFQGIFMQA 1.260 3 RELLAGILL 1.200 24 PFPLVVFFI 1.050 121 RGYFQGIFM 1.000 38 FFLEMESHY 0.900 21 FFLPFPLVV 0.900 45 HYVAQAGLE 0.750 11 LRITFNFFL 0.600 20 FFFLPFPLV 0.600 29 VFFIYFYFY 0.600 87 KKLKKAFRF 0.600 122 GYFQGIFMQ 0.500 85 RKKKLKKAF 0.480 44 SHYVAQAGL 0.400 93 FRFIQCLLL 0.400 26 PLVVFFIYF 0.360 107 RPLQHQGVN 0.300 25 FPLVVFFIY 0.252 74 HHCACFESF 0.240 50 AGLELLGSS 0.216 69 GTLSVHHCA 0.210 120 ERGYFQGIF 0.200 51 GLELLGSSN 0.180 57 SSNPPASAS 0.180 98 CLLLGLLKV 0.165 94 RFIQCLLLG 0.150 39 FLEMESHYV 0.150 59 NPPASASLV 0.150 64 ASLVAGTLS 0.150 65 SLVAGTLSV 0.150 27 LVVFFIYFY 0.150 8 GILLRITFN 0.150 119 CERGYFQGI 0.144 1 MRRELLAGI 0.144 62 ASASLVAGT 0.120 124 FQGIFMQAA 0.120 6 LAGILLRIT 0.120 109 LQHQGVNSC 0.120 115 NSCDCERGY 0.120 56 GSSNPPASA 0.100 55 LGSSNPPAS 0.100 49 QAGLELLGS 0.100 129 MQAAPWEGT 0.100 111 HQGVNSCDC 0.100 126 GIFMQAAPW 0.100 68 AGTLSVHHC 0.100 75 HCACFESFT 0.100 70 TLSVHHCAC 0.100 54 LLGSSNPPA 0.100 127 IFMQAAPWE 0.075 78 CFESFTKRK 0.075 33 YFYFYFFLE 0.060 16 NFFLFFFLP 0.060 37 YFFLEMESH 0.050 35 YFYFFLEME 0.050 105 KVRPLQHQG 0.029 90 KKAFRFIQC 0.024 84 KRKKKLKKA 0.022 102 GLLKVRPLQ 0.021 106 VRPLQHQGV 0.018 40 LEMESHYVA 0.018 99 LLLGLLKVR 0.018 97 QCLLLGLLK 0.018 53 ELLGSSNPP 0.018 43 ESHYVAQAG 0.017 128 FMQAAPWEG 0.017 113 GVNSCDCER 0.017 77 ACFESFTKR 0.016 V10-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 RCPAGELGT 0.300 9 GTSDVVTVV 0.168 5 AGELGTSDV 0.150 7 ELGTSDVVT 0.100 8 LGTSDVVTV 0.100 3 CPAGELGTS 0.100 6 GELGTSDVV 0.015 4 PAGELGTSD 0.001 1 GRCPAGELG 0.001 V11-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 RLRVMVPPL 8.000 8 VMVPPLPSL 7.200 1 QARLRLRVM 0.500 7 RVMVPPLPS 0.300 9 MVPPLPSLN 0.216 3 RLRLRVMVP 0.020 2 ARLRLRVMV 0.018 6 LRVMVPPLP 0.002 4 LRLRVMVPP 0.002 V12-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 MSEEPEGCS 0.180 5 EPEGCSYST 0.150 1 VMSEEPEGC 0.120 9 CSYSTLTTV 0.100 7 EGCSYSTLT 0.100 8 GCSYSTLTT 0.100 6 PEGCSYSTL 0.040 3 SEEPEGCSY 0.018 4 EEPEGCSYS 0.018 V13-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 SQVTVDVLA 0.210 7 VLADPQEDS 0.120 3 VTVDVLADP 0.025 6 DVLADPQED 0.020 8 LADPQEDSG 0.012 4 TVDVLADPQ 0.012 2 QVTVDVLAD 0.010 9 ADPQEDSGK 0.002 5 VDVLADPQE 0.002 V14-HLA-A24-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified; the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 SNPPASASL 7.200 8 SASLVAGTL 5.600 2 SSNPPASAS 0.180 9 ASLVAGTLS 0.150 4 NPPASASLV 0.150 7 ASASLVAGT 0.120 1 GSSNPPASA 0.100 5 PPASASLVA 0.010 6 PASASLVAG 0.001

[1031] 27 TABLE XVII Start Subsequence Score V1-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 312 IYVCHVSNEF 277.200 373 RYHRRKAQQM 60.000 409 RSQPEESVGL 14.400 85 KYGLHVSPAY 14.000 144 RVLVPPLPSL 12.000 105 RNPLDGSVLL 12.000 99 EQPPPPRNPL 8.640 351 VVVGVIAALL 8.400 361 FCLLVVVVVL 8.400 350 VVVVGVIAAL 8.400 501 IYINGRGHLV 7.500 158 ALEEGQGLTL 7.200 11 GPEAWLLLLL 7.200 10 WGPEAWLLLL 7.200 354 GVIAALLFCL 7.200 35 ETSDVVTVVL 6.720 41 TVVLGQDAKL 6.600 291 SGVRVDGDTL 6.000 79 LALLHSKYGL 6.000 439 EPEGRSYSTL 6.000 72 AGEGAQELAL 6.000 222 TCVVSHPGLL 6.000 355 VIAALLFCLL 5.760 231 LQDQRITHIL 5.600 53 FYRGDSGEQV 5.000 249 SVRGLEDQNL 4.800 244 FLAEASVRGL 4.800 13 EAWLLLLLLL 4.800 392 LTRENSIRRL 4.800 280 YNWTRLDGPL 4.800 235 RITHILHVSF 4.800 9 MWGPEAWLLL 4.800 296 DGDTLGFPPL 4.800 156 GPALEEGQGL 4.800 25 FTGRCPAGEL 4.400 381 QMTQKYEEEL 4.400 132 FPAGSFQARL 4.000 236 ITHILHVSFL 4.000 221 LTCVVSHPGL 4.000 128 RVSTFPAGSF 4.000 137 FQARLRLRVL 4.000 201 SAAVTSEFHL 4.000 134 AGSFQARLRL 4.000 500 GIYINGRGHL 4.000 8 EMWGPEAWLL 4.000 383 TQKYEEELTL 4.000 150 LPSLNPGPAL 4.000 16 LLLLLLLASF 3.600 44 LGQDAKLPCF 3.600 476 EGIKQAMNHF 3.600 207 EFHLVPSRSM 2.500 385 KYEEELTLTR 2.160 352 VVGVIAALLF 2.000 252 GLEDQNLWHI 1.800 230 LLQDQRITHI 1.800 452 REIETQTELL 1.440 347 SASVVVVGVI 1.400 93 AYEGRVEQPP 1.260 389 ELTLTRENSI 1.200 227 HPGLLQDQRI 1.200 445 YSTLTTVREI 1.100 124 EYECRVSTFP 1.050 362 CLLVVVVVLM 1.050 473 DQDEGIKQAM 1.008 301 GFPPLTTEHS 0.900 136 SFQARLRLRV 0.900 324 RDSQVTVDVL 0.800 279 SYNWTRLDGP 0.750 141 LRLRVLVPPL 0.720 360 LFCLLVVVVV 0.700 451 VREIETQTEL 0.660 262 GREGAMLKCL 0.600 259 WHIGREGAML 0.600 320 EFSSRDSQVT 0.600 276 PPPSYNWTRL 0.600 7 AEMWGPEAWL 0.600 70 VDAGEGAQEL 0.528 341 KQVDLVSASV 0.504 258 LWHIGREGAM 0.500 195 SFKHSRSAAV 0.500 444 SYSTLTTVRE 0.500 418 LRAEGHPDSL 0.480 212 PSRSMNGQPL 0.480 336 QEDSGKQVDL 0.400 483 NHFVQENGTL 0.400 73 GEGAQELALL 0.400 293 VRVDGDTLGF 0.360 199 SRSAAVTSEF 0.308 97 RVEQPPPPRN 0.300 214 RSMNGQPLTC 0.300 28 RCPAGELETS 0.300 49 KLPCFYRGDS 0.300 411 QPEESVGLRA 0.252 284 RLDGPLPSGV 0.240 493 RAKPTGNGIY 0.240 123 GEYECRVSTF 0.240 145 VLVPPLPSLN 0.216 274 GQPPPSYNWT 0.216 363 LLVVVVVLMS 0.210 348 ASVVVVGVIA 0.210 V2-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 LGQDAKLPCL 7.200 10 LYRGDSGEQV 5.000 6 KLPCLYRGDS 0.300 2 GQDAKLPCLY 0.120 9 CLYRGDSGEQ 0.011 7 LPCLYRGDSG 0.010 4 DAKLPCLYRG 0.010 5 AKLPCLYRGD 0.002 8 PCLYRGDSGE 0.002 3 QDAKLPCLYR 0.001 V7-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 SQSEEPEGRS 0.120 8 RSQSEEPEGR 0.030 4 HTDPRSQSEE 0.013 6 DPRSQSEEPE 0.010 1 HSHHTDPRSQ 0.010 2 SHHTDPRSQS 0.010 5 TDPRSQSEEP 0.002 3 HHTDPRSQSE 0.001 7 PRSQSEEPEG 0.000 V9-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 45 HYVAQAGLEL 330.000 94 RFIQCLLLGL 72.000 14 TFNFFLFFFL 43.200 92 AFRFIQCLLL 20.000 30 FFIYFYFYFF 18.000 21 FFLPFPLVVF 18.000 16 NFFLFFFLPF 12.000 91 KAFRFIQCLL 11.200 29 VFFIYFYFYF 10.000 122 GYFQGIFMQA 8.400 57 SSNPPASASL 7.200 95 FIQCLLLGLL 7.200 62 ASASLVAGTL 5.600 12 RITFNFFLFF 4.800 18 FLFFFLPFPL 4.800 80 ESFTKRKKKL 4.400 9 ILLRITFNFF 4.320 8 GILLRITFNF 4.200 27 LVVFFIYFYF 4.200 31 FIYFYFYFFL 4.000 10 LLRITFNFFL 4.000 46 YVAQAGLELL 4.000 100 LLGLLKVRPL 4.000 43 ESHYVAQAGL 4.000 25 FPLVVFFIYF 3.600 22 FLPFPLVVFF 3.600 33 YFYFYFFLEM 3.300 115 NSCDCERGYF 2.400 6 LAGILLRITF 2.400 118 DCERGYFQGI 2.160 4 ELLAGILLRI 2.100 13 ITFNFFLFFF 2.000 70 TLSVHHCACF 2.000 23 LPFPLVVFFI 1.680 2 RRELLAGILL 1.200 90 KKAFRFIQCL 0.960 123 YFQGIFMQAA 0.900 38 FFLEMESHYV 0.900 35 YFYFFLEMES 0.660 32 IYFYFYFFLE 0.600 19 LFFFLPFPLV 0.600 1 MRRELLAGIL 0.576 34 FYFYFFLEME 0.500 37 YFFLEMESHY 0.500 20 FFFLPFPLVV 0.500 36 FYFFLEMESH 0.500 84 KRKKKLKKAF 0.480 86 KKKLKKAFRF 0.400 11 LRITFNFFLF 0.360 87 KKLKKAFRFI 0.360 107 RPLQHQGVNS 0.300 105 KVRPLQHQGV 0.288 73 VHHCACFESF 0.240 50 AGLELLGSSN 0.216 119 CERGYFQGIF 0.200 58 SNPPASASLV 0.180 97 QCLLLGLLKV 0.165 53 ELLGSSNPPA 0.150 64 ASLVAGTLSV 0.150 39 FLEMESHYVA 0.150 128 FMQAAPWEGT 0.150 125 QGIFMQAAPW 0.150 59 NPPASASLVA 0.150 69 GTLSVHHCAC 0.150 7 AGILLRITFN 0.150 41 EMESHYVAQA 0.150 68 AGTLSVHHCA 0.140 24 PFPLVVFFIY 0.126 28 VVFFIYFYFY 0.120 49 QAGLELLGSS 0.120 5 LLAGILLRIT 0.120 72 SVHHCACFES 0.110 55 LGSSNPPASA 0.100 114 VNSCDCERGY 0.100 54 LLGSSNPPAS 0.100 48 AQAGLELLGS 0.100 56 GSSNPPASAS 0.100 63 SASLVAGTLS 0.100 67 VAGTLSVHHC 0.100 78 CFESFTKRKK 0.083 127 IFMQAAPWEG 0.083 17 FFLFFFLPFP 0.075 120 ERGYFQGIFM 0.050 81 SFTKRKKKLK 0.050 101 LGLLKVRPLQ 0.021 121 RGYFQGIFMQ 0.020 88 KLKKAFRFIQ 0.020 108 PLQHQGVNSC 0.018 99 LLLGLLKVRP 0.018 98 CLLLGLLKVR 0.018 47 VAQAGLELLG 0.018 112 QGVNSCDCER 0.017 51 GLELLGSSNP 0.015 110 QHQGVNSCDC 0.015 26 PLVVFFIYFY 0.015 102 GLLKVRPLQH 0.015 71 LSVHHCACFE 0.015 106 VRPLQHQGVN 0.015 65 SLVAGTLSVH 0.015 113 GVNSCDCERG 0.015 V10-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 GTSDVVTVVL 6.720 3 RCPAGELGTS 0.300 6 AGELGTSDVV 0.150 9 LGTSDVVTVV 0.140 8 ELGTSDVVTV 0.100 7 GELGTSDVVT 0.015 4 CPAGELGTSD 0.012 5 PAGELGTSDV 0.012 2 GRCPAGELGT 0.012 1 TGRCPAGELG 0.010 V11-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RVMVPPLPSL 12.000 5 LRLRVMVPPL 0.600 1 FQARLRLRVM 0.500 9 VMVPPLPSLN 0.216 2 QARLRLRVMV 0.120 6 RLRVMVPPLP 0.028 4 RLRLRVMVPP 0.028 10 MVPPLPSLNP 0.018 7 LRVMVPPLPS 0.015 3 ARLRLRVMVP 0.002 V12-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 EPEGCSYSTL 6.000 11 SYSTLTTVRE 0.500 3 MSEEPEGCSY 0.180 1 SVMSEEPEGC 0.150 2 VMSEEPEGCS 0.120 8 EGCSYSTLTT 0.100 9 GCSYSTLTTV 0.100 5 EEPEGCSYST 0.018 4 SEEPEGCSYS 0.018 10 CSYSTLTTVR 0.012 7 PEGCSYSTLT 0.001 V13-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 DSQVTVDVLA 0.210 7 DVLADPQEDS 0.150 4 VTVDVLADPQ 0.022 2 SQVTVDVLAD 0.015 3 QVTVDVLADP 0.014 8 VLADPQEDSG 0.012 9 LADPQEDSGK 0.012 5 TVDVLADPQE 0.010 6 VDVLADPQED 0.002 10 ADPQEDSGKQ 0.002 V14-HLA-A24-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 SSNPPASASL 7.200 8 ASASLVAGTL 5.600 4 SNPPASASLV 0.180 10 ASLVAGTLSV 0.150 5 NPPASASLVA 0.150 9 SASLVAGTLS 0.100 1 LGSSNPPASA 0.100 2 GSSNPPASAS 0.100 7 PASASLVAGT 0.012 6 PPASASLVAG 0.001

[1032] 28 TABLE XVIII Start Subsequence Score V1-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 292 GVRVDGDTL 200.000 100 QPPPPRNPL 180.000 138 QARLRLRVL 120.000 106 NPLDGSVLL 80.000 26 TGRCPAGEL 60.000 142 RLRVLVPPL 40.000 202 AAVTSEFHL 36.000 11 GPEAWLLLL 24.000 42 VVLGQDAKL 20.000 1 MPLSLGAEM 20.000 351 VVVGVIAAL 20.000 352 VVGVIAALL 20.000 223 CVVSHPGLL 20.000 13 EAWLLLLLL 12.000 71 DAGEGAQEL 12.000 80 ALLHSKYGL 12.000 356 IAALLFCLL 12.000 277 PPSYNWTRL 8.000 495 KPTGNGIYI 8.000 135 GSFQARLRL 6.000 8 EMWGPEAWL 6.000 145 VLVPPLPSL 6.000 450 TVREIETQT 5.000 222 TCVVSHPGL 4.000 325 DSQVTVDVL 4.000 287 GPLPSGVRV 4.000 362 CLLVVVVVL 4.000 10 WGPEAWLLL 4.000 260 HIGREGAML 4.000 410 SQPEESVGL 4.000 355 VIAALLFCL 4.000 105 RNPLDGSVL 4.000 74 EGAQELALL 4.000 382 MTQKYEEEL 4.000 407 DPRSQPEES 4.000 419 RAEGHPDSL 3.600 245 LAEASVRGL 3.600 203 AVTSEFHLV 3.000 275 QPPPSYNWT 2.000 322 SSRDSQVTV 2.000 150 LPSLNPGPA 2.000 357 AALLFCLLV 1.800 371 MSRYHRRKA 1.500 133 PAGSFQARL 1.200 493 RAKPTGNGI 1.200 14 AWLLLLLLL 1.200 36 TSDVVTVVL 1.200 453 EIETQTELL 1.200 157 PALEEGQGL 1.200 348 ASVVVVGVI 1.200 249 SVRGLEDQN 1.000 374 YHRRKAQQM 1.000 441 EGRSYSTLT 1.000 363 LLVVVVVLM 1.000 345 LVSASVVVV 1.000 126 ECRVSTFPA 1.000 64 QVAWARVDA 0.750 103 PPRNPLDGS 0.600 358 ALLFCLLVV 0.600 178 APSVTWDTE 0.600 501 IYINGRGHL 0.600 151 PSLNPGPAL 0.600 50 LPCFYRGDS 0.600 439 EPEGRSYST 0.600 347 SASVVVVGV 0.600 349 SVVVVGVIA 0.500 350 VVVVGVIAA 0.500 354 GVIAALLFC 0.500 23 ASFTGRCPA 0.450 29 CPAGELETS 0.400 446 STLTTVREI 0.400 297 GDTLGFPPL 0.400 232 QDQRITHIL 0.400 263 REGAMLKCL 0.400 281 NWTRLDGPL 0.400 390 LTLTRENSI 0.400 484 HFVQENGTL 0.400 452 REIETQTEL 0.400 384 QKYEEELTL 0.400 302 FPPLTTEHS 0.400 237 THILHVSFL 0.400 250 VRGLEDQNL 0.400 73 GEGAQELAL 0.400 9 MWGPEAWLL 0.400 213 SRSMNGQPL 0.400 337 EDSGKQVDL 0.400 289 LPSGVRVDG 0.300 110 GSVLLRNAV 0.300 117 AVQADEGEY 0.300 216 MNGQPLTCV 0.300 147 VPPLPSLNP 0.300 137 FQARLRLRV 0.300 67 WARVDAGEG 0.300 342 QVDLVSASV 0.300 462 SPGSGRAEE 0.300 214 RSMNGQPLT 0.300 211 VPSRSMNGQ 0.200 217 NGQPLTCVV 0.200 35 ETSDVVTVV 0.200 154 NPGPALEEG 0.200 V2-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 GQDAKLPCL 1.200 6 LPCLYRGDS 0.600 3 DAKLPCLYR 0.045 8 CLYRGDSGE 0.010 9 LYRGDSGEQ 0.010 5 KLPCLYRGD 0.010 4 AKLPCLYRG 0.003 2 QDAKLPCLY 0.002 7 PCLYRGDSG 0.001 V7-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 DPRSQSEEP 2.000 7 RSQSEEPEG 0.010 8 SQSEEPEGR 0.010 2 HHTDPRSQS 0.005 3 HTDPRSQSE 0.003 4 TDPRSQSEE 0.001 1 SHHTDPRSQ 0.001 6 PRSQSEEPE 0.000 V9 HLA-B7-9mers-J91P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified,the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 46 YVAQAGLEL 20.000 92 AFRFIQCLL 12.000 91 KAFRFIQCL 12.000 63 SASLVAGTL 12.000 47 VAQAGLELL 12.000 59 NPPASASLV 4.000 95 FIQCLLLGL 4.000 96 IQCLLLGLL 4.000 15 FNFFLFFFL 4.000 101 LGLLKVRPL 4.000 58 SNPPASASL 4.000 121 RGYFQGIFM 1.000 105 KVRPLQHQG 0.500 5 LLAGILLRI 0.400 107 RPLQHQGVN 0.400 23 LPFPLVVFF 0.400 88 KLKKAFRFI 0.400 44 SHYVAQAGL 0.400 19 LFFFLPFPL 0.400 81 SFTKRKKKL 0.400 25 FPLVVFFIY 0.400 32 IYFYFYFFL 0.400 3 RELLAGILL 0.400 119 CERGYFQGI 0.400 93 FRFIQCLLL 0.400 1 MRRELLAGI 0.400 11 LRITFNFFL 0.400 6 LAGILLRIT 0.300 62 ASASLVAGT 0.300 68 AGTLSVHHC 0.300 60 PPASASLVA 0.200 10 LLRITFNFF 0.200 98 CLLLGLLKV 0.200 65 SLVAGTLSV 0.200 56 GSSNPPASA 0.150 129 MQAAPWEGT 0.150 2 RRELLAGIL 0.120 70 TLSVHHCAC 0.100 109 LQHQGVNSC 0.100 69 GTLSVHHCA 0.100 28 VVFFIYFYF 0.100 34 FYFYFFLEM 0.100 54 LLGSSNPPA 0.100 27 LVVFFIYFY 0.100 124 FQGIFMQAA 0.100 75 HCACFESFT 0.100 111 HQGVNSCDC 0.100 7 AGILLRITF 0.090 49 QAGLELLGS 0.060 64 ASLVAGTLS 0.060 50 AGLELLGSS 0.060 39 FLEMESHYV 0.060 66 LVAGTLSVH 0.050 72 SVHHCACFE 0.050 113 GVNSCDCER 0.050 48 AQAGLELLG 0.030 40 LEMESHYVA 0.030 77 ACFESFTKR 0.030 67 VAGTLSVHH 0.030 22 FLPFPLVVF 0.030 76 CACFESFTK 0.030 20 FFFLPFPLV 0.030 57 SSNPPASAS 0.030 71 LSVHHCACF 0.020 55 LGSSNPPAS 0.020 106 VRPLQHQGV 0.020 21 FFLPFPLVV 0.020 12 RITFNFFLF 0.020 9 ILLRITFNF 0.020 115 NSCDCERGY 0.020 13 ITFNFFLFF 0.020 126 GIFMQAAPW 0.020 8 GILLRITFN 0.020 31 FIYFYFYFF 0.020 102 GLLKVRPLQ 0.015 80 ESFTKRKKK 0.015 125 QGIFMQAAP 0.010 128 FMQAAPWEG 0.010 18 FLFFFLPFP 0.010 97 QCLLLGLLK 0.010 100 LLGLLKVRP 0.010 1231 YFQGIFMQA 0.010 103 LLKVRPLQH 0.010 83 TKRKKKLKK 0.010 90 KKAFRFIQC 0.010 112 QGVNSCDCE 0.010 42 MESHYVAQA 0.010 4 ELLAGILLR 0.010 82 FTKRKKKLK 0.010 43 ESHYVAQAG 0.010 84 KRKKKLKKA 0.010 99 LLLGLLKVR 0.010 53 ELLGSSNPP 0.010 114 VNSCDCERG 0.010 116 SCDCERGYF 0.009 51 GLELLGSSN 0.006 24 PFPLVVFFI 0.004 127 IFMQAAPWE 0.003 61 PASASLVAG 0.003 118 DCERGYFQG 0.003 V11-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 RLRVMVPPL 40.000 1 QARLRLRVM 30.000 8 VMVPPLPSL 6.000 7 RVMVPPLPS 0.450 9 MVPPLPSLN 0.100 3 RLRLRVMVP 0.100 2 ARLRLRVMV 0.090 6 LRVMVPPLP 0.001 4 LRLRVMVPP 0.001 V12-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 EPEGCSYST 0.600 9 CSYSTLTTV 0.200 7 EGCSYSTLT 0.100 1 VMSEEPEGC 0.100 8 GCSYSTLTT 0.100 6 PEGCSYSTL 0.040 2 MSEEPEGCS 0.009 4 EEPEGCSYS 0.002 3 SEEPEGCSY 0.001 V13-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 SQVTVDVLA 0.100 6 DVLADPQED 0.050 2 QVTVDVLAD 0.050 7 VLADPQEDS 0.030 4 TVDVLADPQ 0.015 3 VTVDVLADP 0.010 8 LADPQEDSG 0.009 9 ADPQEDSGK 0.003 5 VDVLADPQE 0.001 V14-HLA-B7-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 SASLVAGTL 12.000 4 NPPASASLV 4.000 3 SNPPASASL 4.000 7 ASASLVAGT 0.300 5 PPASASLVA 0.200 1 GSSNPPASA 0.150 9 ASLVAGTLS 0.060 2 SSNPPASAS 0.030 6 PASASLVAG 0.003

[1033] 29 TABLE XIX Start Sequence Score V1-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 249 SVRGLEDQNL 200.000 150 LPSLNPGPAL 120.000 156 GPALEEGQGL 80.000 132 FPAGSFQARL 80.000 407 DPRSQPEESV 60.000 392 LTRENSIRRL 40.000 144 RVLVPPLPSL 30.000 11 GPEAWLLLLL 24.000 439 EPEGRSYSTL 24.000 350 VVVVGVIAAL 20.000 351 VVVGVIAALL 20.000 354 GVIAALLFCL 20.000 41 TVVLGQDAKL 20.000 134 AGSFQARLRL 18.000 178 APSVTWDTEV 12.000 13 EAWLLLLLLL 12.000 201 SAAVTSEFHL 12.000 79 LALLHSKYGL 12.000 99 EQPPPPRNPL 9.000 138 QARLRLRVLV 9.000 276 PPPSYNWTRL 8.000 227 HPGLLQDQRI 8.000 500 GIYINGRGHL 6.000 25 FTGRCPAGEL 6.000 7 AEMWGPEAWL 5.400 409 RSQPEESVGL 4.000 103 PPRNPLDGSV 4.000 244 FLAEASVRGL 4.000 8 EMWGPEAWLL 4.000 383 TQKYEEELTL 4.000 137 FQARLRLRVL 4.000 236 ITHILHVSFL 4.000 291 SGVRVDGDTL 4.000 334 DPQEDSGKQV 4.000 10 WGPEAWLLLL 4.000 222 TCVVSHPGLL 4.000 212 PSRSMNGQPL 4.000 280 YNWTRLDGPL 4.000 221 LTCVVSHPGL 4.000 355 VIAALLFCLL 4.000 381 QMTQKYEEEL 4.000 35 ETSDVVTVVL 4.000 361 FCLLVVVVVL 4.000 105 RNPLDGSVLL 4.000 158 ALEEGQGLTL 3.600 72 AGEGAQELAL 3.600 67 WARVDAGEGA 3.000 176 SPAPSVTWDT 2.000 233 DQRITHILHV 2.000 202 AAVTSEFHLV 1.800 357 AALLFCLLVV 1.800 231 LQDQRITHIL 1.200 347 SASVVVVGVI 1.200 296 DGDTLGFPPL 1.200 261 IGREGAMLKC 1.000 397 SIRRLHSHHT 1.000 61 QVGQVAWARV 1.000 441 EGRSYSTLTT 1.000 89 HVSPAYEGRV 1.000 362 CLLVVVVVLM 1.000 241 HVSFLAEASV 1.000 303 PPLTTEHSGI 0.800 411 QPEESVGLRA 0.600 356 IAALLFCLLV 0.600 358 ALLFCLLVVV 0.600 349 SVVVVGVIAA 0.500 485 FVQENGTLRA 0.500 450 TVREIETQTE 0.500 292 GVRVDGDTLG 0.500 39 VVTVVLGQDA 0.500 111 SVLLRNAVQA 0.500 22 LASFTGRCPA 0.450 452 REIETQTELL 0.400 324 RDSQVTVDVL 0.400 70 VDAGEGAQEL 0.400 1 MPLSLGAEMW 0.400 389 ELTLTRENSI 0.400 259 WHIGREGAML 0.400 73 GEGAQELALL 0.400 495 KPTGNGIYIN 0.400 418 LRAEGHPDSL 0.400 9 MWGPEAWLLL 0.400 483 NHFVQENGTL 0.400 230 LLQDQRITHI 0.400 141 LRLRVLVPPL 0.400 445 YSTLTTVREI 0.400 342 QVDLVSASVV 0.300 215 SMNGQPLTCV 0.300 71 DAGEGAQELA 0.300 214 RSMNGQPLTC 0.300 348 ASVVVVGVIA 0.300 109 DGSVLLRNAV 0.300 169 ASCTAEGSPA 0.300 91 SPAYEGRVEQ 0.300 473 DQDEGIKQAM 0.300 172 TAEGSPAPSV 0.270 289 LPSGVRVDGD 0.200 81 LLHSKYGLHV 0.200 417 GLRAEGHPDS 0.200 321 FSSRDSQVTV 0.200 V2-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 LGQDAKLPCL 4.000 7 LPCLYRGDSG 0.200 10 LYRGDSGEQV 0.200 4 DAKLPCLYRG 0.030 6 KLPCLYRGDS 0.030 9 CLYRGDSGEQ 0.010 2 GQDAKLPCLY 0.006 5 AKLPCLYRGD 0.003 3 QDAKLPCLYR 0.002 8 PCLYRGDSGE 0.001 V7-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 DPRSQSEEPE 2.000 9 SQSEEPEGRS 0.030 8 RSQSEEPEGR 0.010 1 HSHHTDPRSQ 0.010 2 SHHTDPRSQS 0.005 4 HTDPRSQSEE 0.003 3 HHTDPRSQSE 0.001 5 TDPRSQSEEP 0.001 7 PRSQSEEPEG 0.000 V9-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 LLRITFNFFL 40.000 46 YVAQAGLELL 20.000 92 AFRFIQCLLL 12.000 91 KAFRFIQCLL 12.000 62 ASASLVAGTL 12.000 105 KVRPLQHQGV 10.000 23 LPFPLVVFFI 8.000 100 LLGLLKVRPL 4.000 31 FIYFYFYFFL 4.000 1 MRRELLAGIL 4.000 95 FIQCLLLGLL 4.000 57 SSNPPASASL 4.000 80 ESFTKRKKKL 4.000 18 FLFFFLPFPL 4.000 43 ESHYVAQAGL 4.000 59 NPPASASLVA 2.000 64 ASLVAGTLSV 0.600 4 ELLAGILLRI 0.400 107 RPLQHQGVNS 0.400 14 TFNFFLFFFL 0.400 25 FPLVVFIYF 0.400 94 RFIQCLLLGL 0.400 45 HYVAQAGLEL 0.400 90 KKAFRFIQCL 0.400 67 VAGTLSVHHC 0.300 68 AGTLSVHHCA 0.300 97 QCLLLGLLKV 0.200 58 SNPPASASLV 0.200 128 FMQMPWEGT 0.150 55 LGSSNPPASA 0.150 2 RRELLAGILL 0.120 118 DCERGYFQGI 0.120 33 YFYFYFFLEM 0.100 28 VVFFIYFYFY 0.100 53 ELLGSSNPPA 0.100 72 SVHHCACFES 0.100 83 TKRKKKLKKA 0.100 5 LLAGILLRIT 0.100 69 GTLSVHHCAC 0.100 27 LVVFFIYFYF 0.100 120 ERGYFQGIFM 0.100 6 LAGILLRITF 0.090 63 SASLVAGTLS 0.060 48 AQAGLELLGS 0.060 7 AGILLRITFN 0.060 50 AGLELLGSSN 0.060 49 QAGLELLGSS 0.060 113 GVNSCDCERG 0.050 66 LVAGTLSVHH 0.050 87 KKLKKAFRFI 0.040 115 NSCDCERGYF 0.030 47 VAQAGLELLG 0.030 61 PASASLVAGT 0.030 76 CACFESFTKR 0.030 56 GSSNPPASAS 0.030 19 LFFFLPFPLV 0.030 77 ACFESFTKRK 0.030 39 FLEMESHYVA 0.030 41 EMESHYVAQA 0.030 38 FFLEMESHYV 0.020 22 FLPFPLVVFF 0.020 119 CERGYFQGIF 0.020 9 ILLRITFNFF 0.020 70 TLSVHHCACF 0.020 125 QGIFMQAAPW 0.020 60 PPASASLVAG 0.020 8 GILLRITFNF 0.020 12 RITFNFFLFF 0.020 114 VNSCDCERGY 0.020 54 LLGSSNPPAS 0.020 13 ITFNFFLFFF 0.020 20 FFFLPFPLVV 0.020 101 LGLLKVRPLQ 0.015 103 LLKVRPLQHQ 0.015 88 KLKKAFRFIQ 0.015 108 PLQHQGVNSC 0.010 96 IQCLLLGLLK 0.010 89 LKKAFRFIQC 0.010 75 HCACFESFTK 0.010 82 FTKRKKKLKK 0.010 102 GLLKVRPLQH 0.010 121 RGYFQGIFMQ 0.010 15 FNFFLFFFLP 0.010 65 SLVAGTLSVH 0.010 98 CLLLGLLKVR 0.010 109 LQHQGVNSCD 0.010 110 QHQGVNSCDC 0.010 122 GYFQGIFMQA 0.010 111 HQGVNSCDCE 0.010 71 LSVHHCACFE 0.010 126 GIFMQAAPWE 0.010 99 LLLGLLKVRP 0.010 123 YFQGIFMQAA 0.010 124 FQGIFMQAAP 0.010 74 HHCACFESFT 0.010 112 QGVNSCDCER 0.010 21 FFLPFPLVVF 0.003 127 IFMQAAPWEG 0.003 40 LEMESHYVAQ 0.003 116 SCDCERGYFQ 0.003 V10-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start positions specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 GTSDVVTVVL 4.000 9 LGTSDVVTVV 0.200 8 ELGTSDVVTV 0.200 4 CPAGELGTSD 0.200 6 AGELGTSDVV 0.180 1 TGRCPAGELG 0.100 5 PAGELGTSDV 0.060 3 RCPAGELGTS 0.020 2 GRCPAGELGT 0.010 7 GELGTSDVVT 0.010 V11-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQD NO: 23; each start positions specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RVMVPPLPSL 90.000 2 QARLRLRVMV 9.000 1 FQARLRLRVM 1.000 5 LRLRVMVPPL 0.400 6 RLRVMVPPLP 0.100 4 RLRLRVMVPP 0.100 10 MVPPLPSLNP 0.075 9 VMVPPLPSLN 0.020 7 LRVMVPPLPS 0.003 3 ARLRLRVMVP 0.003 V12-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 EPEGCSYSTL 24.000 1 SVMSEEPEGC 1.500 9 GCSYSTLTTV 0.200 8 EGCSYSTLTT 0.100 2 VMSEEPEGCS 0.030 5 EEPEGCSYST 0.010 10 CSYSTLTTVR 0.010 3 MSEEPEGCSY 0.006 11 SYSTLTTVRE 0.001 7 PEGCSYSTLT 0.001 4 SEEPEGCSYS 0.001 V13-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 7 DVLADPQEDS 0.150 1 DSQVTVDVLA 0.100 3 QVTVDVLADP 0.050 5 TVDVLADPQE 0.015 4 VTVDVLADPQ 0.010 2 SQVTVDVLAD 0.010 8 VLADPQEDSG 0.010 9 LADPQEDSGK 0.009 10 ADPQEDSGKQ 0.003 6 VDVLADPQED 0.001 V14-HLA-B7-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length; of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 ASASLVAGTL 12.000 3 SSNPPASASL 4.000 5 NPPASASLVA 2.000 10 ASLVAGTLSV 0.600 4 SNPPASASLV 0.200 1 LGSSNPPASA 0.150 9 SASLVAGTLS 0.060 7 PASASLVAGT 0.030 2 GSSNPPASAS 0.030 6 PPASASLVAG 0.020

[1034] 30 TABLE XX Start Subsequence Score V1-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 MPLSLGAEM 40.000 106 NPLDGSVLL 40.000 100 QPPPPRNPL 20.000 495 KPTGNGIYI 16.000 378 KAQQMTQKY 12.000 200 RSAAVTSEF 10.000 138 QARLRLRVL 9.000 493 RAKPTGNGI 7.200 322 SSRDSQVTV 6.000 407 DPRSQPEES 6.000 142 RLRVLVPPL 6.000 11 GPEAWLLLL 6.000 71 DAGEGAQEL 6.000 129 VSTFPAGSF 5.000 325 DSQVTVDVL 5.000 135 GSFQARLRL 5.000 292 GVRVDGDTL 4.500 305 LTTEHSGIY 4.000 287 GPLPSGVRV 4.000 117 AVQADEGEY 3.000 26 TGRCPAGEL 3.000 202 AAVTSEFHL 3.000 251 RGLEDQNLW 3.000 29 CPAGELETS 3.000 105 RNPLDGSVL 3.000 13 EAWLLLLLL 3.000 356 IAALLFCLL 3.000 410 SQPEESVGL 3.000 477 GIKQAMNHF 3.000 175 GSPAPSVTW 2.500 366 VVVVLMSRY 2.000 275 QPPPSYNWT 2.000 50 LPCFYRGDS 2.000 150 LPSLNPGPA 2.000 78 ELALLHSKY 2.000 348 ASVVVVGVI 2.000 363 LLVVVVVLM 2.000 57 DSGEQVGQV 2.000 86 YGLHVSPAY 2.000 10 WGPEAWLLL 2.000 188 KGTTSSRSF 2.000 302 FPPLTTEHS 2.000 277 PPSYNWTRL 2.000 443 RSYSTLTTV 2.000 419 RAEGHPDSL 1.800 74 EGAQELALL 1.500 260 HIGREGAML 1.500 36 TSDVVTVVL 1.500 83 HSKYGLHVS 1.500 198 HSRSAAVTS 1.500 371 MSRYHRRKA 1.500 8 EMWGPEAWL 1.000 222 TCVVSHPGL 1.000 17 LLLLLLASF 1.000 80 ALLHSKYGL 1.000 355 VIAALLFCL 1.000 42 VVLGQDAKL 1.000 242 VSFLAEASV 1.000 214 RSMNGQPLT 1.000 351 VVVGVIAAL 1.000 382 MTQKYEEEL 1.000 313 YVCHVSNEF 1.000 309 HSGIYVCHV 1.000 353 VGVIAALLF 1.000 352 VVGVIAALL 1.000 362 CLLVVVVVL 1.000 90 VSPAYEGRV 1.000 194 RSFKHSRSA 1.000 145 VLVPPLPSL 1.000 223 CVVSHPGLL 1.000 338 DSGKQVDLV 1.000 110 GSVLLRNAV 1.000 236 ITHILHVSF 1.000 157 PALEEGQGL 0.900 294 RVDGDTLGF 0.900 245 LAEASVRGL 0.900 321 FSSRDSQVT 0.750 425 DSLKDNSSC 0.750 347 SASVVVVGV 0.600 357 AALLFCLLV 0.600 439 EPEGRSYST 0.600 450 TVREIETQT 0.600 334 DPQEDSGKQ 0.600 423 HPDSLKDNS 0.600 103 PPRNPLDGS 0.600 426 SLKDNSSCS 0.600 374 YHRRKAQQM 0.600 23 ASFTGRCPA 0.500 274 GQPPPSYNW 0.500 191 TSSRSFKHS 0.500 151 PSLNPGPAL 0.500 402 HSHHTDPRS 0.500 383 TQKYEEELT 0.450 428 KDNSSCSVM 0.400 446 STLTTVREI 0.400 390 LTLTRENSI 0.400 35 ETSDVVTVV 0.400 341 KQVDLVSAS 0.400 452 REIETQTEL 0.400 491 TLRAKPTGN 0.300 V2-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 LPCLYRGDS 2.000 1 GQDAKLPCL 0.300 2 QDAKLPCLY 0.200 3 DAKLPCLYR 0.090 5 KLPCLYRGD 0.020 8 CLYRGDSGE 0.010 9 LYRGDSGEQ 0.005 4 AKLPCLYRG 0.001 7 PCLYRGDSG 0.001 V7-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 DPRSQSEEP 0.600 7 RSQSEEPEG 0.150 8 SQSEEPEGR 0.030 2 HHTDPRSQS 0.020 3 HTDPRSQSE 0.003 1 SHHTDPRSQ 0.002 4 TDPRSQSEE 0.001 6 PRSQSEEPE 0.000 V9-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 25 FPLVVFFIY 40.000 23 LPFPLVVFF 20.000 115 NSCDCERGY 20.000 91 KAFRFIQCL 6.000 71 LSVHHCACF 5.000 107 RPLQHQGVN 4.000 59 NPPASASLV 4.000 121 RGYFQGIFM 4.000 10 LLRITFNFF 3.000 47 VAQAGLELL 3.000 63 SASLVAGTL 3.000 88 KLKKAFRFI 2.400 27 LVVFFIYFY 2.000 12 RITFNFFLF 2.000 46 YVAQAGLEL 1.000 15 FNFFLFFFL 1.000 7 AGILLRITF 1.000 22 FLPFPLVVF 1.000 95 FIQCLLLGL 1.000 101 LGLLKVRPL 1.000 31 FIYFYFYFF 1.000 58 SNPPASASL 1.000 28 VVFFIYFYF 1.000 9 ILLRITFNF 1.000 13 ITFNFFLFF 1.000 96 IQCLLLGLL 1.000 85 RKKKLKKAF 0.600 126 GIFMQAAPW 0.500 57 SSNPPASAS 0.500 62 ASASLVAGT 0.500 64 ASLVAGTLS 0.500 56 GSSNPPASA 0.500 116 SCDCERGYF 0.450 49 QAGLELLGS 0.450 5 LLAGILLRI 0.400 38 FFLEMESHY 0.400 92 AFRFIQCLL 0.300 6 LAGILLRIT 0.300 1 MRRELLAGI 0.240 87 KKLKKAFRF 0.200 60 PPASASLVA 0.200 3 RELLAGILL 0.200 98 CLLLGLLKV 0.200 34 FYFYFFLEM 0.200 65 SLVAGTLSV 0.200 50 AGLELLGSS 0.200 29 VFFIYFYFY 0.200 119 CERGYFQGI 0.120 93 FRFIQCLLL 0.100 70 TLSVHHCAC 0.100 19 LFFFLPFPL 0.100 111 HQGVNSCDC 0.100 30 FFIYFYFYF 0.100 11 LRITFNFFL 0.100 55 LGSSNPPAS 0.100 32 IYFYFYFFL 0.100 54 LLGSSNPPA 0.100 26 PLVVFFIYF 0.100 14 TFNFFLFFF 0.100 44 SHYVAQAGL 0.100 69 GTLSVHHCA 0.100 109 LQHQGVNSC 0.100 17 FFLFFFLPF 0.100 81 SFTKRKKKL 0.100 124 FQGIFMQAA 0.100 74 HHCACFESF 0.100 75 HCACFESFT 0.100 120 ERGYFQGIF 0.100 68 AGTLSVHHC 0.100 129 MQAAPWEGT 0.100 8 GILLRITFN 0.100 39 FLEMESHYV 0.090 84 KRKKKLKKA 0.060 105 KVRPLQHQG 0.060 2 RRELLAGIL 0.060 80 ESFTKRKKK 0.050 43 ESHYVAQAG 0.050 76 CACFESFTK 0.045 67 VAGTLSVHH 0.030 82 FTKRKKKLK 0.030 103 LLKVRPLQH 0.030 51 GLELLGSSN 0.030 90 KKAFRFIQC 0.020 20 FFFLPFPLV 0.020 40 LEMESHYVA 0.020 77 ACFESFTKR 0.020 106 VRPLQHQGV 0.020 21 FFLPFPLVV 0.020 114 VNSCDCERG 0.015 42 MESHYVAQA 0.010 66 LVAGTLSVH 0.010 72 SVHHCACFE 0.010 100 LLGLLKVRP 0.010 18 FLFFFLPFP 0.010 125 QGIFMQAAP 0.010 97 QCLLLGLLK 0.010 99 LLLGLLKVR 0.010 48 AQAGLELLG 0.010 102 GLLKVRPLQ 0.010 73 VHHCACFES 0.010 V10-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 CPAGELGTS 3.000 9 GTSDVVTVV 0.400 8 LGTSDVVTV 0.300 2 RCPAGELGT 0.200 7 ELGTSDVVT 0.100 5 AGELGTSDV 0.060 6 GELGTSDVV 0.020 4 PAGELGTSD 0.006 1 GRCPAGELG 0.001 V11-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 QARLRLRVM 18.000 5 RLRVMVPPL 6.000 8 VMVPPLPSL 1.000 7 RVMVPPLPS 0.200 9 MVPPLPSLN 0.100 3 RLRLRVMVP 0.060 2 ARLRLRVMV 0.020 6 LRVMVPPLP 0.001 4 LRLRVMVPP 0.001 V12-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 CSYSTLTTV 1.000 5 EPEGCSYST 0.600 1 VMSEEPEGC 0.300 2 MSEEPEGCS 0.300 8 GCSYSTLTT 0.100 7 EGCSYSTLT 0.100 3 SEEPEGCSY 0.090 4 EEPEGCSYS 0.020 6 PEGCSYSTL 0.010 V13-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 VLADPQEDS 0.200 1 SQVTVDVLA 0.100 3 VTVDVLADP 0.020 2 QVTVDVLAD 0.015 6 DVLADPQED 0.015 8 LADPQEDSG 0.009 4 TVDVLADPQ 0.003 9 ADPQEDSGK 0.002 5 VDVLADPQE 0.001 V14-HLA-B3501-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 4 NPPASASLV 4.000 8 SASLVAGTL 3.000 3 SNPPASASL 1.000 9 ASLVAGTLS 0.500 7 ASASLVAGT 0.500 1 GSSNPPASA 0.500 2 SSNPPASAS 0.500 5 PPASASLVA 0.200 6 PASASLVAG 0.003

[1035] 31 TABLE XXI Start Subsequence Score V1-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 493 RAKPTGNGIY 36.000 156 GPALEEGQGL 30.000 150 LPSLNPGPAL 20.000 132 FPAGSFQARL 20.000 409 RSQPEESVGL 15.000 407 DPRSQPEESV 12.000 1 MPLSLGAEMW 10.000 116 NAVQADEGEY 9.000 436 MSEEPEGRSY 9.000 334 DPQEDSGKQV 8.000 227 HPGLLQDQRI 8.000 11 GPEAWLLLLL 6.000 392 LTRENSIRRL 6.000 439 EPEGRSYSTL 6.000 383 TQKYEEELTL 4.500 249 SVRGLEDQNL 4.500 178 APSVTWDTEV 4.000 495 KPTGNGIYIN 4.000 271 LSEGQPPPSY 3.000 79 LALLHSKYGL 3.000 13 EAWLLLLLLL 3.000 201 SAAVTSEFHL 3.000 365 VVVVVLMSRY 2.000 276 PPPSYNWTRL 2.000 128 RVSTFPAGSF 2.000 35 ETSDVVTVVL 2.000 362 CLLVVVVVLM 2.000 235 RITHILHVSF 2.000 44 LGQDAKLPCF 2.000 144 RVLVPPLPSL 2.000 445 YSTLTTVREI 2.000 10 WGPEAWLLLL 2.000 176 SPAPSVTWDT 2.000 105 RNPLDGSVLL 2.000 244 FLAEASVRGL 2.000 138 QARLRLRVLV 1.800 291 SGVRVDGDTL 1.500 192 SSRSFKHSRS 1.500 212 PSRSMNGQPL 1.500 8 EMWGPEAWLL 1.500 426 SLKDNSSCSV 1.200 411 QPEESVGLRA 1.200 103 PPRNPLDGSV 1.200 303 PPLTTEHSGI 1.200 347 SASVVVVGVI 1.200 473 DQDEGIKQAM 1.200 361 FCLLVVVVVL 1.000 236 ITHILHVSFL 1.000 221 LTCVVSHPGL 1.000 222 TCVVSHPGLL 1.000 25 FTGRCPAGEL 1.000 346 VSASVVVVGV 1.000 354 GVIAALLFCL 1.000 57 DSGEQVGQVA 1.000 194 RSFKHSRSAA 1.000 214 RSMNGQPLTC 1.000 381 QMTQKYEEEL 1.000 137 FQARLRLRVL 1.000 355 VIAALLFCLL 1.000 350 VVVVGVIAAL 1.000 352 VVGVIAALLF 1.000 351 VVVGVIAALL 1.000 317 VSNEFSSRDS 1.000 500 GIYINGRGHL 1.000 16 LLLLLLLASF 1.000 99 EQPPPPRNPL 1.000 41 TVVLGQDAKL 1.000 280 YNWTRLDGPL 1.000 134 AGSFQARLRL 1.000 476 EGIKQAMNHF 1.000 321 FSSRDSQVTV 1.000 202 AAVTSEFHLV 0.900 67 WARVDAGEGA 0.900 341 KQVDLVSASV 0.800 230 LLQDQRITHI 0.800 169 ASCTAEGSPA 0.750 71 DAGEGAQELA 0.600 233 DQRITHILHV 0.600 158 ALEEGQGLTL 0.600 45 GQDAKLPCFY 0.600 477 GIKQAMNHFV 0.600 75 GAQELALLHS 0.600 357 AALLFCLLVV 0.600 261 IGREGAMLKC 0.600 356 IAALLFCLLV 0.600 423 HPDSLKDNSS 0.600 309 HSGIYVCHVS 0.500 248 ASVRGLEDQN 0.500 348 ASVVVVGVIA 0.500 174 EGSPAPSVTW 0.500 425 DSLKDNSSCS 0.500 338 DSGKQVDLVS 0.500 273 EGQPPPSYNW 0.500 6 GAEMWGPEAW 0.450 339 SGKQVDLVSA 0.450 106 NPLDGSVLLR 0.400 377 RKAQQMTQKY 0.400 452 REIETQTELL 0.400 389 ELTLTRENSI 0.400 305 LTTEHSGIYV 0.400 V2-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 LGQDAKLPCL 2.000 2 GQDAKLPCLY 0.600 7 LPCLYRGDSG 0.200 6 KLPCLYRGDS 0.200 4 DAKLPCLYRG 0.090 10 LYRGDSGEQV 0.060 9 CLYRGDSGEQ 0.015 3 QDAKLPCLYR 0.001 8 PCLYRGDSGE 0.001 5 AKLPCLYRGD 0.001 V7-HLA-B3501-10Mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 DPRSQSEEPE 0.600 9 SQSEEPEGRS 0.200 8 RSQSEEPEGR 0.150 1 HSHHTDPRSQ 0.075 2 SHHTDPRSQS 0.010 4 HTDPRSQSEE 0.003 3 HHTDPRSQSE 0.002 5 TDPRSQSEEP 0.001 7 PRSQSEEPEG 0.000 V9-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 25 FPLVVFFIYF 20.000 115 NSCDCERGYF 15.000 23 LPFPLVVFFI 8.000 91 KAFRFIQCLL 6.000 57 SSNPPASASL 5.000 80 ESFTKRKKKL 5.000 43 ESHYVAQAGL 5.000 62 ASASLVAGTL 5.000 107 RPLQHQGVNS 4.000 6 LAGILLRITF 3.000 10 LLRITFNFFL 3.000 59 NPPASASLVA 2.000 28 VVFFIYFYFY 2.000 114 VNSCDCERGY 2.000 12 RITFNFFLFF 2.000 105 KVRPLQHQGV 1.200 64 ASLVAGTLSV 1.000 70 TLSVHHCACF 1.000 13 ITFNFFLFFF 1.000 18 FLFFFLPFPL 1.000 100 LLGLLKVRPL 1.000 95 FIQCLLLGLL 1.000 8 GILLRITFNF 1.000 9 ILLRITFNFF 1.000 46 YVAQAGLELL 1.000 31 FIYFYFYFFL 1.000 27 LVVFFIYFYF 1.000 22 FLPFPLVVFF 1.000 86 KKKLKKAFRF 0.600 84 KRKKKLKKAF 0.600 1 MRRELLAGIL 0.600 56 GSSNPPASAS 0.500 125 QGIFMQAAPW 0.500 4 ELLAGILLRI 0.400 119 CERGYFQGIF 0.300 63 SASLVAGTLS 0.300 67 VAGTLSVHHC 0.300 92 AFRFIQCLLL 0.300 49 QAGLELLGSS 0.300 120 ERGYFQGIFM 0.200 58 SNPPASASLV 0.200 90 KKAFRFIQCL 0.200 33 YFYFYFFLEM 0.200 50 AGLELLGSSN 0.200 97 QCLLLGLLKV 0.200 26 PLVVFFIYFY 0.200 37 YFFLEMESHY 0.200 94 RFIQCLLLGL 0.200 48 AQAGLELLGS 0.150 118 DCERGYFQGI 0.120 21 FFLPFPLVVF 0.100 14 TFNFFLFFFL 0.100 30 FFIYFYFYFF 0.100 72 SVHHCACFES 0.100 55 LGSSNPPASA 0.100 69 GTLSVHHCAC 0.100 45 HYVAQAGLEL 0.100 53 ELLGSSNPPA 0.100 16 NFFLFFFLPF 0.100 128 FMQAAPWEGT 0.100 11 LRITFNFFLF 0.100 68 AGTLSVHHCA 0.100 7 AGILLRITFN 0.100 54 LLGSSNPPAS 0.100 73 VHHCACFESF 0.100 29 VFFIYFYFYF 0.100 5 LLAGILLRIT 0.100 87 KKLKKAFRFI 0.080 38 FFLEMESHYV 0.060 88 KLKKAFRFIQ 0.060 2 RRELLAGILL 0.060 71 LSVHHCACFE 0.050 83 TKRKKKLKKA 0.030 47 VAQAGLELLG 0.030 103 LLKVRPLQHQ 0.030 61 PASASLVAGT 0.030 76 CACFESFTKR 0.030 82 FTKRKKKLKK 0.030 89 LKKAFRFIQC 0.030 41 EMESHYVAQA 0.030 39 FLEMESHYVA 0.030 121 RGYFQGIFMQ 0.020 24 PFPLVVFFIY 0.020 60 PPASASLVAG 0.020 77 ACFESFTKRK 0.020 19 LFFFLPFPLV 0.020 20 FFFLPFPLVV 0.020 75 HCACFESFTK 0.015 113 GVNSCDCERG 0.015 108 PLQHQGVNSC 0.010 98 CLLLGLLKVR 0.010 110 QHQGVNSCDC 0.010 15 FNFFLFFFLP 0.010 99 LLLGLLKVRP 0.010 65 SLVAGTLSVH 0.010 101 LGLLKVRPLQ 0.010 111 HQGVNSCDCE 0.010 126 GIFMQAAPWE 0.010 96 IQCLLLGLLK 0.010 102 GLLKVRPLQH 0.010 V10-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 GTSDVVTVVL 2.000 8 ELGTSDVVTV 0.300 3 RCPAGELGTS 0.300 4 CPAGELGTSD 0.200 9 LGTSDVVTVV 0.200 5 PAGELGTSDV 0.120 6 AGELGTSDVV 0.060 1 TGRCPAGELG 0.030 2 GRCPAGELGT 0.010 7 GELGTSDVVT 0.010 V11-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 RVMVPPLPSL 2.000 1 FQARLRLRVM 2.000 2 QARLRLRVMV 1.800 9 VMVPPLPSLN 0.100 5 LRLRVMVPPL 0.100 4 RLRLRVMVPP 0.060 6 RLRVMVPPLP 0.060 10 MVPPLPSLNP 0.010 7 LRVMVPPLPS 0.010 3 ARLRLRVMVP 0.001 V12-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 MSEEPEGCSY 9.000 6 EPEGCSYSTL 6.000 2 VMSEEPEGCS 0.200 9 GCSYSTLTTV 0.200 1 SVMSEEPEGC 0.150 8 EGCSYSTLTT 0.100 10 CSYSTLTTVR 0.050 5 EEPEGCSYST 0.020 4 SEEPEGCSYS 0.003 7 PEGCSYSTLT 0.001 11 SYSTLTTVRE 0.001 V13-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 DSQVTVDVLA 0.500 7 DVLADPQEDS 0.100 8 VLADPQEDSG 0.020 4 VTVDVLADPQ 0.020 2 SQVTVDVLAD 0.015 9 LADPQEDSGK 0.013 3 QVTVDVLADP 0.010 5 TVDVLADPQE 0.003 10 ADPQEDSGKQ 0.002 6 VDVLADPQED 0.002 V14-HLA-B3501-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 ASASLVAGTL 5.000 3 SSNPPASASL 5.000 5 NPPASASLVA 2.000 10 ASLVAGTLSV 1.000 2 GSSNPPASAS 0.500 9 SASLVAGTLS 0.300 4 SNPPASASLV 0.200 1 LGSSNPPASA 0.100 7 PASASLVAGT 0.030 6 PPASASLVAG 0.020

[1036] 32 TABLE XXII Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 437 S E E P E G R S Y 32 107 P L D G S V L L R 21 305 L T T E H S G I Y 21 306 T T E H S G I Y V 21 159 L E E G Q G L T L 20 252 G L E D Q N L W H 20 405 H T D P R S Q P E 20 86 Y G L H V S P A Y 19 262 G R E G A M L K C 19 412 P E E S V G L R A 19 486 V Q E N G T L R A 19 494 A K P T G N G I Y 19 11 G P E A W L L L L 18 78 E L A L L H S K Y 18 272 S E G Q P P P S Y 18 332 V L D P Q E D S G 18 386 Y E E E L T L T R 18 36 T S D V V T V V L 17 76 A Q E L A L L H S 17 184 D T E V K G T T S 17 225 V S H P G L L Q D 17 271 L S E G Q P P P S 17 294 R V D G D T L G F 17 378 K A Q Q M T Q K Y 17 58 S G E Q V G Q V A 16 117 A V Q A D E G E Y 16 158 A L E E G Q G L T 16 323 S R D S Q V T V D 16 366 V V V V L M S R Y 16 457 Q T E L L S P G S 16 46 Q D A K L P C F Y 15 436 M S E E P E G R S 15 V2-HLA-A1-9mers-191P4D12 Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 Q D A K L P C L Y 17 1 G Q D A K L P C L 10 V7-HLA-A1-9mers-191P4D12 Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 H T D P R S Q S E 20 V9-HLA-A1-9mers-191P4D12 Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 25 F P L V V F F I Y 21 29 V F F I Y F Y F Y 20 115 N S C D C E R G Y 19 38 F F L E M E S H Y 16 13 I T F N F F L F F 15 27 L V V F F I Y F Y 15 116 S C D C E R G Y F 13 21 F F L P F P L V V 12 39 F L E M E S H Y V 12 51 G L E L L G S S N 12 118 D C E R G Y F Q G 12 4 E L L A G I L L R 11 57 S S N P P A S A S 11 65 S L V A G T L S V 11 93 F R F I Q C L L L 11 98 C L L L G L L K V 11 2 R R E L L A G I L 10 17 F F L F F F L P F 10 34 F Y F Y F F L E M 10 41 E M E S H Y V A Q 10 48 A Q A G L E L L G 10 78 C F E S F T K R K 10 V10-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 A G E L G T S D V 13 9 G T S D V V T V V 10 2 R C P A G E L G T 8 1 G R C P A G E L G 7 V11-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 R V M V P P L P S 7 8 V M V P P L P S L 6 9 M V P P L P S L N 6 6 L R V M V P P L P 4 2 A R L R L R V M V 3 3 R L R L R V M V P 3 V12-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S E E P E G C S Y 32 V13-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 L A D P Q E D S G 16 4 T V D V L A D P Q 10 3 V T V D V L A D P 9 2 Q V T V D V L A D 7 V14-HLA-A1-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 S S N P P A S A S 11 9 A S L V A G T L S 8 5 P P A S A S L V A 7 3 S N P P A S A S L 6 7 A S A S L V A G T 6 1 G S S N P P A S A 5

[1037] 33 TABLE XXIII Pos 1 2 3 4 5 6 7 8 9 Score V1-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 145 V L V P P L P S L 31 359 L L F C L L V V V 30 358 A L L F C L L V V 28 362 C L L V V V V V L 28 80 A L L H S K Y G L 26 142 R L R V L V P P L 26 355 V I A A L L F C L 26 351 V V V G V I A A L 24 502 Y I N G R G H L V 24 17 L L L L L L A S F 23 42 V V L G Q D A K L 23 347 S A S V V V V G V 23 15 W L L L L L L L A 22 345 L V S A S V V V V 22 363 L L V V V V V L M 22 446 S T L T T V R E I 22 8 E M W G P E A W L 21 16 L L L L L L L A S 21 344 D L V S A S V V V 21 14 A W L L L L L L L 20 245 L A E A S V R G L 20 260 H I G R E G A M L 20 284 R L D G P L P S G 20 357 A A L L F C L L V 20 460 L L S P G S G R A 20 18 L L L L L A S F T 19 34 L E T S D V V T V 19 71 D A G E G A Q E L 19 112 V L L R N A V Q A 19 152 S L N P G P A L E 19 158 A L E E G Q G L T 19 356 I A A L L F C L L 19 360 L F C L L V V V V 19 361 F C L L V V V V V 19 390 L T L T R E N S I 19 13 E A W L L L L L L 18 138 Q A R L R L R V L 18 266 A M L K C L S E G 18 342 Q V D L V S A S V 18 481 A M N H F V Q E N 18 21 L L A S F T G R C 17 106 N P L D G S V L L 17 113 L L R N A V Q A D 17 139 A R L R L R V L V 17 229 G L L Q D Q R I T 17 234 Q R I T H I L H V 17 244 F L A E A S V R G 17 287 G P L P S G V R V 17 292 G V R V D G D T L 17 299 T L G F P P L T T 17 322 S S R D S Q V T V 17 352 V V G V I A A L L 17 382 M T Q K Y E E E L 17 410 S Q P E E S V G L 17 419 R A E G H P D S L 17 443 R S Y S T L T T V 17 19 L L L L A S F T G 16 35 E T S D V V T V V 16 157 P A L E E G Q G L 16 159 L E E G Q G L T L 16 173 A E G S P A P S V 16 202 A A V T S E F H L 16 203 A V T S E F H L V 16 215 S M N G Q P L T C 16 237 T H I L H V S F L 16 242 V S F L A E A S V 16 285 L D G P L P S G V 16 350 V V V V G V I A A 16 384 Q K Y E E E L T L 16 452 R E I E T Q T E L 16 453 E I E T Q T E L L 16 501 I Y I N G R G H L 16 11 G P E A W L L L L 15 12 P E A W L L L L L 15 20 L L L A S F T G R 15 32 G E L E T S D V V 15 57 D S G E Q V G Q V 15 74 E G A Q E L A L L 15 137 F Q A R L R L R V 15 140 R L R L R V L V P 15 216 M N G Q P L T C V 15 217 N G Q P L T C V V 15 230 L L Q D Q R I T H 15 240 L H V S F L A E A 15 270 C L S E G Q P P P 15 304 P L T T E H S G I 15 309 H S G I Y V C H V 15 332 V L D P Q E D S G 15 493 R A K P T G N G I 15 V2-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 17 8 C L Y R G D S G E 14 5 K L P C L Y R G D 13 4 A K L P C L Y R G 11 V7-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 H T D P R S Q S E 8 8 S Q S E E P E G R 5 1 S H H T D P R S Q 4 7 R S Q S E E P E G 3 V9-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 98 C L L L G L L K V 31 5 L L A G I L L R I 29 65 S L V A G T L S V 29 95 F I Q C L L L G L 26 39 F L E M E S H Y V 21 46 Y V A Q A G L E L 21 47 V A Q A G L E L L 21 91 K A F R F I Q C L 21 99 L L L G L L K V R 20 101 L G L L K V R P L 19 1 M R R E L L A G I 18 58 S N P P A S A S L 18 63 S A S L V A G T L 18 88 K L K K A F R F I 18 18 F L F F F L P F P 17 21 F F L P F P L V V 17 22 F L P F P L V V F 17 54 L L G S S N P P A 17 96 I Q C L L L G L L 17 4 E L L A G I L L R 16 9 I L L R I T F N F 16 44 S H Y V A Q A G L 16 62 A S A S L V A G T 16 6 L A G I L L R I T 15 8 G I L L R I T F N 15 11 L R I T F N F F L 15 100 L L G L L K V R P 15 V10-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 G T S D V V T V V 20 8 L G T S D V V T V 19 5 A G E L G T S D V 15 6 G E L G T S D V V 15 7 E L G T S D V V T 13 3 C P A G E L G T S 10 V11-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 V M V P P L P S L 29 5 R L R V M V P P L 25 2 A R L R L R V M V 17 3 R L R L R V M V P 14 V12-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 C S Y S T L T T V 17 1 V M S E E P E G C 12 6 P E G C S Y S T L 9 8 G C S Y S T L T T 9 V13-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 V L A D P Q E D S 15 3 V T V D V L A D P 12 8 L A D P Q E D S G 10 2 Q V T V D V L A D 9 1 S Q V T V D V L A 8 6 D V L A D P Q E D 7 V14-HLA-A0201-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S N P P A S A S L 18 8 S A S L V A G T L 18 7 A S A S L V A G T 16 1 G S S N P P A S A 10 4 N P P A S A S L V 10 6 P A S A S L V A G 8

[1038] 34 TABLE XXIV Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-A0203-9mers-191P4D12B No Results Found. V2-HLA-A0203-9mers-191P4D12B No Results Found. V7-HLA-A0203-9mers-191P4D12B No Results Found. V9-HLA-A0203-9mers-191P4D12B No Results Found. V10-HLA-A0203-9mers-191P4D12B No Results Found. V11-HLA-A0203-9mers-191P4D12B No Results Found. V12-HLA-A0203-9mers-191P4D12B No Results Found. V13-HLA-A0203-9mers-191P4D12B No Results Found. V14-HLA-A0203-9mers-191P4D12B No Results Found.

[1039] 35 TABLE XXV Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 140 R L R L R V L V P 27 112 V L L R N A V Q A 25 180 S V T W D T E V K 25 41 T V V L G Q D A K 24 111 S V L L R N A V Q 23 294 R V D G D T L G F 23 17 L L L L L L A S F 22 117 A V Q A D E G E Y 22 186 E V K G T T S S R 22 261 I G R E G A M L K 22 358 A L L F C L L V V 22 397 S I R R L H S H H 22 459 E L L S P G S G R 22 61 Q V G Q V A W A R 21 78 E L A L L H S K Y 21 362 C L L V V V V V L 21 415 S V G L R A E G H 21 69 R V D A G E G A Q 20 144 R V L V P P L P S 20 152 S L N P G P A L E 20 230 L L Q D Q R I T H 20 292 G V R V D G D T L 20 316 H V S N E F S S R 20 345 L V S A S V V V V 20 391 T L T R E N S I R 20 500 G I Y I N G R G H 20 18 L L L L L A S F T 19 20 L L L A S F T G R 19 97 R V E Q P P P P R 19 107 P L D G S V L L R 19 243 S F L A E A S V R 19 249 S V R G L E D Q N 19 252 G L E D Q N L W H 19 342 Q V D L V S A S V 19 349 S V V V V G V I A 19 366 V V V V L M S R Y 19 377 R K A Q Q M T Q K 19 485 F V Q E N G T L R 19 33 E L E T S D V V T 18 64 Q V A W A R V D A 18 77 Q E L A L L H S K 18 128 R V S T F P A G S 18 209 H L V P S R S M N 18 260 H I G R E G A M L 18 284 R L D G P L P S G 18 299 T L G F P P L T T 18 311 G I Y V C H V S N 18 344 D L V S A S V V V 18 354 G V I A A L L F C 18 359 L L F C L L V V V 18 365 V V V V V L M S R 18 417 G L R A E G H P D 18 450 T V R E I E T Q T 18 491 T L R A K P T G N 18 2 P L S L G A E M W 17 16 L L L L L L L A S 17 19 L L L L A S F T G 17 42 V V L G Q D A K L 17 89 H V S P A Y E G R 17 142 R L R V L V P P L 17 146 L V P P L P S L N 17 158 A L E E G Q G L T 17 164 G L T L A A S C T 17 351 V V V G V I A A L 17 368 V V L M S R Y H R 17 15 W L L L L L L L A 16 81 L L H S K Y G L H 16 197 K H S R S A A V T 16 224 V V S H P G L L Q 16 235 R I T H I L H V S 16 239 I L H V S F L A E 16 244 F L A E A S V R G 16 288 P L P S G V R V D 16 352 V V G V I A A L L 16 369 V L M S R Y H R R 16 420 A E G H P D S L K 16 426 S L K D N S S C S 16 460 L L S P G S G R A 16 39 V V T V V L G Q D 15 80 A L L H S K Y G L 15 105 R N P L D G S V L 15 113 L L R N A V Q A D 15 145 V L V P P L P S L 15 166 T L A A S C T A E 15 200 R S A A V T S E F 15 313 Y V C H V S N E F 15 327 Q V T V D V L D P 15 332 V L D P Q E D S G 15 363 L L V V V V V L M 15 364 L V V V V V L M S 15 367 V V V L M S R Y H 15 373 R Y H R R K A Q Q 15 400 R L H S H H T D P 15 437 S E E P E G R S Y 15 487 Q E N G T L R A K 15 502 Y I N G R G H L V 15 38 D V V T V V L G Q 14 87 G L H V S P A Y E 14 189 G T T S S R S F K 14 198 H S R S A A V T S 14 21 Q P L T C V V S H 14 220 P L T C V V S H P 14 241 H V S F L A E A S 14 384 Q K Y E E E L T L 14 396 N S I R R L H S H 14 409 R S Q P E E S V G 14 4 S L G A E M W G P 13 43 V L G Q D A K L P 13 49 K L P C F Y R G D 13 84 S K Y G L H V S P 13 124 E Y E C R V S T F 13 139 A R L R L R V L V 13 203 A V T S E F H L V 13 210 L V P S R S M N G 13 236 I T H I L H V S F 13 257 N L W H I G R E G 13 270 C L S E G Q P P P 13 304 P L T T E H S G I 13 322 S S R D S Q V T V 13 329 T V D V L D P Q E 13 331 D V L D P Q E D S 13 333 L D P Q E D S G K 13 350 V V V V G V I A A 13 370 L M S R Y H R R K 13 374 Y H R R K A Q Q M 13 443 R S Y S T L T T V 13 477 G I K Q A M N H F 13 V2-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 C L Y R G D S G E 22 5 K L P C L Y R G D 13 2 Q D A K L P C L Y 10 V7-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 H H T D P R S Q S 8 3 H T D P R S Q S E 7 8 S Q S E E P E G R 7 4 T D P R S Q S E E 6 1 S H H T D P R S Q 4 7 R S Q S E E P E G 4 5 D P R S Q S E E P 3 V9-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 66 L V A G T L S V H 24 103 L L K V R P L Q H 24 4 E L L A G I L L R 23 22 F L P F P L V V F 22 99 L L L G L L K V R 22 105 K V R P L Q H Q G 22 9 I L L R I T F N F 21 97 Q C L L L G L L K 21 65 S L V A G T L S V 20 51 G L E L L G S S N 19 10 L L R I T F N F F 18 98 C L L L G L L K V 18 46 Y V A Q A G L E L 17 83 T K R K K K L K K 17 108 P L Q H Q G V N S 17 5 L L A G I L L R I 16 7 A G I L L R I T F 16 12 R I T F N F F L F 16 27 L V V F F I Y F Y 16 31 F I Y F Y F Y F F 16 82 F T K R K K K L K 15 100 L L G L L K V R P 15 8 G I L L R I T F N 14 26 P L V V F F I Y F 14 28 V V F F I Y F Y F 14 53 E L L G S S N P P 14 72 S V H H C A C F E 14 76 C A C F E S F T K 14 88 K L K K A F R F I 14 102 G L L K V R P L Q 14 113 G V N S C D C E R 14 126 G I F M Q A A P W 14 21 F F L P F P L V V 13 86 K K K L K K A F R 13 87 K K L K K A F R F 13 38 F F L E M E S H Y 12 80 E S F T K R K K K 12 23 L P F P L V V F F 11 57 S S N P P A S A S 11 63 S A S L V A G T L 11 70 T L S V H H C A C 11 95 F I Q C L L L G L 11 107 R P L Q H Q G V N 11 121 R G Y F Q G I F M 11 V10-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 E L G T S D V V T 18 2 R C P A G E L G T 11 5 A G E L G T S D V 9 3 C P A G E L G T S 8 6 G E L G T S D V V 8 8 L G T S D V V T V 8 V11-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 R L R L R V M V P 25 7 R V M V P P L P S 18 5 R L R V M V P P L 17 9 M V P P L P S L N 17 2 A R L R L R V M V 14 1 Q A R L R L R V M 12 V12-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S E E P E G C S Y 15 9 C S Y S T L T T V 9 6 P E G C S Y S T L 7 8 G C S Y S T L T T 7 V13-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 Q V T V D V L A D 16 9 A D P Q E D S G K 16 6 D V L A D P Q E D 15 4 T V D V L A D P Q 13 7 V L A D P Q E D S 12 V14-HLA-A03-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 S S N P P A S A S 11 8 S A S L V A G T L 11 3 S N P P A S A S L 9 9 A S L V A G T L S 9 4 N P P A S A S L V 8 5 P P A S A S L V A 8 1 G S S N P P A S A 7 6 P A S A S L V A G 7 7 A S A S L V A G T 7

[1040] 36 TABLE XXVI Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 38 D V V T V V L G Q 27 351 V V V G V I A A L 27 366 V V V V L M S R Y 26 13 E A W L L L L L L 24 124 E Y E C R V S T F 24 223 C V V S H P G L L 24 455 E T Q T E L L S P 24 35 E T S D V V T V V 23 78 E L A L L H S K Y 23 74 E G A Q E L A L L 22 186 E V K G T T S S R 22 305 L T T E H S G I Y 22 453 E I E T Q T E L L 22 117 A V Q A D E G E Y 21 292 G V R V D G D T L 20 325 D S Q V T V D V L 20 350 V V V V G V I A A 20 352 V V G V I A A L L 20 364 L V V V V V L M S 20 42 V V L G Q D A K L 19 184 D T E V K G T T S 19 294 R V D G D T L G F 19 331 D V L D P Q E D S 19 337 E D S G K Q V D L 19 354 G V I A A L L F C 19 365 V V V V V L M S R 19 8 E M W G P E A W L 18 60 E Q V G Q V A W A 18 71 D A G E G A Q E L 18 145 V L V P P L P S L 18 236 I T H I L H V S F 18 237 T H I L H V S F L 18 313 Y V C H V S N E F 18 449 T T V R E I E T Q 18 39 V V T V V L G Q D 17 328 V T V D V L D P Q 17 355 V I A A L L F C L 17 41 T V V L G Q D A K 16 57 D S G E Q V G Q V 16 130 S T F P A G S F Q 16 298 D T L G F P P L T 16 327 Q V T V D V L D P 16 349 S V V V V G V I A 16 382 M T Q K Y E E E L 16 450 T V R E I E T Q T 16 413 E E S V G L R A E 15 414 E S V G L R A E G 15 473 D Q D E G I K Q A 15 12 P E A W L L L L L 14 14 A W L L L L L L L 14 17 L L L L L L A S F 14 40 V T V V L G Q D A 14 160 E E G Q G L T L A 14 260 H I G R E G A M L 14 345 L V S A S V V V V 14 367 V V V L M S R Y H 14 387 E E E L T L T R E 14 437 S E E P E G R S Y 14 452 R E I E T Q T E L 14 472 E D Q D E G I K Q 14 476 E G I K Q A M N H 14 484 H F V Q E N G T L 14 485 F V Q E N G T L R 14 11 G P E A W L L L L 13 45 G Q D A K L P C F 13 109 D G S V L L R N A 13 135 G S F Q A R L R L 13 142 R L R V L V P P L 13 146 L V P P L P S L N 13 161 E G Q G L T L A A 13 222 T C V V S H P G L 13 249 S V R G L E D Q N 13 320 E F S S R D S Q V 13 329 T V D V L D P Q E 13 344 D L V S A S V V V 13 353 V G V I A A L L F 13 393 T R E N S I R R L 13 421 E G H P D S L K D 13 438 E E P E G R S Y S 13 446 S T L T T V R E I 13 459 E L L S P G S G R 13 501 I Y I N G R G H L 13 V2-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 13 2 Q D A K L P C L Y 11 3 D A K L P C L Y R 9 V7-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 H T D P R S Q S E 10 5 D P R S Q S E E P 9 2 H H T D P R S Q S 4 V9-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 27 L V V F F I Y F Y 28 28 V V F F I Y F Y F 24 13 I T F N F F L F F 21 46 Y V A Q A G L E L 20 120 E R G Y F Q G I F 19 23 L P F P L V V F F 18 95 F I Q C L L L G L 18 80 E S F T K R K K K 16 91 K A F R F I Q C L 16 4 E L L A G I L L R 15 7 A G I L L R I T F 15 66 L V A G T L S V H 15 12 R I T F N F F L F 14 29 V F F I Y F Y F Y 14 96 I Q C L L L G L L 14 14 T F N F F L F F F 13 15 F N F F L F F F L 13 19 L F F F L P F P L 13 26 P L V V F F I Y F 13 38 F F L E M E S H Y 13 93 F R F I Q C L L L 13 101 L G L L K V R P L 13 105 K V R P L Q H Q G 13 V10-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 G T S D V V T V V 13 7 E L G T S D V V T 10 8 L G T S D V V T V 7 3 C P A G E L G T S 6 V11-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 V M V P P L P S L 18 9 M V P P L P S L N 13 5 R L R V M V P P L 12 7 R V M V P P L P S 11 V12-HLA-A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S E E P E G C S Y 14 4 E E P E G C S Y S 13 5 E P E G C S Y S T 11 7 E G C S Y S T L T 11 6 P E G C S Y S T L 10 9 C S Y S T L T T V 6 V13-HLA- A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 D V L A D P Q E D 18 2 Q V T V D V L A D 17 3 V T V D V L A D P 17 4 T V D V L A D P Q 12 V14-HLA- A26-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S N P P A S A S L 11 8 S A S L V A G T L 11 7 A S A S L V A T G 6 6 P A S A S L V A G 5

[1041] 37 TABLE XXVII Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 100 Q P P P P R N P L 26 11 G P E A W L L L L 23 277 P P S Y N W T R L 23 106 N P L D G S V L L 22 287 G P L P S G V R V 20 495 K P T G N G I Y I 20 150 L P S L N P G P A 19 439 E P E G R S Y S T 19 1 M P L S L G A E M 18 8 E M W G P E A W L 17 275 Q P P P S Y N W T 17 289 L P S G V R V D G 17 337 E D S G K Q V D L 17 142 R L R V L V P P L 16 151 P S L N P G P A L 16 26 T G R C P A G E L 15 36 T S D V V T V V L 15 73 G E G A Q E L A L 15 103 P P R N P L D G S 15 132 F P A G S F Q A R 15 145 V L V P P L P S L 15 147 V P P L P S L N P 15 159 L E E G Q G L T L 15 14 A W L L L L L L L 14 176 S P A P S V T W D 14 178 A P S V T W D T E 14 213 S R S M N G Q P L 14 351 V V V G V I A A L 14 362 C L L V V V V V L 14 12 P E A W L L L L L 13 13 E A W L L L L L L 13 29 C P A G E L E T S 13 42 V V L G Q D A K L 13 74 E G A Q E L A L L 13 91 S P A Y E G R V E 13 105 R N P L D G S V L 13 135 G S F Q A R L R L 13 138 Q A R L R L R V L 13 161 E G Q G L T L A A 13 173 A E G S P A P S V 13 219 Q P L T C V V S H 13 260 H I G R E G A M L 13 263 R E G A M L K C L 13 292 G V R V D G D T L 13 294 R V D G D T L G F 13 297 G D T L G F P P L 13 345 L V S A S V V V V 13 356 I A A L L F C L L 13 419 R A E G H P D S L 13 462 S P G S G R A E E 13 9 M W G P E A W L L 12 10 W G P E A W L L L 12 35 E T S D V V T V V 12 80 A L L H S K Y G L 12 82 L H S K Y G L H V 12 101 P P P P R N P L D 12 102 P P P R N P L D G 12 133 P A G S F Q A R L 12 148 P P L P S L N P G 12 154 N P G P A L E E G 12 202 A A V T S E F H L 12 211 V P S R S M N G Q 12 237 T H I L H V S F L 12 245 L A E A S V R G L 12 299 T L G F P P L T T 12 324 R D S Q V T V D V 12 325 D S Q V T V D V L 12 352 V V G V I A A L L 12 355 V I A A L L F C L 12 384 Q K Y E E E L T L 12 407 D P R S Q P E E S 12 410 S Q P E E S V G L 12 452 R E I E T Q T E L 12 453 E I E T Q T E L L 12 501 I Y I N G R G H L 12 V2-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 13 6 L P C L Y R G D S 11 V7-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 D P R S Q S E E P 12 V9-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 23 L P F P L V V F F 21 60 P P A S A S L V A 20 59 N P P A S A S L V 17 46 Y V A Q A G L E L 14 92 A F R F I Q C L L 14 3 R E L L A G I L L 12 15 F N F F L F F F L 12 22 F L P F P L V V F 12 32 I Y F Y F Y F F L 12 56 G S S N P P A S A 12 58 S N P P A S A S L 12 63 S A S L V A G T L 12 93 F R F I Q C L L L 12 95 F I Q C L L L G L 12 101 L G L L K V R P L 12 107 R P L Q H Q G V N 12 2 R R E L L A G I L 11 5 L L A G I L L R I 11 11 L R I T F N F F L 11 13 I T F N F F L F F 11 19 L F F F L P F P L 11 20 F F F L P F P L V 11 25 F P L V V F F I Y 11 44 S H Y V A Q A G L 11 4 V A Q A G L E L L 11 62 A S A S L V A G T 11 81 S F T K R K K K L 11 91 K A F R F I Q C L 11 96 I Q C L L L G L L 11 119 C E R G Y F Q G I 11 129 M Q A A P W E G T 11 10 L L R I T F N F F 10 17 F F L F F F L P F 10 21 F F L P F P L V V 10 42 M E S H Y V A Q A 10 65 S L V A G T L S V 10 88 K L K K A F R F I 10 V10-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 C P A G E L G T S 13 7 E L G T S D V V T 11 9 G T S D V V T V V 11 2 R C P A G E L G T 10 5 A G E L G T S D V 9 6 G E L G T S D V V 9 8 L G T S D V V T V 9 V11-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 R L R V M V P P L 16 8 V M V P P L P S L 15 2 A R L R L R V M V 11 1 Q A R L R L R V M 9 7 R V M V P P L P S 8 V12-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 E P E G C S Y S T 19 6 P E G C S Y S T L 11 8 G C S Y S T L T T 11 V13-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 S Q V T V D V L A 8 2 Q V T V D V L A D 4 7 V L A D P Q E D S 4 V14-HLA-B0702-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 P P A S A S L V A 20 4 N P P A S A S L V 17 1 G S S N P P A S A 12 3 S N P P A S A S L 12 8 S A S L V A G T L 12 7 A S A S L V A G T 11

[1042] 38 TABLE XXVIII Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 138 Q A R L R L R V L 29 142 R L R V L V P P L 24 337 E D S G K Q V D L 23 140 R L R L R V L V P 22 491 T L R A K P T G N 22 477 G I K Q A M N H F 21 493 R A K P T G N G I 20 362 C L L V V V V V L 19 292 G V R V D G D T L 18 426 S L K D N S S C S 18 11 G P E A W L L L L 17 13 E A W L L L L L L 17 26 T G R C P A G E L 17 45 G Q D A K L P C F 17 71 D A G E G A Q E L 17 106 N P L D G S V L L 17 124 E Y E C R V S T F 17 145 V L V P P L P S L 17 27 P P S Y N W T R L 17 80 A L L H S K Y G L 16 81 L L H S K Y G L H 16 100 Q P P P P R N P L 16 157 P A L E E G Q G L 16 247 E A S V R G L E D 16 265 G A M L K C L S E 16 267 M L K C L S E G Q 16 356 I A A L L F C L L 16 374 Y H R R K A Q Q M 16 439 E P E G R S Y S T 16 453 E I E T Q T E L L 16 47 D A K L P C F Y R 15 65 V A W A R V D A G 15 101 P P P P R N P L D 15 231 L Q D Q R I T H I 15 245 L A E A S V R G L 15 260 H I G R E G A M L 15 355 V I A A L L F C L 15 369 V L M S R Y H R R 15 410 S Q P E E S V G L 15 113 L L R N A V Q A D 14 133 P A G S F Q A R L 14 202 A A V T S E F H L 14 390 L T L T R E N S I 14 419 R A E G H P D S L 14 V2-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 21 3 D A K L P C L Y R 15 V7-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 D P R S Q S E E P 13 3 H T D P R S Q S E 9 V9-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 103 L L K V R P L Q H 25 82 F T K R K K K L K 22 88 K L K K A F R F I 22 101 L G L L K V R P L 22 811 S F T K R K K K L 21 84 K R K K K L K K A 21 86 K K K L K K A F R 21 10 L L R I T F N F F 18 85 R K K K L K K A F 18 63 S A S L V A G T L 17 83 T K R K K K L K K 16 87 K K L K K A F R F 16 92 A F R F I Q C L L 16 8 G I L L R I T F N 15 47 V A Q A G L E L L 15 91 K A F R F I Q C L 15 V9-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 95 F I Q C L L L G L 15 1 M R R E L L A G I 14 22 F L P F P L V V F 14 23 L P F P L V V F F 14 9 I L L R I T F N F 13 26 P L V V F F I Y F 13 44 S H Y V A Q A G L 13 80 E S F T K R K K K 13 5 L L A G I L L R I 12 32 I Y F Y F Y F F L 12 58 S N P P A S A S L 12 96 I Q C L L L G L L 12 119 C E R G Y F Q G I 12 V10-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 E L G T S D V V T 9 3 C P A G E L G T S 6 4 P A G E L G T S D 6 V11-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 R L R V M V P P L 24 3 R L R L R V M V P 22 1 Q A R L R L R V M 19 8 V M V P P L P S L 11 V12-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 P E G C S Y S T L 10 5 E P E G C S Y S T 8 4 E E P E G C S Y S 4 V13-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 V L A D P Q E D S 7 8 L A D P Q E D S G 4 1 S Q V T V D V L A 3 2 Q V T V D V L A D 3 V14-HLA-B08-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 S A S L V A G T L 17 3 S N P P A S A S L 12

[1043] 39 TABLE XXIX Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 237 T H I L H V S F L 22 208 F H L V P S R S M 20 259 W H I G R E G A M 18 374 Y H R R K A Q Q M 17 393 T R E N S I R R L 17 36 T S D V V T V V L 16 362 C L L V V V V V L 16 135 G S F Q A R L R L 15 308 E H S G I Y V C H 15 337 E D S G K Q V D L 15 100 Q P P P P R N P L 14 106 N P L D G S V L L 14 138 Q A R L R L R V L 14 145 V L V P P L P S L 14 245 L A E A S V R G L 14 277 P P S Y N W T R L 14 325 D S Q V T V D V L 14 501 I Y I N G R G H L 14 8 E M W G P E A W L 13 26 T G R C P A G E L 13 71 D A G E G A Q E L 13 74 E G A Q E L A L L 13 142 R L R V L V P P L 13 151 P S L N P G P A L 13 159 L E E G Q G L T L 13 197 K H S R S A A V T 13 222 T C V V S H P G L 13 292 G V R V D G D T L 13 297 G D T L G F P P L 13 351 V V V G V I A A L 13 356 I A A L L F C L L 13 403 S H H T D P R S Q 13 404 H H T D P R S Q P 13 410 S Q P E E S V G L 13 419 R A E G H P D S L 13 9 M W G P E A W L L 12 11 G P E A W L L L L 12 73 G E G A Q E L A L 12 82 L H S K Y G L H V 12 88 L H V S P A Y E G 12 105 R N P L D G S V L 12 133 P A G S F Q A R L 12 213 S R S M N G Q P L 12 382 M T Q K Y E E E L 12 384 Q K Y E E E L T L 12 422 G H P D S L K D N 12 452 R E I E T Q T E L 12 453 E I E T Q T E L L 12 484 H F V Q E N G T L 12 10 W G P E A W L L L 11 12 P E A W L L L L L 11 13 E A W L L L L L L 11 42 V V L G Q D A K L 11 80 A L L H S K Y G L 11 157 P A L E E G Q G L 11 223 C V V S H P G L L 11 226 S H P G L L Q D Q 11 240 L H V S F L A E A 11 315 C H V S N E F S S 11 352 V V G V I A A L L 11 355 V I A A L L F C L 11 401 L H S H H T D P R 11 440 P E G R S Y S T L 11 483 N H F V Q E N G T 11 14 A W L L L L L L L 10 124 E Y E C R V S T F 10 202 A A V T S E F H L 10 232 Q D Q R I T H I L 10 236 I T H I L H V S F 10 250 V R G L E D Q N L 10 260 H I G R E G A M L 10 263 R E G A M L K C L 10 281 N W T R L D G P L 10 363 L L V V V V V L M 10 474 Q D E G I K Q A M 10 V2-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 12 V7-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 S H H T D P R S Q 13 2 H H T D P R S Q S 13 V9-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 44 S H Y V A Q A G L 21 74 H H C A C F E S F 16 46 Y V A Q A G L E L 14 101 L G L L K V R P L 13 32 I Y F Y F Y F F L 12 58 S N P P A S A S L 12 63 S A S L V A G T L 12 81 S F T K R K K K L 12 96 I Q C L L L G L L 12 2 R R E L L A G I L 11 19 L F F F L P F P L 11 22 F L P F P L V V F 11 23 L P F P L V V F F 11 47 V A Q A G L E L L 11 73 V H H C A C F E S 11 91 K A F R F I Q C L 11 110 Q H Q G V N S C D 11 3 R E L L A G I L L 10 11 L R I T F N F F L 10 15 F N F F L F F F L 10 92 A F R F I Q C L L 10 93 F R F I Q C L L L 10 95 F I Q C L L L G L 10 V10-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 G T S D V V T V V 6 7 E L G T S D V V T 5 6 G E L G T S D V V 4 8 L G T S D V V T V 4 1 G R C P A G E L G 3 3 C P A G E L G T S 3 5 A G E L G T S D V 2 V11-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 V M V P P L P S L 14 5 R L R V M V P P L 13 1 Q A R L R L R V M 10 V12-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 P E G C S Y S T L 11 V13-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 Q V T V D V L A D 3 7 V L A D P Q E D S 3 1 S Q V T V D V L A 2 4 T V D V L A D P Q 2 6 D V L A D P Q E D 2 8 L A D P Q E D S G 2 3 V T V D V L A D P 1 5 V D V L A D P Q E 1 9 A D P Q E D S G K 1 V14-HLA-B1510-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S N P P A S A S L 12 8 S A S L V A G T L 12

[1044] 40 TABLE XXX Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight 393 T R E N S I R R L 26 250 V R G L E D Q N L 25 452 R E I E T Q T E L 22 135 G S F Q A R L R L 21 213 S R S M N G Q P L 20 377 R K A Q Q M T Q K 19 42 V V L G Q D A K L 18 97 R V E Q P P P P R 18 262 G R E G A M L K C 18 351 V V V G V I A A L 18 376 R R K A Q Q M T Q 18 399 R R L H S H H T D 18 14 A W L L L L L L L 17 17 L L L L L L A S F 17 105 R N P L D G S V L 17 142 R L R V L V P P L 17 200 R S A A V T S E F 17 206 S E F H L V P S R 17 294 R V D G D T L G F 17 297 G D T L G F P P L 17 419 R A E G H P D S L 17 498 G N G I Y I N G R 17 41 T V V L G Q D A K 16 45 G Q D A K L P C F 16 80 A L L H S K Y G L 16 96 G R V E Q P P P P 16 106 N P L D G S V L L 16 145 V L V P P L P S L 16 234 Q R I T H I L H V 16 243 S F L A E A S V R 16 261 I G R E G A M L K 16 293 V R V D G D T L G 16 301 G F P P L T T E H 16 337 E D S G K Q V D L 16 362 C L L V V V V V L 16 384 Q K Y E E E L T L 16 442 G R S Y S T L T T 16 476 E G I K Q A M N H 16 477 G I K Q A M N H F 16 484 H F V Q E N G T L 16 11 G P E A W L L L L 15 20 L L L A S F T G R 15 61 Q V G Q V A W A R 15 71 D A G E G A Q E L 15 74 E G A Q E L A L L 15 75 G A Q E L A L L H 15 77 Q E L A L L H S K 15 10 P L D G S V L L R 15 133 P A G S F Q A R L 15 139 A R L R L R V L V 15 141 L R L R V L V P P 15 188 K G T T S S R S F 15 189 G T T S S R S F K 15 227 H P G L L Q D Q R 15 237 T H I L H V S F L 15 263 R E G A M L K C L 15 283 T R L D G P L P S 15 333 L D P Q E D S G K 15 365 V V V V V L M S R 15 392 L T R E N S I R R 15 466 G R A E E E E D Q 15 492 L R A K P T G N G 15 501 I Y I N G R G H L 15 8 E M W G P E A W L 14 9 M W G P E A W L L 14 13 E A W L L L L L L 14 27 G R C P A G E L E 14 73 G E G A Q E L A L 14 104 P R N P L D G S V 14 114 L R N A V Q A D E 14 120 A D E G E Y E C R 14 143 L R V L V P P L P 14 151 P S L N P G P A L 14 157 P A L E E G Q G L 14 159 L E E G Q G L T L 14 186 E V K G T T S S R 14 193 S R S F K H S R S 14 199 S R S A A V T S E 14 236 I T H I L H V S F 14 277 P P S Y N W T R L 14 286 D G P L P S G V R 14 292 G V R V D G D T L 14 313 Y V C H V S N E F 14 323 S R D S Q V T V D 14 368 V V L M S R Y H R 14 375 H R R K A Q Q M T 14 378 K A Q Q M T Q K Y 14 386 Y E E E L T L T R 14 408 P R S Q P E E S V 14 410 S Q P E E S V G L 14 418 L R A E G H P D S 14 420 A E G H P D S L K 14 444 S Y S T L T T V R 14 459 E L L S P G S G R 14 1 M P L S L G A E M 13 12 P E A W L L L L L 13 26 T G R C P A G E L 13 36 T S D V V T V V L 13 78 E L A L L H S K Y 13 86 Y G L H V S P A Y 13 100 Q P P P P R N P L 13 124 E Y E C R V S T F 13 129 V S T F P A G S F 13 132 F P A G S F Q A R 13 138 Q A R L R L R V L 13 202 A A V T S E F H L 13 208 F H L V P S R S M 13 219 Q P L T C V V S H 13 222 T C V V S H P G L 13 231 L Q D Q R I T H I 13 252 G L E D Q N L W H 13 272 S E G Q P P P S Y 13 276 P P P S Y N W T R 13 316 H V S N E F S S R 13 352 V V G V I A A L L 13 353 V G V I A A L L F 13 356 I A A L L F C L L 13 366 V V V V L M S R Y 13 382 M T Q K Y E E E L 13 391 T L T R E N S I R 13 394 R E N S I R R L H 13 398 I R R L H S H H T 13 411 Q P E E S V G L R 13 428 K D N S S C S V M 13 440 P E G R S Y S T L 13 485 F V Q E N G T L R 13 487 Q E N G T L R A K 13 500 G I Y I N G R G H 13 10 W G P E A W L L L 12 47 D A K L P C F Y R 12 54 Y R G D S G E Q V 12 68 A R V D A G E G A 12 127 C R V S T F P A G 12 134 A G S F Q A R L R 12 192 S S R S F K H S R 12 228 P G L L Q D Q R I 12 245 L A E A S V R G L 12 255 D Q N L W H I G R 12 259 W H I G R E G A M 12 260 H I G R E G A M L 12 281 N W T R L D G P L 12 308 E H S G I Y V C H 12 325 D S Q V T V D V L 12 355 V I A A L L F C L 12 363 L L V V V V V L M 12 369 V L M S R Y H R R 12 370 L M S R Y H R R K 12 372 S R Y H R R K A Q 12 396 N S I R R L H S H 12 435 V M S E E P E G R 12 451 V R E I E T Q T E 12 471 E E D Q D E G I K 12 474 Q D E G I K Q A M 12 493 R A K P T G N G I 12 494 A K P T G N G I Y 12 V2-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 16 3 D A K L P C L Y R 13 2 Q D A K L P C L Y 11 4 A K L P C L Y R G 8 V7-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 P R S Q S E E P E 13 8 S Q S E E P E G R 12 7 R S Q S E E P E G 7 V9-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 R R E L L A G I L 27 93 F R F I Q C L L L 24 11 L R I T F N F F L 23 120 E R G Y F Q G I F 22 1 M R R E L L A G I 20 77 A C F E S F T K R 20 87 K K L K K A F R F 20 3 R E L L A G I L L 18 1 E L L A G I L L R 18 84 K R K K K L K K A 18 85 R K K K L K K A F 18 91 K A F R F I Q C L 18 7 A G I L L R I T F 17 23 L P F P L V V F F 17 83 T K R K K K L K K 17 99 L L L G L L K V R 17 9 I L L R I T F N F 16 80 E S F T K R K K K 16 86 K K K L K K A F R 16 13 I T F N F F L F F 15 44 S H Y V A Q A G L 15 81 S F T K R K K K L 15 97 Q C L L L G L L K 15 101 L G L L K V R P L 15 113 G V N S C D C E R 15 121 R G Y F Q G I F M 15 12 R I T F N F F L F 14 15 F N F F L F F F L 14 19 L F F F L P F P L 14 22 F L P F P L V V F 14 28 V V F F I Y F Y F 14 32 I Y F Y F Y F F L 14 37 Y F F L E M E S H 14 46 Y V A Q A G L E L 14 58 S N P P A S A S L 14 63 S A S L V A G T L 14 92 A F R F I Q C L L 14 96 I Q C L L L G L L 14 5 L L A G I L L R I 13 17 F F L F F F L P F 13 27 L V V F F I Y F Y 13 31 F I Y F Y F Y F F 13 34 F Y F Y F F L E M 13 47 V A Q A G L E L L 13 66 L V A G T L S V H 13 76 C A C F E S F T K 13 79 F E S F T K R K K 13 95 F I Q C L L L G L 13 122 G Y F Q G I F M Q 13 V10-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G R C P A G E L G 14 6 G E L G T S D V V 9 9 G T S D V V T V V 8 2 R C P A G E L G T 7 3 C P A G E L G T S 5 4 P A G E L G T S D 5 5 A G E L G T S D V 5 V11-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 R L R V M V P P L 16 8 V M V P P L P S L 16 2 A R L R L R V M V 15 4 L R L R V M V P P 14 6 L R V M V P P L P 13 1 Q A R L R L R V M 11 3 R L R L R V M V P 8 V12-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 P E G C S Y S T L 13 3 S E E P E G C S Y 11 8 G C S Y S T L T T 6 9 C S Y S T L T T V 6 V13-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 A D P Q E D S G K 16 V14-HLA-B2705-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S N P P A S A S L 14 8 S A S L V A G T L 14 1 G S S N P P A S A 6

[1045] 41 TABLE XXXI Start Subsequence Score V1-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 139 ARLRLRVLV 22 250 VRGLEDQNL 21 393 TRENSIRRL 21 213 SRSMNGQPL 20 234 QRITHILHV 20 54 YRGDSGEQV 19 104 PRNPLDGSV 19 408 PRSQPEESV 18 135 GSFQARLRL 17 142 RLRVLVPPL 16 287 GPLPSGVRV 16 399 RRLHSHHTD 16 96 GRVEQPPPP 15 105 RNPLDGSVL 15 297 GDTLGFPPL 15 443 RSYSTLTTV 15 452 REIETQTEL 15 11 GPEAWLLLL 14 14 AWLLLLLLL 14 27 GRCPAGELE 14 73 GEGAQELAL 14 80 ALLHSKYGL 14 262 GREGAMLKC 14 263 REGAMLKCL 14 292 GVRVDGDTL 14 294 RVDGDTLGF 14 362 CLLVVVVVL 14 376 RRKAQQMTQ 14 419 RAEGHPDSL 14 442 GRSYSTLTT 14 32 GELETSDVV 13 34 LETSDVVTV 13 106 NPLDGSVLL 13 127 CRVSTFPAG 13 141 LRLRVLVPP 13 145 VLVPPLPSL 13 151 PSLNPGPAL 13 283 TRLDGPLPS 13 324 RDSQVTVDV 13 384 QKYEEELTL 13 466 GRAEEEEDQ 13 493 RAKPTGNGI 13 9 MWGPEAWLL 12 42 VVLGQDAKL 12 45 GQDAKLPCF 12 68 ARVDAGEGA 12 110 GSVLLRNAV 12 133 PAGSFQARL 12 143 LRVLVPPLP 12 157 PALEEGQGL 12 173 AEGSPAPSV 12 200 RSAAVTSEF 12 202 AAVTSEFHL 12 222 TCVVSHPGL 12 223 CVVSHPGLL 12 237 THILHVSFL 12 323 SRDSQVTVD 12 352 VVGVIAALL 12 357 AALLFCLLV 12 358 ALLFCLLVV 12 361 FCLLVVVVV 12 372 SRYHRRKAQ 12 501 IYINGRGHL 12 1 MPLSLGAEM 11 10 WGPEAWLLL 11 12 PEAWLLLLL 11 13 EAWLLLLLL 11 26 TGRCPAGEL 11 36 TSDVVTVVL 11 71 DAGEGAQEL 11 100 QPPPPRNPL 11 159 LEEGQGLTL 11 188 KGTTSSRSF 11 193 SRSFKHSRS 11 199 SRSAAVTSE 11 203 AVTSEFHLV 11 228 PGLLQDQRI 11 232 QDQRITHIL 11 245 LAEASVRGL 11 277 PPSYNWTRL 11 281 NWTRLDGPL 11 293 VRVDGDTLG 11 325 DSQVTVDVL 11 337 EDSGKQVDL 11 343 VDLVSASVV 11 344 DLVSASVVV 11 348 ASVVVVGVI 11 351 VVVGVIAAL 11 353 VGVIAALLF 11 356 IAALLFCLL 11 359 LLFCLLVVV 11 363 LLVVVVVLM 11 398 IRRLHSHHT 11 410 SQPEESVGL 11 418 LRAEGHPDS 11 428 KDNSSCSVM 11 446 STLTTVREI 11 477 GIKQAMNHF 11 484 HFVQENGTL 11 492 LRAKPTGNG 11 495 KPTGNGIYI 11 8 EMWGPEAWL 10 17 LLLLLLASF 10 57 DSGEQVGQV 10 74 EGAQELALL 10 114 LRNAVQADE 10 129 VSTFPAGSF 10 137 FQARLRLRV 10 138 QARLRLRVL 10 208 FHLVPSRSM 10 236 ITHILHVSF 10 242 VSFLAEASV 10 260 HIGREGAML 10 320 EFSSRDSQV 10 345 LVSASVVVV 10 347 SASVVVVGV 10 355 VIAALLFCL 10 360 LFCLLVVVV 10 374 YHRRKAQQM 10 375 HRRKAQQMT 10 382 MTQKYEEEL 10 390 LTLTRENSI 10 440 PEGRSYSTL 10 451 VREIETQTE 10 453 EIETQTELL 10 V2-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 GQDAKLPCL 14 4 AKLPCLYRG 6 V7-HLA-B2709-9mers- 191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 PRSQSEEPE 10 7 RSQSEEPEG 6 V9-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 RRELLAGIL 25 93 FRFIQCLLL 23 11 LRITFNFFL 21 1 MRRELLAGI 18 106 VRPLQHQGV 18 120 ERGYFQGIF 18 3 RELLAGILL 16 87 KKLKKAFRF 14 91 KAFRFIQCL 14 121 RGYFQGIFM 14 9 LLRITFNF 13 12 RITFNFFLF 13 23 LPFPLVVFF 13 32 IYFYFYFFL 13 101 LGLLKVRPL 13 13 ITFNFFLFF 12 15 FNFFLFFFL 12 19 LFFFLPFPL 12 21 FFLPFPLVV 12 44 SHYVAQAGL 12 84 KRKKKLKKA 12 85 RKKKLKKAF 12 92 AFRFIQCLL 12 V10-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 GRCPAGELG 14 6 GELGTSDVV 13 8 LGTSDVVTV 13 V10-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 GTSDVVTVV 12 5 AGELGTSDV 9 V11-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 ARLRLRVMV 22 5 RLRVMVPPL 16 4 LRLRVMVPP 13 8 VMVPPLPSL 13 6 LRVMVPPLP 12 V12-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 CSYSTLTTV 11 6 PEGCSYSTL 10 V13-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 2 QVTVDVLAD 4 5 VDVLADPQE 3 6 DVLADPQED 3 1 SQVTVDVLA 2 3 VTVDVLADP 1 4 TVDVLADPQ 1 8 LADPQEDSG 1 9 ADPQEDSGK 1 V14-HLA-B2709-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 SNPPASASL 11 8 SASLVAGTL 11 4 NPPASASLV 9

[1046] 42 TABLE XXXII Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-B44Q2-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 7 A E M W G P E A W 27 437 S E E P E G R S Y 25 12 P E A W L L L L L 23 59 G E Q V G Q V A W 23 73 G E G A Q E L A L 23 159 L E E G Q G L T L 23 263 R E G A M L K C L 23 452 R E I E T Q T E L 23 272 S E G Q P P P S Y 22 440 P E G R S Y S T L 22 253 L E D Q N L W H I 21 470 E E E D Q D E G I 21 14 A W L L L L L L L 18 413 E E S V G L R A E 17 13 E A W L L L L L L 16 100 Q P P P P R N P L 16 351 V V V G V I A A L 16 388 E E L T L T R E N 16 9 M W G P E A W L L 15 106 N P L D G S V L L 15 124 E Y E C R V S T F 15 138 Q A R L R L R V L 15 237 T H I L H V S F L 15 246 A E A S V R G L E 15 337 E D S G K Q V D L 15 393 T R E N S I R R L 15 453 E I E T Q T E L L 15 487 Q E N G T L R A K 15 494 A K P T G N G I Y 15 501 I Y I N G R G H L 15 36 T S D V V T V V L 14 74 E G A Q E L A L L 14 78 E L A L L H S K Y 14 80 A L L H S K Y G L 14 98 V E Q P P P P R N 14 135 G S F Q A R L R L 14 145 V L V P P L P S L 14 151 P S L N P G P A L 14 160 E E G Q G L T L A 14 173 A E G S P A P S V 14 202 A A V T S E F H L 14 206 S E F H L V P S R 14 232 Q D Q R I T H I L 14 274 G Q P P P S Y N W 14 294 R V D G D T L G F 14 307 T E H S G I Y V C 14 319 N E F S S R D S Q 14 362 C L L V V V V V L 14 387 E E E L T L T R E 14 394 R E N S I R R L H 14 420 A E G H P D S L K 14 438 E E P E G R S Y S 14 2 P L S L G A E M W 13 8 E M W G P E A W L 13 10 W G P E A W L L L 13 11 G P E A W L L L L 13 17 L L L L L L A S F 13 34 L E T S D V V T V 13 42 V V L G Q D A K L 13 77 Q E L A L L H S K 13 86 Y G L H V S P A Y 13 105 R N P L D G S V L 13 117 A V Q A D E G E Y 13 175 G S P A P S V T W 13 188 K G T T S S R S F 13 213 S R S M N G Q P L 13 231 L Q D Q R I T H I 13 251 R G L E D Q N L W 13 348 A S V V V V G V I 13 352 V V G V I A A L L 13 353 V G V I A A L L F 13 356 I A A L L F C L L 13 378 K A Q Q M T Q K Y 13 386 Y E E E L T L T R 13 410 S Q P E E S V G L 13 446 S T L T T V R E I 13 458 T E L L S P G S G 13 468 A E E E E D Q D E 13 471 E E D Q D E G I K 13 V2-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 G Q D A K L P C L 12 2 Q D A K L P C L Y 12 4 A K L P C L Y R G 8 V7-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 H T D P R S Q S E 5 1 S H H T D P R S Q 4 2 H H T D P R S Q S 3 8 S Q S E E P E G R 3 4 T D P R S Q S E E 2 V9-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 R E L L A G I L L 24 7 A G I L L R I T F 20 119 C E R G Y F Q G I 20 23 L P F P L V V F F 17 91 K A F R F I Q C L 17 13 I T F N F F L F F 15 58 S N P P A S A S L 15 63 S A S L V A G T L 15 81 S F T K R K K K L 15 92 A F R F I Q C L L 15 9 I L L R I T F N F 14 11 L R I T F N F F L 14 22 F L P F P L V V F 14 85 R K K K L K K A F 14 93 F R F I Q C L L L 14 101 L G L L K V R P L 14 12 R I T F N F F L F 13 15 F N F F L F F F L 13 17 F F L F F F L P F 13 19 L F F F L P F P L 13 27 L V V F F I Y F Y 13 28 V V F F I Y F Y F 13 29 V F F I Y F Y F Y 13 30 F F I Y F Y F Y F 13 42 M E S H Y V A Q A 13 79 F E S F T K R K K 13 87 K K L K K A F R F 13 96 I Q C L L L G L L 13 115 N S C D C E R G Y 13 116 S C D C E R G Y F 13 126 G I F M Q A A P W 13 2 R R E L L A G I L 12 5 L L A G I L L R I 12 10 L L R I T F N F F 12 25 F P L V V F F I Y 12 26 P L V V F F I Y F 12 32 I Y F Y F Y F F L 12 40 L E M E S H Y V A 12 47 V A Q A G L E L L 12 52 L E L L G S S N P 12 95 F I Q C L L L G L 12 120 E R G Y F Q G I F 12 14 T F N F F L F F F 11 24 P F P L V V F F I 11 31 F I Y F Y F Y F F 11 38 F F L E M E S H Y 11 44 S H Y V A Q A G L 11 46 Y V A Q A G L E L 11 74 H H C A C F E S F 11 88 K L K K A F R F I 11 V10-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 6 G E L G T S D V V 13 V11-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 V M V P P L P S L 14 5 R L R V M V P P L 11 2 A R L R L R V M V 7 9 M V P P L P S L N 6 V12-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S E E P E G C S Y 24 6 P E G C S Y S T L 21 4 E E P E G C S Y S 13 V13-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 S Q V T V D V L A 4 2 Q V T V D V L A D 4 8 L A D P Q E D S G 4 9 A D P Q E D S G K 4 3 V T V D V L A D P 4 T V D V L A D P Q 2 5 V D V L A D P Q E 2 6 D V L A D P Q E D 2 7 V L A D P Q E D S 1 V14-HLA-B4402-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 S N P P A S A S L 15 8 S A S L V A G T L 15 2 S S N P P A S A S 7

[1047] 43 TABLE XXXIIII Pos 1 2 3 4 5 6 7 8 9 score V1-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 71 D A G E G A Q E L 23 245 L A E A S V R G L 23 287 G P L P S G V R V 23 347 S A S V V V V G V 23 493 R A K P T G N G I 22 495 K P T G N G I Y I 22 106 N P L D G S V L L 21 138 Q A R L R L R V L 21 357 A A L L F C L L V 21 157 P A L E E G Q G L 20 11 G P E A W L L L L 19 13 E A W L L L L L L 19 202 A A V T S E F H L 19 228 P G L L Q D Q R I 19 356 I A A L L F C L L 19 361 F C L L V V V V V 19 100 Q P P P P R N P L 18 217 N G Q P L T C V V 18 277 P P S Y N W T R L 18 334 D P Q E D S G K Q 18 345 L V S A S V V V V 18 419 R A E G H P D S L 18 35 E T S D V V T V V 17 92 P A Y E G R V E Q 17 133 P A G S F Q A R L 17 348 A S V V V V G V I 17 443 R S Y S T L T T V 17 446 S T L T T V R E I 17 10 W G P E A W L L L 16 32 G E L E T S D V V 16 57 D S G E Q V G Q V 16 62 V G Q V A W A R V 16 121 D E G E Y E C R V 16 219 Q P L T C V V S H 16 289 L P S G V R V D G 16 325 D S Q V T V D V L 16 343 V D L V S A S V V 16 344 D L V S A S V V V 16 359 L L F C L L V V V 16 360 L F C L L V V V V 16 362 C L L V V V V V L 16 390 L T L T R E N S I 16 34 L E T S D V V T V 15 65 V A W A R V D A G 15 79 L A L L H S K Y G 15 148 P P L P S L N P G 15 231 L Q D Q R I T H I 15 276 P P P S Y N W T R 15 338 D S G K Q V D L V 15 358 A L L F C L L V V 15 384 Q K Y E E E L T L 15 407 D P R S Q P E E S 15 411 Q P E E S V G L R 15 22 L A S F T G R C P 14 26 T G R C P A G E L 14 29 C P A G E L E T S 14 31 A G E L E T S D V 14 47 D A K L P C F Y R 14 75 G A Q E L A L L H 14 82 L H S K Y G L H V 14 91 S P A Y E G R V E 14 132 F P A G S F Q A R 14 172 T A E G S P A P S 14 176 S P A P S V T W D 14 253 L E D Q N L W H I 14 286 D G P L P S G V R 14 302 F P P L T T E H S 14 303 P P L T T E H S G 14 1 M P L S L G A E M 13 30 P A G E L E T S D 13 36 T S D V V T V V L 13 50 L P C F Y R G D S 13 74 E G A Q E L A L L 13 90 V S P A Y E G R V 13 102 P P P R N P L D G 13 147 V P P L P S L N P 13 150 L P S L N P G P A 13 177 P A P S V T W D T 13 178 A P S V T W D T E 13 211 V P S R S M N G Q 13 275 Q P P P S Y N W T 13 300 L G F P P L T T E 13 322 S S R D S Q V T V 13 378 K A Q Q M T Q K Y 13 478 I K Q A M N H F V 13 42 V V L G Q D A K L 12 54 Y R G D S G E Q V 12 86 Y G L H V S P A Y 12 101 P P P P R N P L D 12 1091 D G S V L L R N A 12 119 Q A D E G E Y E C 12 154 N P G P A L E E G 12 159 L E E G Q G L T L 12 167 L A A S C T A E G 12 168 A A S C T A E G S 12 234 Q R I T H I L H V 12 265 G A M L K C L S E 12 309 H S G I Y V C H V 12 339 S G K Q V D L V S 12 467 R A E E E E D Q D 12 480 Q A M N H F V Q E 12 5 L G A E M W G P E 11 58 S G E Q V G Q V A 11 67 W A R V D A G E G 11 103 P P R N P L D G S 11 116 N A V Q A D E G E 11 137 F Q A R L R L R V 11 139 A R L R L R V L V 11 201 S A A V T S E F H 11 216 M N G Q P L T C V 11 247 E A S V R G L E D 11 251 R G L E D Q N L W 11 261 I G R E G A M L K 11 285 L D G P L P S G V 11 296 D G D T L G F P P 11 304 P L T T E H S G I 11 306 T T E H S G I Y V 11 310 S G I Y V C H V S 11 324 R D S Q V T V D V 11 335 P Q E D S G K Q V 11 351 V V V G V I A A L 11 393 T R E N S I R R L 11 427 L K D N S S C S V 11 439 E P E G R S Y S T 11 470 E E E D Q D E G I 11 502 Y I N G R G H L V 11 V2-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 3 D A K L P C L Y R 1 6 L P C L Y R G D S 13 11 IL G Q D A K L P C 9 V7-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 5 D P R S Q S E E P 14 V9-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 59 N P P A S A S L V 23 63 S A S L V A G T L 21 101 L G L L K V R P L 20 47 V A Q A G L E L L 19 911 K A F R F I Q C L 18 5 L L A G I L L R I 16 21 F F L P F P L V V 16 23 L P F P L V V F F 16 25 F P L V V F F I Y 16 24 P F P L V V F F I 15 107 R P L Q H Q G V N 15 1 M R R E L L A G I 14 6 L A G I L L R I T 14 60 P P A S A S L V A 14 61 P A S A S L V A G 14 67 V A G T L S V H H 14 98 C L L L G L L K V 14 88 K L K K A F R F I 13 119 C E R G Y F Q G I 13 49 Q A G L E L L G S 12 76 C A C F E S F T K 12 20 F F F L P F P L V 11 50 A G L E L L G S S 11 121 R G Y F Q G I F M 11 V10-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 L G T S D V V T V 21 9 G T S D V V T V V 17 6 G E L G T S D V V 15 3 C P A G E L G T S 14 5 A G E L G T S D V 14 4 P A G E L G T S D 13 V11-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 1 Q A R L R L R V M 15 2 A R L R L R V M V 11 5 R L R V M V P P L 9 8 V M V P P L P S L 8 4 L R L R V M V P P 7 V12-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 9 C S Y S T L T T V 17 5 E P E G C S Y S T 11 6 P E G C S Y S T L 9 7 E G C S Y S T L T 8 V13-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 8 L A D P Q E D S G 12 6 D V L A D P Q E D 8 3 V T V D V L A D P 5 V14-HLA-B5101-9mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 9 amino acids, and the end position for each peptide is the start position plus eight. 4 N P P A S A S L V 23 8 S A S L V A G T L 21 5 P P A S A S L V A 14 6 P A S A S L V A G 14

[1048] 44 TABLE XXXIV Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 271 L S E G Q P P P S Y 30 436 M S E E P E G R S Y 30 45 G Q D A K L P C F Y 25 405 H T D P R S Q P E E 20 493 R A K P T G N G I Y 20 158 A L E E G Q G L T L 19 11 G P E A W L L L L L 18 72 A G E G A Q E L A L 18 107 P L D G S V L L R N 18 453 E I E T Q T E L L S 18 36 T S D V V T V V L G 17 77 Q E L A L L H S K Y 17 306 T T E H S G I Y V C 17 377 R K A Q Q M T Q K Y 17 411 Q P E E S V G L R A 17 437 S E E P E G R S Y S 17 471 E E D Q D E G I K Q 17 184 D T E V K G T T S S 16 304 P L T T E H S G I Y 16 332 V L D P Q E D S G K 16 365 V V V V V L M S R Y 16 385 K Y E E E L T L T R 16 457 Q T E L L S P G S G 16 85 K Y G L H V S P A Y 15 116 N A V Q A D E G E Y 15 205 T S E F H L V P S R 15 V2-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 G Q D A K L P C L Y 27 V7-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 4 H T D P R S Q S E E 20 V9-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 28 V V F F I Y F Y F Y 19 24 P F P L V V F F I Y 18 2 R R E L L A G I L L 17 37 Y F F L E M E S H Y 17 26 P L V V F F I Y F Y 16 114 V N S C D C E R G Y 16 82 F T K R K K K L K K 15 39 F L E M E S H Y V A 13 116 S C D C E R G Y F Q 13 118 D C E R G Y F Q G I 13 78 C F E S F T K R K K 12 33 Y F Y F Y F F L E M 11 41 E M E S H Y V A Q A 11 51 G L E L L G S S N P 11 64 A S L V A G T L S V 11 57 S S N P P A S A S L 10 12 R I T F N F F L F F 9 16 N F F L F F F L P F 9 47 V A Q A G L E L L G 9 92 A F R F I Q C L L L 9 93 F R F I Q C L L L G 9 96 I Q C L L L G L L K V10-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 A G E L G T S D V V 12 2 G R C P A G E L G T 10 10 G T S D V V T V V L 7 V11-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 M V P P L P S L N P 10 9 V M V P P L P S L N 7 7 L R V M V P P L P S 6 V12-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 M S E E P E G C S Y 30 4 S E E P E G C S Y S 16 V13-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 L A D P Q E D S G K 14 5 T V D V L A D P Q E 10 2 S Q V T V D V L A D 9 4 V T V D V L A D P Q 7 1 D S Q V T V D V L A 6 V14-HLA-A1-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 A S L V A G T L S V 11 3 S S N P P A S A S L 10 4 S N P P A S A S L V 8 5 N P P A S A S L V A 7 8 A S A S L V A G T L 5

[1049] 45 TABLE XXXV Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 244 F L A E A S V R G L 3 358 A L L F C L L V V V 29 359 L L F C L L V V V V 29 215 S M N G Q P L T C V 27 158 A L E E G Q G L T L 26 230 L L Q D Q R I T H I 25 344 D L V S A S V V V V 25 33 E L E T S D V V T V 24 239 I L H V S F L A E A 24 426 S L K D N S S C S V 24 81 L L H S K Y G L H V 23 144 R V L V P P L P S L 23 252 G L E D Q N L W H I 23 284 R L D G P L P S G V 23 357 A A L L F C L L V V 23 16 L L L L L L L A S F 22 350 V V V V G V I A A L 22 362 C L L V V V V V L M 22 392 L T R E N S I R R L 22 354 G V I A A L L F C L 21 355 V I A A L L F C L L 21 79 L A L L H S K Y G L 20 236 I T H I L H V S F L 20 346 V S A S V V V V G V 20 500 G I Y I N G R G H L 20 141 L R L R V L V P P L 19 351 V V V G V I A A L L 19 356 I A A L L F C L L V 19 361 F C L L V V V V V L 19 381 Q M T Q K Y E E E L 19 477 G I K Q A M N H F V 19 8 E M W G P E A W L L 18 15 W L L L L L L L A S 18 17 L L L L L L A S F T 18 41 T V V L G Q D A K L 18 112 V L L R N A V Q A D 18 152 S L N P G P A L E E 18 172 T A E G S P A P S V 18 201 S A A V T S E F H L 18 221 L T C V V S H P G L 18 249 S V R G L E D Q N L 18 347 S A S V V V V G V I 18 360 L F C L L V V V V V 18 418 L R A E G H P D S L 18 10 W G P E A W L L L L 17 13 E A W L L L L L L L 17 25 F T G R C P A G E L 17 56 G D S G E Q V G Q V 17 70 V D A G E G A Q E L 17 73 G E G A Q E L A L L 17 132 F P A G S F Q A R L 17 137 F Q A R L R L R V L 17 202 A A V T S E F H L V 17 241 H V S F L A E A S V 17 305 L T T E H S G I Y V 17 363 L L V V V V V L M S 17 389 E L T L T R E N S I 17 18 L L L L L A S F T G 16 61 Q V G Q V A W A R V 16 89 H V S P A Y E G R V 16 138 Q A R L R L R V L V 16 140 R L R L R V L V P P 16 164 G L T L A A S C T A 16 166 T L A A S C T A E G 16 257 N I W H I G R E G A 16 259 W H I G R E G A M L 16 341 K Q V D L V S A S V 16 370 L M S R Y H R R K A 16 442 G R S Y S I L T T V 16 7 A E M W G P E A W L 15 11 G P E A W L L L L L 15 19 L L L L A S F T G R 15 34 L E T S D V V T V V 15 72 A G E G A Q E L A L 15 181 V T W D T E V K G T 15 229 G L L Q D Q R I T H 15 262 G R E G A M L K C L 15 299 T L G F P P L T T E 15 321 F S S R D S Q V T V 15 343 V D L V S A S V V V 15 349 S V V V V G V I A A 15 397 S I R R L H S H H T 15 409 R S Q P E E S V G L 15 445 Y S T L T V R E 15 447 T L T T V R E I E T 15 460 L L S P G S G R A E 15 501 I Y I N G R G H L V 15 12 P E A W L L L L L L 14 20 L L L A S F T G R C 14 21 L L A S F T G R C P 14 35 E T S D V V T V V L 14 80 A L L H S K Y G L H 14 87 G L H V S P A Y E G 14 107 P L D G S V L L R N 14 111 S V L L R N A V Q A 14 113 L L R N A V Q A D E 14 150 L P S L N P G P A L 14 156 G P A L E E G Q G L 14 178 A P S V T W D T E V 14 195 S F K H S R S A A V 14 233 D Q R I T H I L H V 14 291 S G V R V D G D T L 14 298 D T L G F P P L T T 14 311 G I Y V C H V S N E 14 323 S R D S Q V T V D V 14 324 R D S Q V T V D V L 14 332 V L D P Q E D S G K 14 342 Q V D L V S A S V V 14 452 R E I E T Q T E L L 14 492 L R A K P T G N G I 14 V2-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 L G Q D A K L P C L 18 10 L Y R G D S G E Q V 14 9 C L Y R G D S G E Q 13 6 K L P C L Y R G D S 11 V7-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 4 H T D P R S Q S E E 8 9 S Q S E E P E G R S 4 V9-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 100 L L G L L K V R P L 26 5 L L A G I L L R I T 24 95 F I Q C L L L G L L 23 4 E L L A G I L L R I 22 10 L L R I T F N F F L 22 46 Y V A Q A G L E L L 22 18 F L F F F L P F P L 21 31 F I Y F Y F Y F F L 19 57 S S N P P A S A S L 19 97 Q C L L L G L L K V 19 94 R F I Q C L L L G L 18 99 L L L G L L K V R P 18 105 K V R P L Q H Q G V 18 23 L P F P L V V F F I 17 64 A S L V A G T L S V 17 22 F L P F P L V V F F 16 38 F F L E M E S H Y V 16 53 E L L G S S N P P A 16 62 A S A S L V A G T L 16 65 S L V A G I L S V H 16 90 K K A F R F I Q C L 16 91 K A F R F I Q C L L 16 9 I L L R I I F N F F 15 39 F L E M E S H Y V A 15 98 C L L L G L L K V R 15 103 L L K V R P L Q H Q 15 41 E M E S H Y V A Q A 14 54 L L G S S N P P A S 14 58 S N P P A S A S L V 14 102 G L L K V R P L Q H 14 108 P L Q H Q G V N S C 14 128 F M Q A A P W E G T 14 19 L F F F L P F P L V 13 20 F F F L P F P L V V 13 45 H Y V A Q A G L E L 13 1 M R R E L L A G I L 12 26 P L V V F F I Y F Y 12 48 A Q A G L E L L G S 12 61 P A S A S L V A G T 12 66 L V A G T L S V H H 12 70 T L S V H H C A C F 12 92 A F R F I Q C L L L 12 V10-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 E L G T S D V V T V 25 10 G T S D V V T V V L 18 9 L G T S D V V T V V 15 5 P A G E L G T S D V 13 V11-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 R V M V P P L P S L 22 5 L R L R V M V P P L 19 2 Q A R L R L R V M V 16 4 R L R L R V M V P P 12 1 F Q A R L R L R V M 11 6 R L R V M V P P L P 11 9 V M V P P L P S L N 11 V12-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 G C S Y S I L T T V 16 2 V M S E E P E G C S 11 6 E P E G C S Y S T L 10 1 S V M S E E P E G C 8 V13-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 V L A D P Q E D S G 16 3 Q V T V D V L A D P 9 9 L A D P Q E D S G K 9 2 S Q V T V D V L A D 8 V14-HLA-A0201-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 S S N P P A S A S L 19 10 A S L V A G T L S V 17 8 A S A S L V A G T L 16 4 S N P P A S A S L V 14 7 P A S A S L V A G T 12 1 L G S S N P P A S A 10

[1050] 46 TABLE XXXVI Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA- A02Q3-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 160 E E G Q G L T L A A 19 194 R S F K H S R S A A 19 349 S V V V V G V I A A 19 59 G E Q V G Q V A W A 18 239 I L H V S F L A E A 18 161 E G Q G L T L A A S 17 195 S F K H S R S A A V 17 350 V V V V G V I A A L 17 5 L G A E M W G P E A 10 14 A W L L L L L L L A 10 22 L A S F T G R C P A 10 39 V V T V V L G Q D A 10 57 D S G E Q V G Q V A 10 63 G Q V A W A R V D A 10 67 W A R V D A G E G A 10 71 D A G E G A Q E L A 10 84 S K Y G L H V S P A 10 108 L D G S V L L R N A 10 111 S V L L R N A V Q A 10 125 Y E C R V S T F P A 10 130 S T F P A G S F Q A 10 149 P L P S L N P G P A 10 159 L E E G Q G L T L A 10 164 G L T L A A S C T A 10 169 A S C T A E G S P A 10 193 S R S F K H S R S A 10 237 T H I L H V S F L A 10 257 N L W H I G R E G A 10 339 S G K Q V D L V S A 10 348 A S V V V V G V I A 10 370 L M S R Y H R R K A 10 411 Q P E E S V G L R A 10 459 E L L S P G S G R A 10 472 E D Q D E G I K Q A 10 485 F V Q E N G I L R A 10 6 G A E M W G P E A W 9 15 W L L L L L L L A S 9 23 A S F T G R C P A G 9 40 V T V V L G Q D A K 9 58 S G E Q V G Q V A W 9 60 E Q V G Q V A W A R 9 64 Q V A W A R V D A G 9 68 A R V D A G E G A Q 9 72 A G E G A Q E L A L 9 85 K Y G L H V S P A Y 9 109 D G S V L L R N A V 9 112 V L L R N A V Q A D 9 126 E C R V S T F P A G 9 131 T F P A G S F Q A R 9 150 L P S L N P G P A L 9 165 L T L A A S C T A E 9 170 S C T A E G S P A P 9 238 H I L H V S F L A E 9 240 L H V S F L A E A S 9 258 L W H I G R E G A M 9 340 G K Q V D L V S A S 9 371 M S R Y H R R K A Q 9 412 P E E S V G L R A E 9 460 L L S P G S G R A E 9 473 D Q D E G I K Q A M 9 486 V Q E N G T L R A K 9 V2-HLA-A0203-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 160 E E G Q G L I L A A 19 V7-HLA-A0203-10mers-191P4D12B No Results Found. V9-HLA-A0203-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 123 Y F Q G I F M Q A A 19 41 E M E S H Y V A Q A 18 55 L G S S N P P A S A 18 124 F Q G I F M Q A A P 17 39 F L E M E S H Y V A 10 53 E L L G S S N P P A 10 59 N P P A S A S L V A 10 68 A G T L S V H H C A 10 83 T K R K K K L K K A 10 122 G Y F Q G I F M Q A 10 40 L E M E S H Y V A Q 9 42 M E S H Y V A Q A G 9 54 L L G S S N P P A S 9 56 G S S N P P A S A S 9 60 P P A S A S L V A G 9 69 G T L S V H H C A C 9 84 K R K K K L K K A F 9 V10-HLA-A0203-10mers-191P4D12B No Results Found. V11-HLA-A0203-10mers-191P4D12B No Results Found. V12-HLA-A0203-10mers-191P4D12B No Results Found. V13-HLA-A0203-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 D S Q V T V D V L A 10 2 S Q V T V D V L A D 9 3 Q V T V D V L A D P 8 V14-HLA-A0203-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 L G S S N P P A S A 18 5 N P P A S A S L V A 10 2 G S S N P P A S A S 9 6 P P A S A S L V A G 9 3 S S N P P A S A S L 8 7 P A S A S L V A G T 8

[1051] 47 TABLE XXXVII Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 332 V L D P Q E D S G K 26 69 R V D A G E G A Q E 25 260 H I G R E G A M L K 25 111 S V L L R N A V Q A 24 128 R V S T F P A G S F 24 158 A L E E G Q G L T L 24 342 Q V D L V S A S V V 23 358 A L L F C L L V V V 23 16 L L L L L L L A S F 22 140 R L R L R V L V P P 22 235 R I T H I L H V S F 22 229 G L L Q D Q R I T H 21 376 R R K A Q Q M T Q K 21 80 A L L H S K Y G L H 20 152 S L N P G P A L E E 20 203 A V J S E F H L V P 20 284 R L D G P L P S G V 20 345 L V S A S V V V V G 20 352 V V G V I A A L L F 20 369 V L M S R Y H R R K 20 17 L L L L L L A S F T 19 365 V V V V V L M S R Y 19 419 R A E G H P D S L K 19 19 L L L L A S F T G R 18 33 E L E T S D V V T V 18 117 A V Q A D E G E Y E 18 142 R L R V L V P P L P 18 144 R V L V P P L P S L 18 344 D L V S A S V V V V 18 351 V V V G V I A A L L 18 359 L L F C L L V V V V 18 400 R L H S H H I D P R 18 450 T V R E I E T Q T E 18 15 W L L L L L L L A S 17 18 L L L L L A S F T G 17 42 V V L G Q D A K L P 17 113 L L R N A V Q A D E 17 145 V L V P P L P S L N 17 188 K G I T S S R S F K 17 197 K H S R S A A V T S 17 294 R V D G D I L G F P 17 304 P L I T E H S G I Y 17 364 L V V V V V L M S R 17 391 T L T R E N S I R R 17 443 R S Y S T L I T V R 17 460 L L S P G S G R A E 17 76 A Q E L A L L H S K 16 81 L L H S K Y G L H V 16 112 V L L R N A V Q A D 16 123 G E Y E C R V S T F 16 146 L V P P L P S L N P 16 166 T L A A S C T A E G 16 186 E V K G T T S S R S 16 223 C V V S H P G L L Q 16 224 V V S H P G L L Q D 16 249 S V R G L E D Q N L 16 362 C L L V V V Y V L M 16 367 V V V L M S R Y H R 16 368 V V L M S R Y H R R 16 434 S V M S E E P E G R 16 491 T L R A K P T G N G 16 20 L L L A S F I G R C 15 49 K L P C F Y R G D S 15 61 Q V G Q V A W A R V 15 77 Q E L A L L H S K Y 15 97 R V E Q P P P P R N 15 107 P L D G S V L L R N 15 139 A R L R L R V L V P 15 164 G I T L A A S C T A 15 180 S V J W D I E V K G 15 239 I L H V S F L A E A 15 241 H V S F L A E A S V 15 242 V S F L A E A S V R 15 251 R G L E D Q N L W H 15 267 M L K C L S E G Q P 15 288 P L P S G V R V D G 15 299 T L G F P P L T T E 15 311 G I Y V C H V S N E 15 331 D V L D P Q E D S G 15 354 G V I A A L L F C L 15 385 K Y E E E L T L T R 15 397 S I R R L H S H H T 15 417 G L R A E G H P D S 15 426 S L K D N S S C S V 15 493 R A K P T G N G I Y 15 500 G I Y J N G R G H L 15 4 S L G A E M W G P E 14 21 L L A S F T C R C P 14 38 D V V T V V L G Q D 14 41 T V V L G Q D A K L 14 64 Q V A W A R V D A G 14 89 H V S P A Y E G R V 14 179 P S V T W D T E V K 14 209 H L V P S R S M N G 14 238 H I L H V S F L A E 14 292 G V R V D G D T L G 14 316 H V S N E F S S R D 14 350 V V V V G V I A A L 14 363 L L V V V V V L M S 14 366 V V V V L M S R Y H 14 485 F V Q E N G T L R A 14 2 P L S L G A E M W G 13 39 V V T V V L G Q D A 13 43 V L G Q D A K L P C 13 87 G L H V S P A Y E G 13 104 P R N P L D G S V L 13 214 R S M N G Q P L T C 13 275 Q P P P S Y N W T R 13 357 A A L L F C L L V V 13 373 R Y H R R K A Q Q M 13 389 E L I L T R E N S I 13 396 N S I R R L H S H H 13 415 S V G L R A E G H P 13 458 T E L L S P G S G R 13 459 E L L S P G S G R A 13 78 E L A L L H S K Y G 12 149 P L P S L N P G P A 12 230 L L Q D Q R I T H I 12 244 F L A E A S V R G L 12 259 W H I G R E G A M L 12 270 C L S E G Q P P P S 12 285 L D G P L P S G V R 12 298 D T L G F P P L T T 12 327 Q V T V D V L D P Q 12 349 S V V V V G V I A A 12 436 M S E E P E G R S Y 12 470 E E E D Q D E G I K 12 486 V Q E N G T L R A K 12 V2-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 C L Y R G D S G E Q 18 6 K L P C L Y R G D S 15 10; L Y R G D S G E Q V 11 3 Q D A K L P C L Y R 10 2 G Q D A K L P C L Y 9 5 A K L P C L Y R G D 8 V7-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 R S Q S E E P E G R 9 2 S H H T D P R S Q S 8 4 H T D P R S Q S E E 6 V9-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 65 S L V A G T L S V H 24 102 G L L K V R P L Q H 23 9 I L L R I T F N F F 21 66 L V A G T L S V H H 21 98 C L L L G L L K V R 21 12 R I T F N F F L F F 19 96 I Q C L L L G L L K 19 105 K V R P L Q H Q G V 19 22 F L P F P L V V F F 18 99; L L L G L L K V R P 18 4 E L L A G J L L R I 17 21 F F L P F P L V V F 17 70 T L S V H H C A C F 17 82 F T K R K K K L K K 17 26 P L V V F F I Y F Y 16 28 V V F F I Y F Y F Y 16 8 G I L L R J I F N F 15 75 H C A C F E S F T K 15 88 K L K K A F R F I Q 15 3 R E L L A G I L L R 14 10 L L R I T F N F F L 14 27 L V V F F I Y F Y F 14 39 F L E M E S H Y V A 14 50 A G L E L L G S S N 14 51 G L E L L G S S N P 14 53 E L L G S S N P P A 14 77 A C F E S F T K R K 14 5 L L A G I L L R I T 13 107 R P L Q H Q G V N S 13 31 F I Y F Y F Y F F L 12 54 L L G S S N P P A S 12 62 A S A S L V A G T L 12 85 R K K K L K K A F R 12 86 K K K L K K A F R F 12 108 P L Q H Q G V N S C 12 126 G I F M Q A A P W E 12 18 F L F F F L P F P L 11 46 Y V A Q A G L E L L 11 72 S V H H C A C F E S 11 79 F E S F T K R K K K 11 81 S F T K R K K K L K 11 100 L L G L L K V R P L 11 103 L L K V R P L Q H Q 11 125 Q G I F M Q A A P W 11 V10-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 E L G T S D V V T V 18 7 G E L G T S D V V T 12 3 R C P A G E L G T S 11 4 C P A G E L G T S D 9 10 G T S D V V T V V L 9 6 A G E L G T S D V V 8 V11-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 4 R L R L R V M V P P 22 6 R L R V M V P P L P 18 8 R V M V P P L P S L 16 10 M V P P L P S L N P 16 3 A R L R L R V M V P 13 2 Q A R L R L R V M V 12 V12-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 C S Y S T L T T V R 13 1 S V M S E E P E G C 12 3 M S E E P E G C S Y 12 6 E P E G C S Y S T L 9 4 S E E P E G C S Y S 7 8 E G C S Y S J L T T 7 V13-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 9 L A D P Q E D S G K 16 3 Q V T V D V L A D P 15 7 D V L A D P Q E D S 14 8 V L A D P Q E D S G 14 5 T V D V L A D P Q E 13 V14-HLA-A03-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 A S A S L V A G T L 12 4 S N P P A S A S L V 10 10 A S L V A G T L S V 10 3 S S N P P A S A S L 9 5 N P P A S A S L V A 9 2 G S S N P P A S A S 8 1 L G S S N P P A S A 6 6 P P A S A S L V A G 6 9 S A S L V A G T L S 6 7 P A S A S L V A G T 5

[1052] 48 TABLE XXXVIII Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 38 D V V T V V L G Q D 28 35 E T S D V V T V V L 27 350 V V V V G V I A A L 27 354 G V I A A L L F C L 26 365 V V V V V L M S R Y 25 41 T V V L G Q D A K L 24 13 E A W L L L L L L L 23 144 R V L V P P L P S L 23 455 E T Q T E L L S P G 23 351 V V V G V I A A L L 22 392 L T R E N S I R R L 22 476 E G I K Q A M N H F 22 186 E V K G T T S S R S 21 236 I T H I L H V S F L 21 349 S V V V V G V I A A 21 128 R V S T F P A G S F 20 331 D V L D P Q E D S G 20 439 E P E G R S Y S T L 20 99 E Q P P P P R N P L 19 249 S V R G L E D Q N L 19 352 V V G V I A A L L F 19 364 L V V V V V L M S R 19 8 E M W G P E A W L L 18 298 D T L G F P P L T T 18 25 F T G R C P A G E L 17 184 D T E V K G T T S S 17 223 C V V S H P G L L Q 17 344 D L V S A S V V V V 17 123 G E Y E C R V S T F 16 221 L T C V V S H P G L 16 224 V V S H P G L L Q D 16 296 D G D T L G F P P L 16 472 E D Q D E G I K Q A 16 10 W G P E A W L L L L 15 33 E L E T S D V V T V 15 60 E Q V G Q V A W A R 15 64 Q V A W A R V D A G 15 116 N A V Q A D E G E Y 15 130 S T F P A G S F Q A 15 161 E G Q G L T L A A S 15 291 S G V R V D G D T L 15 294 R V D G D T L G F P 15 327 Q V T V D V L D P Q 15 395 E N S I R R L H S H 15 421 E G H P D S L K D N 15 453 E I E T Q T E L L S 15 204 V T S E F H L V P S 14 222 T C V V S H P G L L 14 235 R I T H I L H V S F 14 244 F L A E A S V R G L 14 247 E A S V R G L E D Q 14 259 W H I G R E G A M L 14 293 V R V D G D T L G F 14 308 E H S G I Y V C H V 14 328 V T V D V L D P Q E 14 337 E D S G K Q V D L V 14 345 L V S A S V V V V G 14 366 V V V V L M S R Y H 14 367 V V V L M S R Y H R 14 414 E S V G L R A E G H 14 429 D N S S C S V M S E 14 436 M S E E P E G R S Y 14 448 L T T V R E I E T Q 14 449 T T V R E I E T Q T 14 450 T V R E I E T Q T E 14 452 R E I E T Q T E L L 14 483 N H F V Q E N G T L 14 11 G P E A W L L L L L 13 12 P E A W L L L L L L 13 16 L L L L L L L A S F 13 40 V T V V L G Q D A K 13 44 L G Q D A K L P C F 13 158 A L E E G Q G L T L 13 180 S V T W D T E V K G 13 181 V T W D T E V K G T 13 203 A V T S E F H L V P 13 233 D Q R I T H I L H V 13 255 D Q N L W H I G R E 13 305 L T T E H S G I Y V 13 306 T T E H S G I Y V C 13 438 E E P E G R S Y S T 13 441 E G R S Y S T L T T 13 471 E E D Q D E G I K Q 13 485 F V Q E N G T L R A 13 500 G I Y I N G R G H L 13 V2-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 L G Q D A K L P C L 13 4 D A K L P C L Y R G 12 2 G Q D A K L P C L Y 10 V7-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 4 H T D P R S Q S E E 10 6 D P R S Q S E E P E 9 9 S Q S E E P E G R S 4 V9-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 13 I T F N F F L F F F 24 28 V V F F I Y F Y F Y 24 80 E S F T K R K K K L 23 27 L V V F F I Y F Y F 22 46 Y V A Q A G L E L L 22 26 P L V V F F I Y F Y 18 43 E S H Y V A Q A G L 18 94 R F I Q C L L L G L 17 95; F I Q C L L L G L L 17 41 E M E S H Y V A Q A 16 4 E L L A G I L L R I 15 37 Y F F L E M E S H Y 15 12 R I T F N F F L F F 14 45 H Y V A Q A G L E L 14 16 N F F L F F F L P F 13 21 F F L P F P L V V F 13 8 G I L L R I T F N F 12 11 L R I T F N F F L F 12 18 F L F F F L P F P L 12 22 F L P F P L V V F F 12 29 V F F I Y F Y F Y F 12 30 F F I Y F Y F Y F F 12 31 F I Y F Y F Y F F L 12 90 K K A F R F I Q C L 12 91 K A F R F I Q C L L 12 100 L L G L L K V R P L 12 120 E R G Y F Q G I F M 12 1 M R R E L L A G I L 11 57 S S N P P A S A S L 11 62 A S A S L V A G T L 11 72 S V H H C A C F E S 11 105 K V R P L Q H Q G V 11 113 G V N S C D C E R G 11 V10-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 G T S D V V T V V L 17 8 E L G T S D V V T V 15 V11-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 R V M V P P L P S L 23 5 L R L R V M V P P L 12 10 M V P P L P S L N P 12 V12-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 E P E G C S Y S T L 20 3 M S E E P E G C S Y 14 5 E E P E G C S Y S T 13 8 E G C S Y S T L T T 13 1 S V M S E E P E G C 12 V13-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 7 D V L A D P Q E D S 18 3 Q V T V D V L A D P 15 4 V T V D V L A D P Q 13 5 T V D V L A D P Q E 12 2 S Q V T V D V L A D 11 1 D S Q V T V D V L A 8 V14-HLA-A26-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 3 S S N P P A S A S L 11 8 A S A S L V A G T L 11 6 P P A S A S L V A G 6

[1053] 49 TABLE XXXIX Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 132 F P A G S F Q A R L 24 150 L P S L N P G P A L 24 11 G P E A W L L L L L 23 439 E P E G R S Y S T L 23 156 G P A L E E G Q G L 21 178 A P S V T W D T E V 21 276 P P P S Y N W T R L 21 176 S P A P S V T W D T 19 103 P P R N P L D G S V 18 407 D P R S Q P E E S V 18 411 Q P E E S V G L R A 18 35 E T S D V V T V V L 17 72 A G E G A Q E L A L 17 134 A G S F Q A R L R L 17 227 H P G L L Q D Q R I 17 303 P P L T T E H S G I 16 334 D P Q E D S G K Q V 16 289 L P S G V R V D G D 15 324 R D S Q V T V D V L 15 7 A E M W G P E A W L 14 9 M W G P E A W L L L 14 29 C P A G E L E T S D 14 91 S P A Y E G R V E Q 14 99 E Q P P P P R N P L 14 158 A L E E G Q G L T L 14 249 S V R G L E D Q N L 14 296 D G D T L G F P P L 14 361 F C L L V V V V V L 14 409 R S Q P E E S V G L 14 8 E M W G P E A W L L 13 12 P E A W L L L L L L 13 13 E A W L L L L L L L 13 70 V D A G E G A Q E L 13 73 G E G A Q E L A L L 13 101 P P P P R N P L D G 13 105 R N P L D G S V L L 13 106 N P L D G S V L L R 13 141 L R L R V L V P P L 13 212 P S R S M N G Q P L 13 236 I T H I L H V S F L 13 259 W H I G R E G A M L 13 277 P P S Y N W T R L D 13 287 G P L P S G V R V D 13 336 Q E D S G K Q V D L 13 351 V V V G V I A A L L 13 355 V I A A L L F C L L 13 495 K P T G N G I Y I N 13 10 W G P E A W L L L L 12 100 Q P P P P R N P L D 12 104 P R N P L D G S V L 12 137 F Q A R L R L R V L 12 144 R V L V P P L P S L 12 148 P P L P S L N P G P 12 154 N P G P A L E E G Q 12 160 E E G Q G L T L A A 12 211 V P S R S M N G Q P 12 231 L Q D Q R I T H I L 12 244 F L A E A S V R G L 12 262 G R E G A M L K C L 12 308 E H S G I Y V C H V 12 337 E D S G K Q V D L V 12 350 V V V V G V I A A L 12 383 T Q K Y E E E L T L 12 392 L T R E N S I R R L 12 441 E G R S Y S T L T T 12 452 R E I E T Q T E L L 12 25 F T G R C P A G E L 11 41 T V V L G Q D A K L 11 56 G D S G E Q V G Q V 11 138 Q A R L R L R V L V 11 147 V P P L P S L N P G 11 201 S A A V T S E F H L 11 219 Q P L T C V V S H P 11 221 L T C V V S H P G L 11 275 Q P P P S Y N W T R 11 280 Y N W T R L D G P L 11 354 G V I A A L L F C L 11 357 A A L L F C L L V V 11 358 A L L F C L L V V V 11 418 L R A E G H P D S L 11 423 H P D S L K D N S S 11 451 V R E I E T Q T E L 11 462 S P G S G R A E E E 11 500 G I Y I N G R G H L 11 V2-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 L G Q D A K L P C L 11 7 L P C L Y R G D S G 10 10 L Y R G D S G E Q V 10 V7-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 D P R S Q S E E P E 13 V9-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 59 N P P A S A S L V A 20 23 L P F P L V V F F I 19 25 F P L V V F F I Y F 17 92 A F R F I Q C L L L 16 60 P P A S A S L V A G 14 10 L L R I T F N F F L 13 45 H Y V A Q A G L E L 13 62 A S A S L V A G T L 13 94 R F I Q C L L L G L 13 100 L L G L L K V R P L 13 107 R P L Q H Q G V N S 13 1 M R R E L L A G I L 12 14 T F N F F L F F F L 12 43 E S H Y V A Q A G L 12 57 S S N P P A S A S L 12 90 K K A F R F I Q C L 12 2 R R E L L A G I L L 11 12 R I T F N F F L F F 11 18 F L F F F L P F P L 11 31 F I Y F Y F Y F F L 11 46 Y V A Q A G L E L L 11 53 E L L G S S N P P A 11 61 P A S A S L V A G T 11 64 A S L V A G T L S V 11 80 E S F T K R K K K L 11 91 K A F R F I Q C L L 11 4 E L L A G I L L R I 10 16 N F F L F F F L P F 10 21 F F L P F P L V V F 10 22 F L P F P L V V F F 10 87 K K L K K A F R F I 10 95 F I Q C L L L G L L 10 105 K V R P L Q H Q G V 10 119 C E R G Y F Q G I F 10 5 L L A G I L L R I T 9 9 I L L R I T F N F F 9 20 F F F L P F P L V V 9 33 Y F Y F Y F F L E M 9 41 E M E S H Y V A Q A 9 55 L G S S N P P A S A 9 70 T L S V H H C A C F 9 83 T K R K K K L K K A 9 84 K R K K K L K K A F 9 120 E R G Y F Q G I F M 9 123 Y F Q G I F M Q A A 9 V10-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 G T S D V V T V V L 16 4 C P A G E L G T S D 14 7 G E L G T S D V V T 11 8 E L G T S D V V T V 11 2 G R C P A G E L G T 9 6 A G E L G T S D V V 9 9 L G T S D V V T V V 9 5 P A G E L G T S D V 8 V11-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 5 L R L R V M V P P L 13 8 R V M V P P L P S L 13 2 Q A R L R L R V M V 11 1 F Q A R L R L R V M 8 4 R L R L R V M V P P 6 V12-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 6 E P E G C S Y S T L 23 V13-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 1 D S Q V T V D V L A 8 2 S Q V T V D V L A D 4 V14-HLA-B0702-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 5 N P P A S A S L V A 20 6 P P A S A S L V A G 14 8 A S A S L V A G T L 13 3 S S N P P A S A S L 12 7 P A S A S L V A G T 11 10 A S L V A G T L S V 11 1 L G S S N P P A S A 9

[1054] 50 TABLE XL Pos 1234567890 score V1-HLA-B08-10mers-191P4D12B No Results Found.

[1055] 51 TABLE XXIV Pos 123456789 score V7-HLA-A0203-9mers-191P4D12B No Results Found. V9-HLA-A0203-9mers-191P4D12B No Results Found. V10-HLA-A0203-9mers-191P4D12B No Results Found. V11-HLA-A0203-9mers-191P4D12B No Results Found. V12-HLA-A0203-9mers-191P4D12B No Results Found. V13-HLA-A0203-9mers-191P4D12B No Results Found. V14-HLA-A0203-9mers-191P4D12B No Results Found.

[1056] 52 TABLE XLI Pos 1234567890 score V1-HLA-B1510-10mers-191P4D12B No Results Found. V2-HLA-B1510-10mers-191P4D12B No Results Found. V7-HLA-B1510-10mers-191P4D12B No Results Found. V9-HLA-B1510-10mers-191P4D12B No Results Found. V10-HLA-B1510-10mers-191P4D12B No Results Found. V11-HLA-B1510-10mers-191P4D12B No Results Found. V12-HLA-B1510-10mers-191P4D12B No Results Found. V13-HLA-B1510-10mers-191P4D12B No Results Found. V14-HLA-B1510-10mers-191P4D12B No Results Found.

[1057] 53 TABLE XLII Pos 1234567890 score V1-HLA-B2705-10mers-191P4D12B No Results Found. V2-HLA-B2705-10mers-191P4D12B No Results Found. V7-HLA-B2705-10mers-191P4D12B No Results Found. V9-HLA-B2705-10mers-191P4D12B No Results Found. V10-HLA-B2705-10mers-191P4D12B No Results Found. V11-HLA-B2705-10mers-191P4D12B No Results Found. V12-HLA-B2705-10mers-191P4D12B No Results Found. V13-HLA-B2705-10mers-191P4D12B No Results Found. V14-HLA-B2705-10mers-191P4D12B No Results Found.

[1058] 54 TABLE XLIII Pos 1234567890 score V1-HLA-B2709-10mers-191P4D12B No Results Found. V2-HLA-B2709-10mers-191P4D12B No Results Found. V7-HLA-B2709-10mers-191P4D12B No Results Found. V9-HLA-B2709-10mers-191P4D12B No Results Found. V10-HLA-B2709-10mers-191P4D12B No Results Found. V11-HLA-B2709-10mers-191P4D12B No Results Found. V12-HLA-B2709-10mers-191P4D12B No Results Found. V13-HLA-B2709-10mers-191P4D12B No Results Found. V14-HLA-B2709-10mers-191P4D12B No Results Found.

[1059] 55 TABLE XLIV Pos 1 2 3 4 5 6 7 8 9 0 score V1-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 452 R E I E T Q T E L L 25 7 A E M W G P E A W L 24 12 P E A W L L L L L L 23 73 G E G A Q E L A L L 22 77 Q E L A L L H S K Y 22 123 G E Y E C R V S T F 22 336 Q E D S G K Q V D L 22 469 E E E E D Q D E G I 20 99 E Q P P P P R N P L 18 174 E G S P A P S V T W 18 35 E T S D V V T V V L 17 72 A G E G A Q E L A L 17 13 E A W L L L L L L L 16 134 A G S F Q A R L R L 16 160 E E G Q G L T L A A 16 476 E G I K Q A M N H F 16 8 E M W G P E A W L L 15 9 M W G P E A W L L L 15 98 V E Q P P P P R N P 15 158 A L E E G Q G L T L 15 173 A E G S P A P S V T 15 273 E G Q P P P S Y N W 15 350 V V V V G V I A A L 15 361 F C L L V V V V V L 15 387 E E E L T L T R E N 15 388 E E L T L T R E N S 15 420 A E G H P D S L K D 15 437 S E E P E G R S Y S 15 471 E E D Q D E G I K Q 15 10 W G P E A W L L L L 14 58 S G E Q V G Q V A W 14 85 K Y G L H V S P A Y 14 104 P R N P L D G S V L 14 105 R N P L D G S V L L 14 137 F Q A R L R L R V L 14 150 L P S L N P G P A L 14 206 S E F H L V P S R S 14 246 A E A S V R G L E D 14 259 W H I G R E G A M L 14 262 G R E G A M L K C L 14 319 N E F S S R D S Q V 14 354 G V I A A L L F C L 14 392 L T R E N S I R R L 14 409 R S Q P E E S V G L 14 412 P E E S V G L R A E 14 413 E E S V G L R A E G 14 439 E P E G R S Y S T L 14 483 N H F V Q E N G T L 14 494 A K P T G N G I Y I 14 6 G A E M W G P E A W 13 11 G P E A W L L L L L 13 16 L L L L L L L A S F 13 32 G E L E T S D V V T 13 128 R V S T F P A G S F 13 141 L R L R V L V P P L 13 159 L E E G Q G L T L A 13 199 S R S A A V T S E F 13 231 L Q D Q R I T H I L 13 250 V R G L E D Q N L W 13 291 S G V R V D G D T L 13 293 V R V D G D T L G F 13 296 D G D T L G F P P L 13 324 R D S Q V T V D V L 13 351 V V V G V I A A L L 13 352 V V G V I A A L L F 13 438 E E P E G R S Y S T 13 468 A E E E E D Q D E G 13 470 E E E D Q D E G I K 13 487 Q E N G T L R A K P 13 493 R A K P T G N G I Y 13 1 M P L S L G A E M W 12 25 F T G R C P A G E L 12 34 L E T S D V V T V V 12 41 T V V L G Q D A K L 12 44 L G Q D A K L P C F 12 45 G Q D A K L P C F Y 12 70 V D A G E G A Q E L 12 79 L A L L H S K Y G L 12 121 D E G E Y E C R V S 12 125 Y E C R V S T F P A 12 144 R V L V P P L P S L 12 187 V K G T T S S R S F 12 222 T C V V S H P G L L 12 230 L L Q D Q R I T H I 12 244 F L A E A S V R G L 12 249 S V R G L E D Q N L 12 253 L E D Q N L W H I G 12 271 L S E G Q P P P S Y 12 272 S E G Q P P P S Y N 12 347 S A S V V V V G V I 12 355 V I A A L L F C L L 12 377 R K A Q Q M T Q K Y 12 383 T Q K Y E E E L T L 12 389 E L T L T R E N S I 12 394 R E N S I R R L H S 12 440 P E G R S Y S T L T 12 454 I E T Q T E L L S P 12 458 T E L L S P G S G R 12 V2-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 G Q D A K L P C L Y 13 1 L G Q D A K L P C L 12 5 A K L P C L Y R G D 8 V7-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 S H H T D P R S Q S 4 4 H T D P R S Q S E E 4 1 H S H H T D P R S Q 2 5 T D P R S Q S E E P 2 9 S Q S E E P E G R S 2 3 H H T D P R S Q S E 1 7 P R S Q S E E P E G 1 8 R S Q S E E P E G R 1 V9-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 119 C E R G Y F Q G I F 21 80 E S F T K R K K K L 18 3 R E L L A G I L L R 17 21 F F L P F P L V V F 17 11 L R I T F N F F L F 16 16 N F F L F F F L P F 16 62 A S A S L V A G T L 15 79 F E S F T K R K K K 15 84 K R K K K L K K A F 15 91 K A F R F I Q C L L 15 92 A F R F I Q C L L L 15 94 R F I Q C L L L G L 15 9 I L L R I T F N F F 14 13 I T F N F F L F F F 14 23 L P F P L V V F F I 14 30 F F I Y F Y F Y F F 14 40 L E M E S H Y V A Q 14 42 M E S H Y V A Q A G 14 57 S S N P P A S A S L 14 90 K K A F R F I Q C L 14 125 Q G I F M Q A A P W 14 2 R R E L L A G I L L 13 4 E L L A G I L L R I 13 6 L A G I L L R I T F 13 8 G I L L R I T F N F 13 18 F L F F F L P F P L 13 22 F L P F P L V V F F 13 24 P F P L V V F F I Y 13 25 F P L V V F F I Y F 13 26 P L V V F F I Y F Y 13 28 V V F F I Y F Y F Y 13 37 Y F F L E M E S H Y 13 52 L E L L G S S N P P 13 86 K K K L K K A F R F 13 100 L L G L L K V R P L 13 115 N S C D C E R G Y F 13 12 R I T F N F F L F F 12 29 V F F I Y F Y F Y F 12 43 E S H Y V A Q A G L 12 46 Y V A Q A G L E L L 12 87 K K L K K A F R F I 12 95 F I Q C L L L G L L 12 114 V N S C D C E R G Y 12 1 M R R E L L A G I L 11 14 T F N F F L F F F L 11 45 H Y V A Q A G L E L 11 70 T L S V H H C A C F 11 73 V H H C A C F E S F 11 7 A G I L L R I T F N 10 10 L L R I T F N F F L 10 27 L V V F F I Y F Y F 10 31 F I Y F Y F Y F F L 10 118 D C E R G Y F Q G I 10 V10-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 10 G T S D V V T V V L 15 7 G E L G T S D V V T 14 V11-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 5 L R L R V M V P P L 13 8 R V M V P P L P S L 12 3 A R L R L R V M V P 7 V12-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 4 S E E P E G C S Y S 14 6 E P E G C S Y S T L 14 5 E E P E G C S Y S T 13 7 P E G C S Y S T L T 11 3 M S E E P E G C S Y 10 V13-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 2 S Q V T V D V L A D 6 10 A D P Q E D S G K Q 5 9 L A D P Q E D S G K 4 1 D S Q V T V D V L A 2 4 V T V D V L A D P Q 2 5 T V D V L A D P Q E 2 6 V D V L A D P Q E D 2 V14-HLA-B4402-10mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 10 amino acids, and the end position for each peptide is the start position plus nine. 8 A S A S L V A G T L 15 3 S S N P P A S A S L 14 4 S N P P A S A S L V 7

[1060] 56 TABLE XLV Pos 1234567890 score V1-HLA-B5101-10mers-191P4D12B No Results Found. V2-HLA-B5101-10mers-191P4D12B No Results Found. V7-HLA-B5101-10mers-191P4D12B No Results Found. V9-HLA-B5101-10mers-191P4D12B No Results Found. V10-HLA-B5101-10mers-191P4D12B No Results Found. V11-HLA-B5101-10mers-191P4D12B No Results Found. V12-HLA-B5101-10mers-191P4D12B No Results Found. V13-HLA-B5101-10mers-191P4D12B No Results Found. V14-HLA-B5101-10mers-191P4D12B No Results Found.

[1061] 57 TABLE XLVI Pos 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 score V1-HLA-DRB1 -0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 279 S Y N W T R L D G P L P S G V 35 140 R L R L R V L V P P L P S L N 32 205 T S E F H L V P S R S M N G Q 32 299 T L G F P P L T T E H S G I Y 32 37 S D V V T V V L G Q D A K L P 31 40 V T V V L G Q D A K L P C F Y 31 340 G K Q V D L V S A S V V V V G 31 349 S V V V V G V I A A L L F C L 31 144 R V L V P P L P S L N P G P A 30 147 V P P L P S L N P G P A L E E 30 350 V V V V G V I A A L L F C L L 30 51 P C F Y R G D S G E Q V G Q V 28 12 P E A W L L L L L L L A S F T 27 247 E A S V R G L E D Q N L W H I 27 358 A L L F C L L V V V V V L M S 27 371 M S R Y H R R K A Q Q M T Q K 26 6 G A E M W G P E A W L L L L L 25 13 E A W L L L L L L L A S F T G 25 14 A W L L L L L L L A S F T G R 25 15 W L L L L L L L A S F T G R C 25 19 L L L L A S F T G R C P A G E 25 102 P P P R N P L D G S V L L R N 25 109 D G S V L L R N A V Q A D E G 25 122 E G E Y E C R V S T F P A G S 25 193 S R S F K H S R S A A V T S E 25 239 I L H V S F L A E A S V R G L 25 255 D Q N L W H I G R E G A M L K 25 265 G A M L K C L S E G Q P P P S 25 310 S G I Y V C H V S N E F S S R 25 454 I E T Q T E L L S P G S G R A 25 64 Q V A W A R V D A G E G A Q E 24 76 A Q E L A L L H S K Y G L H V 24 79 L A L L H S K Y G L H V S P A 24 126 E C R V S T F P A G S F Q A R 24 156 G P A L E E G Q G L T L A A S 24 162 G Q G L T L A A S C T A E G S 24 181 V T W D T E V K G T T S S R S 24 210 L V P S R S M N G Q P L T C V 24 213 S R S M N G Q P L T C V V S H 24 282 W T R L D G P L P S G V R V D 24 347 S A S V V V V G V I A A L L F 24 353 V G V I A A L L F C L L V V V 24 357 A A L L F C L L V V V V V L M 24 364 L V V V V V L M S R Y H R R K 24 395 E N S I R R L H S H H T D P R 24 442 G R S Y S T L T T V R E I E T 24 16 L L L L L L L A S F T G R C P 23 28 R C P A G E L E T S D V V T V 23 184 D T E V K G T T S S R S F K H 23 228 P G L L Q D Q R I T H I L H V 23 233 D Q R I T H I L H V S F L A E 23 289 L P S G V R V D G D T L G F P 23 339 S G K Q V D L V S A S V V V V 23 346 V S A S V V V V G V I A A L L 23 361 F C L L V V V V V L M S R Y H 23 424 P D S L K D N S S C S V M S E 23 448 L T T V R E I E T Q T E L L S 23 457 Q T E L L S P G S G R A E E E 23 483 N H F V Q E N G T L R A K P T 23 3 L S L G A E M W G P E A W L L 22 55 R G D S G E Q V G Q V A W A R 22 59 G E Q V G Q V A W A R V D A G 22 141 L R L R V L V P P L P S L N P 22 204 V T S E F H L V P S R S M N G 22 250 V R G L E D Q N L W H I G R E 22 268 L K C L S E G Q P P P S Y N W 22 311 G I Y V C H V S N E F S S R D 22 327 Q V T V D V L D P Q E D S G K 22 360 L F C L L V V V V V L M S R Y 22 451 V R E I E T Q T E L L S P G S 22 218 G Q P L T C V V S H P G L L Q 21 256 Q N L W H I G R E G A M L K C 21 277 P P S Y N W T R L D G P L P S 21 33 E L E T S D V V T V V L G Q D 20 65 V A W A R V D A G E G A Q E L 20 123 G E Y E C R V S T F P A G S F 20 154 N P G P A L E E G Q G L T L A 20 321 F S S R D S Q V T V D V L D P 20 429 D N S S C S V M S E E P E G R 20 482 M N H F V Q E N G T L R A K P 20 490 G T L R A K P T G N G I Y I N 20 22 L A S F T G R C P A G E L E T 19 39 V V T V V L G Q D A K L P C F 19 138 Q A R L R L R V L V P P L P S 19 234 Q R I T H I L H V S F L A E A 19 242 V S F L A E A S V R G L E D Q 19 412 P E E S V G L R A E G H P D S 19 415 S V G L R A E G H P D S L K D 19 7 A E M W G P E A W L L L L L L 18 91 S P A Y E G R V E Q P P P P R 18 134 A G S F Q A R L R L R V L V P 18 165 L T L A A S C T A E G S P A P 18 264 E G A M L K C L S E G Q P P P 18 266 A M L K C L S E G Q P P P S Y 18 280 Y N W T R L D G P L P S G V R 18 368 V V L M S R Y H R R K A Q Q M 18 387 E E E L T L T R E N S I R R L 18 11 G P E A W L L L L L L L A S F 17 67 W A R V D A G E G A Q E L A L 17 68 A R V D A G E G A Q E L A L L 17 83 H S K Y G L H V S P A Y E G R 17 115 R N A V Q A D E G E Y E C R V 17 125 Y E C R V S T F P A G S F Q A 17 135 G S F Q A R L R L R V L V P P 17 148 P P L P S L N P G P A L E E G 17 150; L P S L N P G P A L E E G Q G 17 167 L A A S C T A E G S P A P S V 17 201 S A A V T S E F H L V P S R S 17 221 L T C V V S H P G L L Q D Q R 17 225 V S H P G L L Q D Q R I T H I 17 238 H I L H V S F L A E A S V R G 17 257 N L W H I G R E G A M L K C L 17 258 L W H I G R E G A M L K C L S 17 284 R L D G P L P S G V R V D G D 17 291 S G V R V D G D T L G F P P L 17 294 R V D G D T L G F P P L T T E 17 303 P P L T T E H S G I Y V C H V 17 330 V D V L D P Q E D S G K Q V D 17 332 V L D P Q E D S G K Q V D L V 17 342 Q V D L V S A S V V V V G V I 17 348 A S V V V V G V I A A L L F C 17 354 G V I A A L L F C L L V V V V 17 356 I A A L L F C L L V V V V V L 17 379 A Q Q M T Q K Y E E E L T L T 17 407 D P R S Q P E E S V G L R A E 17 413 E E S V G L R A E G H P D S L 17 432 S C S V M S E E P E G R S Y S 17 458 T E L L S P G S G R A E E E E 17 475 D E G I K Q A M N H F V Q E N 17 486 V Q E N G T L R A K P T G N G 17 V2-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 2 V T V V L G Q D A K L P C L Y 31 13 P C L Y R G D S G E Q V G Q V 28 9 D A K L P C L Y R G D S G E Q 24 1 V V T V V L G Q D A K L P C L 19 V7-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 2 I R R L H S H H T D P R S Q S 14 8 H H T D P R S Q S E E P E G R 14 13 R S Q S E E P E G R S Y S T L 10 1 S I R R L H S H H T D P R S Q 9 11 D P R S Q S E E P E G R S Y S 9 14 S Q S E E P E G R S Y S T L T 9 3 R R L H S H H T D P R S Q S E 8 5 L H S H H T D P R S Q S E E P 8 9 H T D P R S Q S E E P E G R S 8 12 P R S Q S E E P E G R S Y S T 8 4 R L H S H H T D P R S Q S E E 7 6 H S H H T D P R S Q S E E P E 7 V9-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 43 E S H Y V A Q A G L E L L G S 33 49 Q A G L E L L G S S N P P A S 32 36 F Y F F L E M E S H Y V A Q A 31 103 L L K V R P L Q H Q G V N S C 28 17 F F L F F F L P F P L V V F F 27 90 K K A F R F I Q C L L L G L L 27 98 C L L L G L L K V R P L Q H Q 26 18 F L F F F L P F P L V V F F I 25 60 P P A S A S L V A G T L S V H 24 61 P A S A S L V A G T L S V H H 24 93 F R F I Q C L L L G L L K V R 24 97 Q C L L L G L L K V R P L Q H 24 121 R G Y F Q G I F M Q A A P W E 24 6 L A G I L L R I T F N F F L F 23 16 N F F L F F F L P F P L V V F 23 7 A G I L L R I T F N F F L F F 22 52 L E L L G S S N P P A S A S L 22 100 L L G L L K V R P L Q H Q G V 22 8 G I L L R I T F N F F L F F F 21 27 L V V F F I Y F Y F Y F F L E 21 12 R I T F N F F L F F F L P F P 20 34 F Y F Y F F L E M E S H Y V A 20 92 A F R F I Q C L L L G L L K V 20 4 E L L A G I L L R I T F N F F 19 14 T F N F F L F F F L P F P L V 19 15 F N F F L F F F L P F P L V V 19 31 F I Y F Y F Y F F L E M E S H 19 33 Y F Y F Y F F L E M E S H Y V 19 46 Y V A Q A G L E L L G S S N P 19 95 F I Q C L L L G L L K V R P L 19 10 L L R I T F N F F L F F F L P 18 19 L F F F L P F P L V V F F I Y 18 25 F P L V V F F I Y F Y F Y F F 18 28 V V F F I Y F Y F Y F F L E M 18 84 K R K K K L K K A F R F I Q C 18 120 E R G Y F Q G I F M Q A A P W 18 13 I T F N F F L F F F L P F P L 17 20 F F F L P F P L V V F F I Y F 17 22 F L P F P L V V F F I Y F Y F 17 29 V F F I Y F Y F Y F F L E M E 17 37 Y F F L E M E S H Y V A Q A G 17 44 S H Y V A Q A G L E L L G S S 17 94 R F I Q C L L L G L L K V R P 17 2 R R E L L A G I L L R I T F N 16 21 F F L P F P L V V F F I Y F Y 16 39 F L E M E S H Y V A Q A G L E 16 41 E M E S H Y V A Q A G L E L L 16 48 A Q A G L E L L G S S N P P A 16 51 G L E L L G S S N P P A S A S 16 54 L L G S S N P P A S A S L V A 16 56 G S S N P P A S A S L V A G T 16 68 A G T L S V H H C A C F E S F 16 70 T L S V H H C A C F E S F T K 16 105 K V R P L Q H Q G V N S C D C 16 118 D C E R G Y F Q G I F M Q A A 16 V10-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 8 R C P A G E L G T S D V V T V 23 13 E L G T S D V V T V V L G Q D 20 2 L A S F T G R C P A G E L G T 19 3 A S F T G R C P A G E L G T S 16 11 A G E L G T S D V V T V V L G 16 9 C P A G E L G T S D V V T V V 15 V11-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 9 R L R L R V M V P P L P S L N 30 13 R V M V P P L P S L N P G P A 30 10 L R L R V M V P P L P S L N P 22 7 Q A R L R L R V M V P P L P S 19 3 A G S F Q A R L R L R V M V P 18 4 G S F Q A R L R L R V M V P P 17 6 F Q A R L R L R V M V P P L P 16 11 R L R V M V P P L P S L N P G 16 1 F P A G S F Q A R L R L R V M 15 12 L R V M V P P L P S L N P G P 15 8 A R L R L R V M V P P L P S L 14 V12-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 14 G C S Y S T L T T V R E I E T 24 1 D N S S C S V M S E E P E G C 20 4 S C S V M S E E P E G C S Y S 17 5 C S V M S E E P E G C S Y S T 16 15 C S Y S T L T T V R E I E T Q 11 V13-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 2 F S S R D S Q V T V D V L A D 20 6 D S Q V T V D V L A D P Q E D 17 14 L A D P Q E D S G K Q V D L V 17 8 Q V T V D V L A D P Q E D S G 16 10 T V D V L A D P Q E D S G K Q 16 7 S Q V T V D V L A D P Q E D S 15 3 S S R D S Q V T V D V L A D P 14 12 D V L A D P Q E D S G K Q V D 9 V14-HLA-DRB1-0101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 11 P P A S A S L V A G T L S V H 24 12 P A S A S L V A G T L S V H H 24 3 L E L L G S S N P P A S A S L 22 2 G L E L L G S S N P P A S A S 16 5 L L G S S N P P A S A S L V A 16 7 G S S N P P A S A S L V A G T 16 1 A G L E L L G S S N P P A S A 15 6 L G S S N P P A S A S L V A G 15 13 A S A S L V A G T L S V H H C 15 4 E L L G S S N P P A S A S L V 14 8 S S N P P A S A S L V A G T L 14 15 A S L V A G T L S V H H C A C 14

[1062] 58 TABLE XLVII Pos 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 score V1-HLA-DRB1-0301-5mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 178 A P S V T W D T E V K G T T S 29 227 H P G L L Q D Q R I T H I L H 28 41 T V V L G Q D A K L P C F Y R 27 379 A Q Q M T Q K Y E E E L T L T 25 14 A W L L L L L L L A S F T G R 23 290 P S G V R V D G D T L G F P P 23 39 V V T V V L G Q D A K L P C F 22 103 P P R N P L D G S V L L R N A 22 247 E A S V R G L E D Q N L W H I 22 115 R N A V Q A D E G E Y E C R V 21 142 R L R V L V P P L P S L N P G 21 233 D Q R I T H I L H V S F L A E 21 325 D S Q V T V D V L D P Q E D S 21 348 A S V V V V G V I A A L L F C 21 349 S V V V V G V I A A L L F C L 21 6 G A E M W G P E A W L L L L L 20 156 G P A L E E G Q G L T L A A S 20 242 V S F L A E A S V R G L E D Q 20 249 S V R G L E D Q N L W H I G R 20 292 G V R V D G D T L G F P P L T 20 350 V V V V G V I A A L L F C L L 20 352 V V G V I A A L L F C L L V V 20 353 V G V I A A L L F C L L V V V 20 363 L L V V V V V L M S R Y H R R 20 126 E C R V S T F P A G S F Q A R 19 302 F P P L T T E H S G I Y V C H 19 328 V T V D V L D P Q E D S G K Q 19 365 V V V V V L M S R Y H R R K A 19 387 E E E L T L T R E N S I R R L 19 77 Q E L A L L H S K Y G L H V S 18 111 S V L L R N A V Q A D E G E Y 18 265 G A M L K C L S E G Q P P P S 18 286 D G P L P S G V R V D G D T L 18 319 N E F S S R D S Q V T V D V L 18 329 T V D V L D P Q E D S G K Q V 18 433 C S V M S E E P E G R S Y S T 18 451 V R E I E T Q T E L L S P G S 18 87 G L H V S P A Y E G R V E Q P 17 97 R V E Q P P P P R N P L D G S 17 239 I L H V S F L A E A S V R G L 17 255 D Q N L W H I G R E G A M L K 17 311 G I Y V C H V S N E F S S R D 17 334 D P Q E D S G K Q V D L V S A 17 368 V V L M S R Y H R R K A Q Q M 17 381 Q M T Q K Y E E E L T L T R E 17 401 L H S H H T D P R S Q P E E S 17 413 E E S V G L R A E G H P D S L 17 445 Y S T L T T V R E I E T Q T E 17 475 D E G I K Q A M N H F V Q E N 17 479 K Q A M N H F V Q E N G T L R 17 491 T L R A K P T G N G I Y I N G 17 5 L G A E M W G P E A W L L L L 16 13 E A W L L L L L L L A S F T G 16 47 D A K L P C F Y R G D S G E Q 16 70 V D A G E G A Q E L A L L H S 16 134 A G S F Q A R L R L R V L V P 16 114 L R N A V Q A D E G E Y E C R 15 130 S T F P A G S F Q A R L R L R 15 132 F P A G S F Q A R L R L R V L 15 199 S R S A A V T S E F H L V P S 15 221 L T C V V S H P G L L Q D Q R 15 236 I T H I L H V S F L A E A S V 15 481 A M N H F V Q E N G T L R A K 15 15 W L L L L L L L A S F T G R C 14 17 L L L L L L A S F T G R C P A 14 78 E L A L L H S K Y G L H V S P 14 109 D G S V L L R N A V Q A D E G 14 110 G S V L L R N A V Q A D E G E 14 143 L R V L V P P L P S L N P G P 14 144 R V L V P P L P S L N P G P A 14 280 Y N W T R L D G P L P S G V R 14 342 Q V D L V S A S V V V V G V I 14 356 I A A L L F C L L V V V V V L 14 360 L F C L L V V V V V L M S R Y 14 448 L T T V R E I E T Q T E L L S 14 449 T T V R E I E T Q T E L L S P 14 457 Q T E L L S P G S G R A E E E 14 V2-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 3 T V V L G Q D A K L P C L Y R 27 1 V V T V V L G Q D A K L P C L 22 9 D A K L P C L Y R G D S G E Q 16 2 V T V V L G Q D A K L P C L Y 13 V7-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 5 L H S H H T D P R S Q S E E P 17 2 I R R L H S H H T D P R S Q S 11 13 R S Q S E E P E G R S Y S T L 10 9 H T D P R S Q S E E P E G R S 9 7 S H H T D P R S Q S E E P E G 8 12 P R S Q S E E P E G R S Y S T 8 14 S Q S E E P E G R S Y S T L T 8 V9-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 8 G I L L R I T F N F F L F F F 25 112 Q G V N S C D C E R G Y F Q G 24 35 Y F Y F F L E M E S H Y V A Q 23 6 L A G I L L R I T F N F F L F 22 7 A G I L L R I T F N F F L F F 21 19 L F F F L P F P L V V F F I Y 21 10 L L R I T F N F F L F F F L P 20 20 F F F L P F P L V V F F I Y F 20 44 S H Y V A Q A G L E L L G S S 20 93 F R F I Q C L L L G L L K V R 20 97 Q C L L L G L L K V R P L Q H 20 98 C L L L G L L K V R P L Q H Q 20 16 N F F L F F F L P F P L V V F 19 24 P F P L V V F F I Y F Y F Y F 19 25 F P L V V F F I Y F Y F Y F F 19 51 G L E L L G S S N P P A S A S 19 68 A G T L S V H H C A C F E S F 19 90 K K A F R F I Q C L L L G L L 19 92 A F R F I Q C L L L G L L K V 19 14 T F N F F L F F F L P F P L V 18 26 P L V V F F I Y F Y F Y F F L 18 29 V F F I Y F Y F Y F F L E M E 18 12 R I T F N F F L F F F L P F P 17 22 F L P F P L V V F F I Y F Y F 17 28 V V F F I Y F Y F Y F F L E M 17 79 F E S F T K R K K K L K K A F 17 82 F T K R K K K L K K A F R F I 17 86 K K K L K K A F R F I Q C L L 17 27 L V V F F I Y F Y F Y F F L E 16 76 C A C F E S F T K R K K K L K 16 4 E L L A G I L L R I T F N F F 15 33 Y F Y F Y F F L E M E S H Y V 15 41 E M E S H Y V A Q A G L E L L 15 78 C F E S F T K R K K K L K K A 15 89 L K K A F R F I Q C L L L G L 15 113 G V N S C D C E R G Y F Q G I 15 117 C D C E R G Y F Q G I F M Q A 15 96 I Q C L L L G L L K V R P L Q 14 2 R R E L L A G I L L R I T F N 13 49 Q A G L E L L G S S N P P A S 13 100 L L G L L K V R P L Q H Q G V 13 101 L G L L K V R P L Q H Q G V N 13 103 L L K V R P L Q H Q G V N S C 13 36 F Y F F L E M E S H Y V A Q A 12 37 Y F F L E M E S H Y V A Q A G 12 39 F L E M E S H Y V A Q A G L E 12 52 L E L L G S S N P P A S A S L 12 64 A S L V A G T L S V H H C A C 12 106 V R P L Q H Q G V N S C D C E 12 V10-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 12 G E L G T S D V V T V V L G Q 12 11 A G E L G T S D V V T V V L G 11 2 L A S F T G R C P A G E L G T 10 3 A S F T G R C P A G E L G T S 9 5 F T G R C P A G E L G T S D V 9 13 E L G T S D V V T V V L G Q D 9 V11-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 11 R L R V M V P P L P S L N P G 19 3 A G S F Q A R L R L R V M V P 16 1 F P A G S F Q A R L R L R V M 15 12 L R V M V P P L P S L N P G P 14 13 R V M V P P L P S L N P G P A 14 7 Q A R L R L R V M V P P L P S 13 9 R L R L R V M V P P L P S L N 12 5 S F Q A R L R L R V M V P P L 10 8 A R L R L R V M V P P L P S L 10 15 M V P P L P S L N P G P A L E 10 V12-HLA-DRB1-0301-5mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 5 C S V M S E E P E G C S Y S T 18 4 S C S V M S E E P E G C S Y S 12 6 S V M S E E P E G C S Y S T L 10 3 S S C S V M S E E P E G C S Y 9 9 S E E P E G C S Y S T L T T V 9 V13-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 10 T V D V L A D P Q E D S G K Q 29 6 D S Q V T V D V L A D P Q E D 22 11 V D V L A D P Q E D S G K Q V 16 V14-HLA-DRB1-0301-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 2 G L E L L G S S N P P A S A S 19 3 L E L L G S S N P P A S A S L 12 15 A S L V A G T L S V H H C A C 12 14 S A S L V A G T L S V H H C A 11 6 L G S S N P P A S A S L V A G 10 11 P P A S A S L V A G T L S V H 9

[1063] 59 TABLE XLVIII Pos 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 score V1-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 205 T S E F H L V P S R S M N G Q 28 299 T L G F P P L T T E H S G I Y 28 47 D A K L P C F Y R G D S G E Q 26 162 G Q G L T L A A S C T A E G S 26 255 D Q N L W H I G R E G A M L K 26 311 G I Y V C H V S N E F S S R D 26 395 E N S I R R L H S H H T D P R 26 415 S V G L R A E G H P D S L K D 26 475 D E G I K Q A M N H F V Q E N 26 7 A E M W G P E A W L L L L L L 22 12 P E A W L L L L L L L A S F T 22 50 L P C F Y R G D S G E Q V G Q 22 51 P C F Y R G D S G E Q V G Q V 22 180 S V T W D T E V K G T T S S R 22 193 S R S F K H S R S A A V T S E 22 241 H V S F L A E A S V R G L E D 22 358 A L L F C L L V V V V V L M S 22 383 T Q K Y E E E L T L T R E N S 22 442 G R S Y S T L T T V R E I E T 22 13 E A W L L L L L L L A S F T G 20 15 W L L L L L L L A S F T G R C 20 16 L L L L L L L A S F T G R C P 20 37 S D V V T V V L G Q D A K L P 20 59 G E Q V G Q V A W A R V D A G 20 76 A Q E L A L L H S K Y G L H V 20 87 G L H V S P A Y E G R V E Q P 20 111 S V L L R N A V Q A D E G E Y 20 144 R V L V P P L P S L N P G P A 20 147 V P P L P S L N P G P A L E E 20 184 D T E V K G T T S S R S F K H 20 201 S A A V T S E F H L V P S R S 20 218 G Q P L T C V V S H P G L L Q 20 227 H P G L L Q D Q R I T H I L H 20 233 D Q R I T H I L H V S F L A E 20 239 I L H V S F L A E A S V R G L 20 242 V S F L A E A S V R G L E D Q 20 247 E A S V R G L E D Q N L W H I 20 258 L W H I G R E G A M L K C L S 20 264 E G A M L K C L S E G Q P P P 20 302 F P P L T T E H S G I Y V C H 20 314 V C H V S N E F S S R D S Q V 20 325 D S Q V T V D V L D P Q E D S 20 340 G K Q V D L V S A S V V V V G 20 342 Q V D L V S A S V V V V G V I 20 347 S A S V V V V G V I A A L L F 20 349 S V V V V G V I A A L L F C L 20 352 V V G V I A A L L F C L L V V 20 353 V G V I A A L L F C L L V V V 20 357 A A L L F C L L V V V V V L M 20 360 L F C L L V V V V V L M S R Y 20 361 F C L L V V V V V L M S R Y H 20 364 L V V V V V L M S R Y H R R K 20 368 V V L M S R Y H R R K A Q Q M 20 389 E L T L T R E N S I R R L H S 20 424 P D S L K D N S S C S V M S E 20 433 C S V M S E E P E G R S Y S T 20 445 Y S T L T T V R E I E T Q T E 20 448 L T T V R E I E T Q T E L L S 20 457 Q T E L L S P G S G R A E E E 20 479 K Q A M N H F V Q E N G T L R 20 483 N H F V Q E N G T L R A K P T 20 28 R C P A G E L E T S D V V T V 18 29 C P A G E L E T S D V V T V V 18 33 E L E T S D V V T V V L G Q D 18 38 D V V T V V L G Q D A K L P C 18 89 H V S P A Y E G R V E Q P P P 18 103 P P R N P L D G S V L L R N A 18 107 P L D G S V L L R N A V Q A D 18 108 L D G S V L L R N A V Q A D E 18 120 A D E G E Y E C R V S T F P A 18 123 G E Y E C R V S T F P A G S F 18 128 R V S T F P A G S F Q A R L R 18 155 P G P A L E E G Q G L T L A A 18 190 T T S S R S F K H S R S A A V 18 219 Q P L T C V V S H P G L L Q D 18 308 E H S G I Y V C H V S N E F S 18 315 C H V S N E F S S R D S Q V T 18 319 N E F S S R D S Q V T V D V L 18 328 V T V D V L D P Q E D S G K Q 18 331 D V L D P Q E D S G K Q V D L 18 339 S G K Q V D L V S A S V V V V 18 373 R Y H R R K A Q Q M T Q K Y E 18 386 Y E E E L T L T R E N S I R R 18 392 L T R E N S I R R L H S H H T 18 407 D P R S Q P E E S V G L R A E 18 423 H P D S L K D N S S C S V M S 18 435 V M S E E P E G R S Y S T L T 18 449 T T V R E I E T Q T E L L S P 18 454 I E T Q T E L L S P G S G R A 18 472 E D Q D E G I K Q A M N H F V 18 134 A G S F Q A R L R L R V L V P 17 318 S N E F S S R D S Q V T V D V 17 64 Q V A W A R V D A G E G A Q E 16 83 H S K Y G L H V S P A Y E G R 16 256 Q N L W H I G R E G A M L K C 16 279 S Y N W T R L D G P L P S G V 16 310 S G I Y V C H V S N E F S S R 16 482 M N H F V Q E N G T L R A K P 16 367 V V V L M S R Y H R R K A Q Q 15 2 P L S L G A E M W G P E A W L 14 6 G A E M W G P E A W L L L L L 14 14 A W L L L L L L L A S F T G R 14 17 L L L L L L A S F T G R C P A 14 18 L L L L L A S F T G R C P A G 14 19 L L L L A S F T G R C P A G E 14 31 A G E L E T S D V V T V V L G 14 36 T S D V V T V V L G Q D A K L 14 39 V V T V V L G Q D A K L P C F 14 41 T V V L G Q D A K L P C F Y R 14 62 V G Q V A W A R V D A G E G A 14 95 E G R V E Q P P P P R N P L D 14 105 R N P L D G S V L L R N A V Q 14 115 R N A V Q A D E G E Y E C R V 14 126 E C R V S T F P A G S F Q A R 14 140 R L R L R V L V P P L P S L N 14 142 R L R V L V P P L P S L N P G 14 143 L R V L V P P L P S L N P G P 14 156 G P A L E E G Q G L T L A A S 14 164 G L T L A A S C T A E G S P A 14 178 A P S V T W D T E V K G T T S 14 207 E F H L V P S R S M N G Q P L 14 213 S R S M N G Q P L T C V V S H 14 221 L T C V V S H P G L L Q D Q R 14 228 P G L L Q D Q R I T H I L H V 14 236 I T H I L H V S F L A E A S V 14 237 T H I L H V S F L A E A S V R 14 250 V R G L E D Q N L W H I G R E 14 265 G A M L K C L S E G Q P P P S 14 268 L K C L S E G Q P P P S Y N W 14 282 W T R L D G P L P S G V R V D 14 286 D G P L P S G V R V D G D T L 14 290 P S G V R V D G D T L G F P P 14 292 G V R V D G D T L G F P P L T 14 327 Q V T V D V L D P Q E D S G K 14 330 V D V L D P Q E D S G K Q V D 14 348 A S V V V V G V I A A L L F C 14 350 V V V V G V I A A L L F C L L 14 356 I A A L L F C L L V V V V V L 14 362 C L L V V V V V L M S R Y H R 14 363 L L V V V V V L M S R Y H R R 14 365 V V V V V L M S R Y H R R K A 14 387 E E E L T L T R E N S I R R L 14 398 I R R L H S H H T D P R S Q P 14 432 S C S V M S E E P E G R S Y S 14 451 V R E I E T Q T E L L S P G S 14 V2-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 9 D A K L P C L Y R G D S G E Q 26 13 P C L Y R G D S G E Q V G Q V 22 12 L P C L Y R G D S G E Q V G Q 20 1 V V T V V L G Q D A K L P C L 14 3 T V V L G Q D A K L P C L Y R 14 4 V V L G Q D A K L P C L Y R G 12 15 L Y R G D S G E Q V G Q V A W 12 V7-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 5 L H S H H T D P R S Q S E E P 18 14 S Q S E E P E G R S Y S T L T 18 2 I R R L H S H H T D P R S Q S 14 12 P R S Q S E E P E G R S Y S T 12 V9-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 37 Y F F L E M E S H Y V A Q A G 26 86 K K K L K K A F R F I Q C L L 26 103 L L K V R P L Q H Q G V N S C 26 12 R I T F N F F L F F F L P F P 22 17 F F L F F F L P F P L V V F F 22 33 Y F Y F Y F F L E M E S H Y V 22 36 F Y F F L E M E S H Y V A Q A 22 76 C A C F E S F T K R K K K L K 22 90 K K A F R F I Q C L L L G L L 22 121 R G Y F Q G I F M Q A A P W E 22 3 R E L L A G I L L R I T F N F 20 8 G I L L R I T F N F F L F F F 20 16 N F F L F F F L P F P L V V F 20 44 S H Y V A Q A G L E L L G S S 20 49 Q A G L E L L G S S N P P A S 20 51 G L E L L G S S N P P A S A S 20 93 F R F I Q C L L L G L L K V R 20 98 C L L L G L L K V R P L Q H Q 20 41 E M E S H Y V A Q A G L E L L 18 62 A S A S L V A G T L S V H H C 18 73 V H H C A C F E S F T K R K K 18 89 L K K A F R F I Q C L L L G L 18 14 T F N F F L F F F L P F P L V 16 15 F N F F L F F F L P F P L V V 16 18 F L F F F L P F P L V V F F I 16 19 L F F F L P F P L V V F F I Y 16 22 F L P F P L V V F F I Y F Y F 16 28 V V F F I Y F Y F Y F F L E M 16 30 F F I Y F Y F Y F F L E M E S 16 31 F I Y F Y F Y F F L E M E S H 16 32 I Y F Y F Y F F L E M E S H Y 16 34 F Y F Y F F L E M E S H Y V A 16 35 Y F Y F F L E M E S H Y V A Q 16 43 E S H Y V A Q A G L E L L G S 16 92 A F R F I Q C L L L G L L K V 16 120 E R G Y F Q G F F M Q A A P W 16 2 R R E L L A G I L L R I T F N 14 7 A G I L L R I T F N F F L F F 14 24 P F P L V V F F I Y F Y F Y F 14 25 F P L V V F F I Y F Y F Y F F 14 26 P L V V F F I Y F Y F Y F F L 14 29 V F F I Y F Y F Y F F L E M E 14 39 F L E M E S H Y V A Q A G L E 14 52 L E L L G S S N P P A S A S L 14 64 A S L V A G T L S V H H C A C 14 70 T L S V H H C A C F E S F T K 14 97 Q C L L L G L L K V R P L Q H 14 100 L L G L L K V R P L Q H Q G V 14 4 E L L A G I L L R I T F N F F 12 5 L L A G I L L R I T F N F F L 12 21 F F L P F P L V V F F I Y F Y 12 46 Y V A Q A G L E L L G S S N P 12 47 V A Q A G L E L L G S S N P P 12 48 A Q A G L E L L G S S N P P A 12 55 L G S S N P P A S A S L V A G 12 56 G S S N P P A S A S L V A G T 12 57 S S N P P A S A S L V A G T L 12 60 P P A S A S L V A G T L S V H 12 61 P A S A S L V A G T L S V H H 12 66 L V A G T L S V H H C A C F E 12 67 V A G T L S V H H C A C F E S 12 75 H C A C F E S F T K R K K K L 12 77 A C F E S F T K R K K K L K K 12 94 R F I Q C L L L G L L K V R P 12 95 F I Q C L L L G L L K V R P L 12 104 L K V R P L Q H Q G V N S C D 12 108 P L Q H Q G V N S C D C E R G 12 114 V N S C D C E R G Y F Q G I F 12 118 D C E R G Y F Q G I F M Q A A 12 122 G Y F Q G I F M Q A A P W E G 12 V10-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 8 R C P A G E L G T S D V V T V 18 13 E L G T S D V V T V V L G Q D 18 11 A G E L G T S D V V T V V L G 14 5 F T G R C P A G E L G T S D V 12 9 C P A G E L G T S D V V T V V 12 12 G E L G T S D V V T V V L G Q 12 V11-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 13 R V M V P P L P S L N P G P A 20 3 A G S F Q A R L R L R V M V P 17 11 R L R V M V P P L P S L N P G 14 12 L R V M V P P L P S L N P G P 14 1 F P A G S F Q A R L R L R V M 12 4 G S F Q A R L R L R V M V P P 12 8 A R L R L R V M V P P L P S L 12 10 L R L R V M V P P L P S L N P 12 V12-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 14 G C S Y S T L T T V R E I E T 22 5 C S V M S E E P E G C S Y S T 20 4 S C S V M S E E P E G C S Y S 14 1 D N S S C S V M S E E P E G C 12 7 V M S E E P E G C S Y S T L T 12 8 M S E E P E G C S Y S T L T T 12 10 E E P E G C S Y S T L T T V R 12 11 E P E G C S Y S T L T T V R E 12 V13-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 10 T V D V L A D P Q E D S G K Q 26 13 V L A D P Q E D S G K Q V D L 18 6 D S Q V T V D V L A D P Q E D 14 8 Q V T V D V L A D P Q E D S G 14 2 F S S R D S Q V T V D V L A D 12 3 S S R D S Q V T V D V L A D P 12 7 S Q V T V D V L A D P Q E D S 12 14 L A D P Q E D S G K Q V D L V 12 V14-HLA-DRB1-0401-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 29; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 2 G L E L L G S S N P P A S A S 20 13 A S A S L V A G T L S V H H C 18 3 L E L L G S S N P P A S A S L 14 15 A S L V A G T L S V H H C A C 14 6 L G S S N P P A S A S L V A G 12 7 G S S N P P A S A S L V A G T 12 8 S S N P P A S A S L V A G T L 12 11 P P A S A S L V A G T L S V H 12 12 P A S A S L V A G T L S V H H 12

[1064] 60 TABLE XLIX Pos 1 2 3 4 5 6 7 8 9 0 1 2 3 4 5 score V1-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 255 D Q N L W H I G R E G A M L K 26 279 S Y N W T R L D G P L P S G V 25 12 P E A W L L L L L L L A S F T 23 201 S A A V T S E F H L V P S R S 23 64 Q V A W A R V D A G E G A Q E 22 140 R L R L R V L V P P L P S L N 22 218 G Q P L T C V V S H P G L L Q 22 233 D Q R I T H I L H V S F L A E 22 286 D G P L P S G V R V D G D T L 22 299 T L G F P P L T T E H S G I Y 22 368 V V L M S R Y H R R K A Q Q M 22 37 S D V V T V V L G Q D A K L P 21 261 I G R E G A M L K C L S E G Q 21 361 F C L L V V V V V L M S R Y H 21 47 D A K L P C F Y R G D S G E Q 20 134 A G S F Q A R L R L R V L V P 20 180 S V T W D T E V K G T T S S R 20 365 V V V V V L M S R Y H R R K A 20 386 Y E E E L T L T R E N S I R R 20 392 L T R E N S I R R L H S H H T 20 415 S V G L R A E G H P D S L K D 20 347 S A S V V V V G V I A A L L F 19 358 A L L F C L L V V V V V L M S 19 13 E A W L L L L L L L A S F T G 18 16 L L L L L L L A S F T G R C P 18 76 A Q E L A L L H S K Y G L H V 18 91 S P A Y E G R V E Q P P P P R 18 122 E G E Y E C R V S T F P A G S 18 144 R V L V P P L P S L N P G P A 18 147 V P P L P S L N P G P A L E E 18 241 H V S F L A E A S V R G L E D 18 265 G A M L K C L S E G Q P P P S 18 311 G I Y V C H V S N E F S S R D 18 442 G R S Y S T L T T V R E I E T 18 204 V T S E F H L V P S R S M N G 17 205 T S E F H L V P S R S M N G Q 17 367 V V V L M S R Y H R R K A Q Q 17 190 T T S S R S F K H S R S A A V 16 277 P P S Y N W T R L D G P L P S 16 346 V S A S V V V V G V I A A L L 16 360 L F C L L V V V V V L M S R Y 16 487 Q E N G T L R A K P T G N G I 16 75 G A Q E L A L L H S K Y G L H 15 107 P L D G S V L L R N A V Q A D 15 178 A P S V T W D T E V K G T T S 15 192 S S R S F K H S R S A A V T S 15 219 Q P L T C V V S H P G L L Q D 15 230 L L Q D Q R I T H I L H V S F 15 343 V D L V S A S V V V V G V I A 15 362 C L L V V V V V L M S R Y H R 15 363 L L V V V V V L M S R Y H R R 15 411 Q P E E S V G L R A E G H P D 15 476 E G I K Q A M N H F V Q E N G 15 485 F V Q E N G T L R A K P T G N 15 20 L L L A S F T G R C P A G E L 14 34 L E T S D V V T V V L G Q D A 14 36 T S D V V T V V L G Q D A K L 14 41 T V V L G Q D A K L P C F Y R 14 59 G E Q V G Q V A W A R V D A G 14 61 Q V G Q V A W A R V D A G E G 14 81 L L H S K Y G L H V S P A Y E 14 138 Q A R L R L R V L V P P L P S 14 162 G Q G L T L A A S C T A E G S 14 181 V T W D T E V K G T T S S R S 14 184 D T E V K G T T S S R S F K H 14 227 H P G L L Q D Q R I T H I L H 14 252 G L E D Q N L W H I G R E G A 14 276 P P P S Y N W T R L D G P L P 14 290 P S G V R V D G D T L G F P P 14 308 E H S G I Y V C H V S N E F S 14 350 V V V V G V I A A L L F C L L 14 357 A A L L F C L L V V V V V L M 14 364 L V V V V V L M S R Y H R R K 14 397 S I R R L H S H H T D P R S Q 14 401 L H S H H T D P R S Q P E E S 14 420 A E G H P D S L K D N S S C S 14 433 C S V M S E E P E G R S Y S T 14 435 V M S E E P E G R S Y S T L T 14 445 Y S T L T T V R E I E T Q T E 14 454 I E T Q T E L L S P G S G R A 14 457 Q T E L L S P G S G R A E E E 14 479 K Q A M N H F V Q E N G T L R 14 483 N H F V Q E N G T L R A K P T 14 19 L L L L A S F T G R C P A G E 13 40 V T V V L G Q D A K L P C F Y 13 85 K Y G L H V S P A Y E G R V E 13 106 N P L D G S V L L R N A V Q A 13 137 F Q A R L R L R V L V P P L P 13 215 S M N G Q P L T C V V S H P G 13 237 T H I L H V S F L A E A S V R 13 327 Q V T V D V L D P Q E D S G K 13 340 G K Q V D L V S A S V V V V G 13 349 S V V V V G V I A A L L F C L 13 353 V G V I A A L L F C L L V V V 13 451 V R E I E T Q T E L L S P G S 13 3 L S L G A E M W G P E A W L L 12 14 A W L L L L L L L A S F T G R 12 15 W L L L L L L L A S F T G R C 12 22 L A S F T G R C P A G E L E T 12 62 V G Q V A W A R V D A G E G A 12 73 G E G A Q E L A L L H S K Y G 12 82 L H S K Y G L H V S P A Y E G 12 83 H S K Y G L H V S P A Y E G R 12 92 P A Y E G R V E Q P P P P R N 12 109 D G S V L L R N A V Q A D E G 12 112 V L L R N A V Q A D E G E Y E 12 123 G E Y E C R V S T F P A G S F 12 141 L R L R V L V P P L P S L N P 12 153 L N P G P A L E E G Q G L T L 12 159 L E E G Q G L T L A A S C T A 12 164 G L T L A A S C T A E G S P A 12 207 E F H L V P S R S M N G Q P L 12 236 I T H I L H V S F L A E A S V 12 239 I L H V S F L A E A S V R G L 12 247 E A S V R G L E D Q N L W H I 12 268 L K C L S E G Q P P P S Y N W 12 292 G V R V D G D T L G F P P L T 12 310 S G I Y V C H V S N E F S S R 12 324 R D S Q V T V D V L D P Q E D 12 329 T V D V L D P Q E D S G K Q V 12 337 E D S G K Q V D L V S A S V V 12 395 E N S I R R L H S H H T D P R 12 413 E E S V G L R A E G H P D S L 12 421 E G H P D S L K D N S S C S V 12 429 D N S S C S V M S E E P E G R 12 448 L T T V R E I E T Q T E L L S 12 455 E T Q T E L L S P G S G R A E 12 489 N G T L R A K P T G N G I Y I 12 V2-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 5; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 9 D A K L P C L Y R G D S G E Q 26 3 T V V L G Q D A K L P C L Y R 14 2 V T V V L G Q D A K L P C L Y 13 V7-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 15; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 1 S I R R L H S H H T D P R S Q 14 5 L H S H H T D P R S Q S E E P 14 14 S Q S E E P E G R S Y S T L T 14 3 R R L H S H H T D P R S Q S E 8 12 P R S Q S E E P E G R S Y S T 8 2 I R R L H S H H T D P R S Q S 6 8 H H T D P R S Q S E E P E G R 6 10 T D P R S Q S E E P E G R S Y 6 V9-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 97 Q C L L L G L L K V R P L Q H 28 121 R G Y F Q G I F M Q A A P W E 22 37 Y F F L E M E S H Y V A Q A G 21 79 F E S F T K R K K K L K K A F 21 76 C A C F E S F T K R K K K L K 20 103 L L K V R P L Q H Q G V N S C 20 22 F L P F P L V V F F I Y F Y F 19 17 F F L F F F L P F P L V V F F 18 49 Q A G L E L L G S S N P P A S 18 66 L V A G T L S V H H C A C F E 18 34 F Y F Y F F L E M E S H Y V A 17 90 K K A F R F I Q C L L L G L L 17 120 E R G Y F Q G I F M Q A A P W 17 15 F N F F L F F F L P F P L V V 16 33 Y F Y F Y F F L E M E S H Y V 16 36 F Y F F L E M E S H Y V A Q A 16 86 K K K L K K A F R F I Q C L L 15 3 R E L L A G I L L R I T F N F 14 4 E L L A G I L L R I T F N F F 14 13 I T F N F F L F F F L P F P L 14 V9-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 19; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 67 V A G T L S V H H C A C F E S 14 83 T K R K K K L K K A F R F I Q 14 111 H Q G V N S C D C E R G Y F Q 14 26 P L V V F F I Y F Y F Y F F L 13 61 P A S A S L V A G T L S V H H 13 93 F R F I Q C L L L G L L K V R 13 98 C L L L G L L K V R P L Q H Q 13 V10-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 21; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 14 L G T S D V V T V V L G Q D A 14 2 L A S F T G R C P A G E L G T 12 13 E L G T S D V V T V V L G Q D 9 1 L L A S F T G R C P A G E L G 7 4 S F T G R C P A G E L G T S D 7 6 T G R C P A G E L G T S D V V 6 8 R C P A G E L G T S D V V T V 6 11 A G E L G T S D V V T V V L G 6 V11-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 23; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 9 R L R L R V M V P P L P S L N 22 3 A G S F Q A R L R L R V M V P 20 13 R V M V P P L P S L N P G P A 18 7 Q A R L R L R V M V P P L P S 14 6 F P A R L R L R V M V P P L P 13 10 L R L R V M V P P L P S L N P 12 1 F P A G S F Q A R L R L R V M 10 V12-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 25; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 14 G C S Y S T L T T V R E I E T 18 1 D N S S C S V M S E E P E G C 12 5 C S V M S E E P E G C S Y S T 12 2 N S S C S V M S E E P E G C S 7 V13-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 27; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 6 D S Q V T V D V L A D P Q E D 17 8 Q V T V D V L A D P Q E D S G 13 10 T V D V L A D P Q E D S G K Q 12 11 V D V L A D P Q E D S G K Q V 12 4 S R D S Q V T V D V L A D P Q 10 15 A D P Q E D S G K Q V D L V S 9 V14-HLA-DRB1-1101-15mers-191P4D12B Each peptide is a portion of SEQ ID NO: 3; each start position is specified, the length of peptide is 15 amino acids, and the end position for each peptide is the start position plus fourteen. 12 P A S A S L V A G T L S V H H 13 2 G L E L L G S S N P P A S A S 12 31 L E L L G S S N P P A S A S L 12 11 P P A S A S L V A G T L S V H 8 8 S S N P P A S A S L V A G T L 7 14 S A S L V A G T L S V H H C A 7 1 A G L E L L G S S N P P A S A 6 4 E L L G S S N P P A S A S L V 6 5 L L G S S N P P A S A S L V A 6 9 S N P P A S A S L V A G T L S 6 15 A S L V A G T L S V H H C A C 6

[1065] 61 TABLE L Properties of 191P4D12(b) Bioinformatic Program URL Outcome 191P4D12(b)B v.1 ORF ORF finder 264-1796 Protein length 510 aa Transmembrane region TM Pred http://www.ch.embnet.org/ 2 TM, aa 14-30, 351-370 HMMTop http://www.enzim.hu/hmmtop/ 1 TM, aa 347-371 Sosui http://www.genome.ad.jp/SOSui/ 2 TM, aa 14-31, 347-369 TMHMM http://www.cbs.dtu.dk/services/TMHMM 1 TM, aa 350-372 Signal Peptide Signal P http://www.cbs.dtu.dk/services/SignalP/ yes, cleaved aa 31-32 pI pI/MW tool http://www.expasy.ch/tools/ pI 5.27 Molecular weight pI/MW tool http://www.expasy.ch/tools/ 55.4 kDa Localization PSORT http://psort.nibb.ac.jp/ 46% plasma membrane 39.1% cytoplasmic, 21% PSORT II http://psort.nibb.ac.jp/ nuclear Motifs Pfam http://www.sanger.ac.uk/Pfam/ Immunoglobulin domain Prints http://www.biochem.ucl.ac.uk/ Cadherin signature Blocks http://www.blocks.fhcrc.org/ Ig domain, Herpesvirus glycoprotein D v.6 ORF ORF finder Protein length 295 aa Transmembrane region TM Pred http://www.ch.embnet.org/ 1 TM, aa 135-156 HMMTop http://www.enzim.hu/hmmtop/ 1 TM, aa 132-156 Sosui http://www.genome.ad.jp/SOSui/ 1 TM, aa 132-154 TMHMM http://www.cbs.dtu.dk/services/TMHMM 1 TM, aa 135-157 Signal Peptide Signal P http://www.cbs.dtu.dk/services/SignalP/ none pI pI/MW tool http://www.expasy.ch/tools/ pI 5.28 Molecular weight pI/MW tool http://www.expasy.ch/tools/ 32.6 kDa Localization PSORT http://psort.nibb.ac.jp/ 70% plasma membrane, 20% endoplasmic reticulum 39% cytoplasmic, 21% PSORT II http://psort.nibb.ac.jp/ nuclear Motifs Pfam http://www.sanger.ac.uk/Pfam/ Immunoglobulin domain Prints http://www.biochem.ucl.ac.uk/ none Blocks http://www.blocks.fhcrc.org/ Herpesvirus glycoprotein D

[1066] 62 TABLE LI Exon boundaries of transcript 191P4D12(b) v.1 Exon Number Start End Length 1 2 342 341 2 343 702 360 3 703 993 291 4 994 1114 121 5 1115 1263 149 6 1264 1420 157 7 1421 1496 76 8 1497 1571 75 9 1572 3459 1888

[1067] 63 TABLE LII(a) Nucleotide sequence of transcript variant 191P4012(b) v.6 (SEQ ID NO: 105) ggccgtcgtt gttggccaca gcgtgggaag cagctctggg ggagctcgga gctcccgatc 60 acggcttctt gggggtagct acggctgggt gtgtagaacg gggccggggc tggggctggg 120 tcccctagtg gagacccaag tgcgagaggc aagaactctg cagcttcctg ccttctgggt 180 cagttcctta ttcaagtctg ctactgctgg catcatttac aggccggtgc cccgcgggtg 240 agctggagac ctcagacgtg gtaactgtgg tgctgggcca ggacgcaaaa ctgccctgct 300 tctaccgagg ggactccggc gagcaagtgg ggcaagtggc atgggctcgg gtggacgcgg 360 gcgaaggcgc ccaggaacta gcgctactgc actccaaata cgggcttcat gtgagcccgg 420 cttacgaggg ccgcgtggag cagccgccgc ccccacgcaa ccccctggac ggctcagtgc 480 tcctgcgcaa cgcagtgcag gcggatgagg gcgagtacga gtgccgggtc agcaccttcc 540 ccgccggcag cttccaggcg cggctgcggc tccgagtgct ggtgcctccc ctgccctcac 600 tgaatcctgg tccagcacta gaagagggcc agggcctgac cctggcagcc tcctgcacag 660 ctgagggcag cccagccccc agcgtgacct gggacacgga ggtcaaaggc acaacgtcca 720 gccgttcctt caagcactcc cgctctgctg ccgtcacctc agagttccac ttggtgccta 780 gccgcagcat gaatgggcag ccactgactt gtgtggtgtc ccatcctggc ctgctccagg 840 accaaaggat cacccacatc ctccacgtgt ccttccttgc tgaggcctct gtgaggggcc 900 ttgaagacca aaatctgtgg cacattggca gagaaggagc tatgctcaag tgcctgagtg 960 aagggcagcc ccctccctca tacaactgga cacggctgga tgggcctctg cccagtgggg 1020 tacgagtgga tggggacact ttgggctttc ccccactgac cactgagcac agcggcatct 1080 acgtctgcca tgtcagcaat gagttctcct caagggattc tcaggtcact gtggatgttc 1140 ttgaccccca ggaagactct gggaagcagg tggacctagt gtcagcctcg gtggtggtgg 1200 tgggtgtgat cgccgcactc ttgttctgcc ttctggtggt ggtggtggtg ctcatgtccc 1260 gataccatcg gcgcaaggcc cagcagatga cccagaaata tgaggaggag ctgaccctga 1320 ccagggagaa ctccatccgg aggctgcatt cccatcacac ggaccccagg agccagccgg 1380 aggagagtgt agggctgaga gccgagggcc accctgatag tctcaaggac aacagtagct 1440 gctctgtgat gagtgaagag cccgagggcc gcagttactc cacgctgacc acggtgaggg 1500 agatagaaac acagactgaa ctgctgtctc caggctctgg gcgggccgag gaggaggaag 1560 atcaggatga aggcatcaaa caggccatga accattttgt tcaggagaat gggaccctac 1620 gggccaagcc cacgggcaat ggcatctaca tcaatgggcg gggacacctg gtctgaccca 1680 ggcctgcctc ccttccctag gcctggctcc ttctgttgac atgggagatt ttagctcatc 1740 ttgggggcct ccttaaacac ccccatttct tgcggaagat gctccccatc ccactgactg 1800 cttgaccttt acctccaacc cttctgttca tcgggagggc tccaccaatt gagtctctcc 1860 caccatgcat gcaggtcact gtgtgtgtgc atgtgtgcct gtgtgagtgt tgactgactg 1920 tgtgtgtgtg gaggggtgac tgtccgtgga ggggtgactg tgtccgtggt gtgtattatg 1980 ctgtcatatc agagtcaagt gaactgtggt gtatgtgcca cgggatttga gtggttgcgt 2040 gggcaacact gtcagggttt ggcgtgtgtg tcatgtggct gtgtgtgacc tctgcctgaa 2100 aaagcaggta ttttctcaga ccccagagca gtattaatga tgcagaggtt ggaggagaga 2160 ggtggagact gtggctcaga cccaggtgtg cgggcatagc tggagctgga atctgcctcc 2220 ggtgtgaggg aacctgtctc ctaccacttc ggagccatgg gggcaagtgt gaagcagcca 2280 gtccctgggt cagccagagg cttgaactgt tacagaagcc ctctgccctc tggtggcctc 2340 tgggcctgct gcatgtacat attttctgta aatatacatg cgccgggagc ttcttgcagg 2400 aatactgctc cgaatcactt ttaatttttt tctttttttt ttcttgccct ttccattagt 2460 tgtatttttt atttattttt atttttattt ttttttagag atggagtctc actatgttgc 2520 tcaggctggc cttgaactcc tgggctcaag caatcctcct gcctcagcct ccctagtagc 2580 tgggacttta agtgtacacc actgtgcctg ctttgaatcc tttacgaaga gaaaaaaaaa 2640 attaaagaaa gcctttagat ttatccaatg tttactactg ggattgctta aagtgaggcc 2700 cctccaacac cagggggtta attcctgtga ttgtgaaagg ggctacttcc aaggcatctt 2760 catgcaggca gccccttggg agggcacctg agagctggta gagtctgaaa ttagggatgt 2820 gagcctcgtg yttactgagt aaggtaaaat tgcatccacc attgtttgtg ataccttagg 2880 gaattgcttg gacctggtga caagggctcc tgttcaatag tggtgttggg gagagagaga 2940 gcagtgatta tagaccgaga gagtaggagt tgaggtgagg tgaaggaggt gctgggggtg 3000 agaatgtcgc ctttccccct gggttttgga tcactaattc aaggctcttc tggatgtttc 3060 tctgggttgg ggctggagtt caatgaggtt tatttttagc tggcccaccc agatacactc 3120 agccagaata cctagattta gtacccaaac tcttcttagt ctgaaatctg ctggatttct 3180 ggcctaaggg agaggctccc atccttcgtt ccccagccag cctaggactt cgaatgtgga 3240 gcctgaagat ctaagatcct aacatgtaca ttttatgtaa atatgtgcaa atttgtacat 3300 aaaatgatat tctgttttta aataaacaga caaaacttga aaaa 3344

[1068] 64 TABLE LIII(a) Nucleotide sequence alignment of 191P4D12(b) v.1 (SEQ ID NO: 106) and 191 P4012(b) v.6 (SEQ ID NO: 107). V.1 1 gGCCGTCGTTGTTGGCCACAGCGTGGGAAGCAGCTCTGGGGGAGCTCGGA 50 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1 ggccgtcgttgttqgccacagcqtgggaagcagctctggqggagctcgga 50 V.1 51 GCTCCCGATCACGGCTTCTTGGOGGTAGCTACGGCTGGGTGTGTAGAACG 100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 51 gctcccgatcacggcttcttgggqgtagctacggctgggtgtgtagaacg 100 V.1 101 GGGCCGGGGCTGGGGCTGGGTCCCCTAGTGGAGACCCAAGTGCGAGAGGC 150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 101 gggccggggctggggctgggtcccctagtggagacccaagtgcgagaggc 150 V.1 151 AAGAACTCTGCAGCTTCCTGCCTTCTGGGTCAGTTCCTTATTCAAGTCTG 200 ||||||||||||||||||||||||||||||||||||||||||||||| V.6 151 aagaactctgcaqcttcctqccttctgggtcagttccttattcaagt--- 197 V.1 201 CAGCCGCCTCCCAGGGAGATCTCGGTGGAACTTCAGAAACGCTGGGCAGT 250 V.6 198 -------------------------------------------------- 197 V.1 251 CTCCCTTTCAACCATGCCCCTGTCCCTGGGAGCCGAGATGTGGGGGCCTG 300 V.6 198 -------------------------------------------------- 197 V.1 301 AGGCCTGGCTGCTGCTGCTGCTACTGCTGGCATCATTTACAGGCCGGTGC 350                  ||||||||||||||||||||||||||||||||| V.6 198 -----------------ctgctactgctgqcatcatttacagqccggtgc 230 V.1 351 CCCGCGGGTGACCTGGAGACCTCAGACGTGGTAACTGTGGTGCTGGGCCA 400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 231 cccgcgqgtgagctggagacctcaqacgtggtaactgtggtgctgggcca 280 V.1 401 GGACGCAAAACTGCCCTGCTTCTACCGAGGGGACTCCGGCGAGCAAGTGG 450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 281 ggacgcaaaactgccctgcttctaccgaggggactccggcgagcaagtgg 330 V.1 451 GGCAAGTGGCATGGGCTCGGGTGGACGCGGGCGAAGGCGCCCAGGAACTA 500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 331 ggcaagtggcatgggctcgggtggacgcgggcgaaqgcgcccaggaacta 380 V.1 501 GCGCTACTGCACTCCAAATACGGGCTTCATGTGAGCCCGGCTTACGAGGG 550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 381 gcgctactgcactccaaatacgggcttcatgtgagcccggcttacgaggg 430 V.1 551 CCGCGTGGAGCAGCCGCCGCCCCCACGCAACCCCCTGGACGGCTCAGTGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 431 ccgcgtggagcagccgccgcccccacgcaaccccctggacggctcagtgc 480 V.1 601 TCCTGCGCAACGCAGTGCAGGCGGATGAGGGCGAGTACGAGTGCCGGGTC 650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 481 tcctgcgcaacgcagtgcaggcygatgagggcgagtacgagtgccgggtc 530 V.1 651 AGCACCTTCCCCGCCGGCAGCTTCCAGGCGCGGCTGCGGCTCCGAGTGCT 700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 531 agcaccttccccgccggcagcttccaggcgcggctgcggctccgagtgct 580 V.1 701 GCTGCCTCCCCTGCCCTCACTGAATCCTGGTCCAGCACTAGAAGAGGGCC 750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 581 ggtgcctcccctgccctcactgaatcctggtccagcactagaagagggcc 630 V.1 751 AGGGCCTGACCCTGGCAGCCTCCTGCACAGCTGAGGGCAGCCCAGCCCCC 800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 631 agggcctgaccctggcagcctcctgcacagctgagggcagcccagccccc 680 V.1 801 AGCGTGACCTGGGACACGGAGGTCAAAGGCACAACGTCCAGCCGTTCCTT 850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 681 agcgtgacctgggacacggaggtcaaaggcacaacgtccagccgttcctt 730 V.1 851 CAAGCACTCCCGCTCTGCTGCCGTCACCTCAGAGTTCCACTTGGTGCCTA 900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 731 caagcactcccgctctgctgccgtcacctcagagttccacttggtgccta 780 V.1 901 GCCGCAGCATGAATGGGCAGCCACTGACTTGTGTGGTGTCCCATCCTGGC 950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 781 gccgcagcatgaatgggcagccactgacttgtgtggtgtcccatcctggc 830 V.1 951 CTGCTCCAGGACCAAAGGATCACCCACATCCTCCACGTGTCCTTCCTTGC 1000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 831 ctgctccaggaccaaaggatcacccacatcctccacgtgtccttccttgc 880 V.1 1001 TGAGGCCTCTGTGAGGGGCCTTGAAGACCAAAATCTGTGGCACATTGGCA 1050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 881 tgaggcctctgtgaggggccttgaagaccaaaatctgtggcacattggca 930 V.1 1051 GAGAACGAGCTATGCTCAAGTGCCTGAGTGAAGGGCAGCCCCCTCCCTCA 1100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 931 gagaaggagctatgctcaagtgcctgagtgaagggcagccccctccctca 980 V.1 1101 TACAACTGGACACGGCTGGATGGGCCTCTGCCCAGTGGGGTACGAGTGGA 1150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 981 tacaactggacacggctggatgggcctctgcccagtggggtacgagtgga 1030 V.1 1151 TGGGGACACTTTGGGCTTTCCCCCACTGACCACTGAGCACAGCGGCATCT 1200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1031 tggggacactttgggctttcccccactgaccactgagcacagcggcatct 1080 V.1 1201 ACGTCTGCCATGTCAOCAATGAGTTCTCCTCAAGGGATTCTCAGGTCACT 1250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1081 acgtctgccatgtcagcaatgagttctcctcaagggattctcaggtcact 1130 V.1 1251 GTGGATCTTCTTGACCCCCAGGAAGACTCTGGGAAGCAGGTGGACCTAGT 1300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1131 gtggatgttcttgacccccaggaagactctgggaagcaggtggacctagt 1180 V.1 1301 GTCAGCCTCGGTGGTGGTGGTGGGTGTGATCGCCGCACTCTTGTTCTGCC 1350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1181 gtcagcctcggtggtggtggtgggtgtgatcgccgcactcttgttctgcc 1230 V.1 1351 TTCTGGTCGTGGTGGTGGTGCTCATGTCCCGATACCATCGGCGCAAGGCC 1400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1231 ttctggtggtggtggtggtgctcatgtcccgataccatcggcgcaaggcc 1280 V.1 1401 CAGCAGATGACCCAGAAATATGAGGAGGAGCTGACCCTGACCAGGGAGAA 1450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1281 cagcagatgacccagaaatatgaggaggagctgaccctgaccagggaaaa 1330 V.1 1451 CTCCATCCGGAGGCTGCATTCCCATCACACGGACCCCAGGAGCCAGCCGG 1500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1331 ctccatccggaggctgcattcccatcacacggaccccaggagccagccgg 1380 V.1 1501 AGGAGAGTGTAGGGCTGAGAGCCGAGGGCCACCCTGATAGTCTCAAGGAC 1550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1381 aggagagtgtagqgctgagagccgagggccaccctgatagtctcaaggac 1430 V.1 1551 AACAGTAGCTGCTCTGTGATGAGTGAAGAGCCCGAGGGCCGCAGTTACTC 1600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1431 aacagtagctgctctgtgatgagtgaagagcccgagggccgcagttactc 1480 V.1 1601 CACGCTGACCACGGTGAGGGAGATAGAAACACAGACTGAACTGCTGTCTC 1650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1481 cacgctgaccacggtgagggagatagaaacacagactgaactgctgtctc 1530 V.1 1651 CAGGCTCTGGGCGGGCCGAGGAGGAGGAAGATCAGGATGAAGGCATCAAA 1700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1531 caggctctgggcgggccgaggaggaggaagatcaggatgaaggcatcaaa 1580 V.1 1701 CAGGCCATGAACCATTTTGTTCAGGAGAATGCGACCCTACGGGCCAAGCC 1750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1581 caggccatgaaccattttgttcaggagaatgggaccctacgggccaagcc 1630 V.1 1751 CACGGGCAATGGCATCTACATCAATGGGCGGGGACACCTGGTCTGACCCA 1800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1631 cacgggcaatggcatctacatcaatgggcggqgacacctggtctgaccca 1680 V.1 1801 GGCCTGCCTCCCTTCCCTAGGCCTGGCTCCTTCTGTTGACATGGGAGATT 1850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1681 ggcctgcctcccttccctaggcctggctccttctgttgacatgggagatt 1730 V.1 1851 TTAGCTCATCTTGGGGGCCTCCTTAAACACCCCCATTTCTTGCGGAAGAT 1900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1731 ttagctcatcttgggggcctccttaaacacccccatttcttgcggaagat 1780 V.1 1901 GCTCCCCATCCCACTGACTGCTTGACCTTTACCTCCAACCCTTCTGTTCA 1950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1781 gctccccatcccactgactgcttgacctttacctccaacccttctgttca 1830 V.1 1951 TCGGGAGGGCTCCACCAATTGAGTCTCTCCCACCATGCATGCAGGTCACT 2000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1831 tcgggagggctccaccaattgagtctctcccaccatgcatgcaggtcact 1880 V.1 2001 GTGTGTGTGCATGTGTGCCTGTGTGAGTGTTGACTGACTGTGTGTGTGTG 2050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1881 qtgtgtgtgcatgtgtgcctgtgtgagtgttgactgactgtgtgtgtgtg 1930 V.1 2051 GAGGGGTGACTGTCCGTGGAGGGGTGACTGTGTCCGTGGTGTGTATTATG 2100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1931 gaggggtgactgtccgtggaggggtgactgtgtccgtggtgtgtattatg 1980 V.1 2101 CTGTCATATCAGAGTCAAGTGAACTGTGGTGTATCTGCCACGGGATTTGA 2150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1981 ctgtcatatcagagtcaagtgaactgtggtgtatgtgccacgggatttga 2030 V.1 2151 GTGGTTGCGTGGGCAACACTGTCAGGGTTTGGCGTGTGTGTCATGTGGCT 2200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2031 gtggttgcgtgggcaacactgtcagggtttggcgtgtgtgtcatgtggct 2080 V.1 2201 GTGTGTGACCTCTGCCTGAAAAAGCAGGTATTTTCTCAGACCCCAGAGCA 2250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2081 gtgtgtgacctctgcctgaaaaagcaggtattttctcagaccccagagca 2130 V.1 2251 GTATTAATGATGCAGAGGTTGGAGGAGAGAGGTGGAGACTGTGGCTCAGA 2300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2131 gtattaatgatgcagaggttggaggagagagqtggagactgtggctcaga 2180 V.1 2301 CCCAGGTGTGCGGGCATAGCTGGAGCTGGAATCTGCCTCCGGTGTGAGGG 2350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2181 cccaggtgtgcgggcatagctggagctggaatctgcctccggtgtgaggg 2230 V.1 2351 AACCTGTCTCCTACCACTTCGGAGCCATGGGGGCAAGTGTGAAGCAGCCA 2400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2231 aacctgtctcctaccacttcggagccatgggggcaagtgtgaagcagcca 2280 V.1 2401 GTCCCTGGGTCAGCCAGAGGCTTGAACTGTTACAGAAGCCCTCTGCCCTC 2450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2281 gtccctgggtcagccagaggcttgaactgttacagaagccctctgccctc 2330 V.1 2451 TGGTGGCCTCTGGGCCTGCTGCATGTACATATTTTCTGTAAATATACATG 2500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2331 tggtqgcctctgggcctgctgcatgtacatattttctgtaaatatacatg 2380 V.1 2501 CGCCGGGAGCTTCTTGCAGGAATACTGCTCCGAATCACTTTTAATTTTTT 2550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2381 cgccgggagcttcttgcaggaatactgctccgaatcacttttaatttttt 2430 V.1 2551 TCTTTTTTTTTTCTTGCCCTTTCCATTAGTTGTATTTTTTATTTATTTTT 2600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2431 tcttttttttttcttgccctttccattagttgtattttttatttattttt 2480 V.1 2601 ATTTTTATTTTTTTTTAGAGATGGAGTCTCACTATGTTGCTCAGGCTGGC 2650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2481 atttttatttttttttagaqatggagtctcactatgttgctcaggctggc 2530 V.1 2651 CTTGAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCCTCCCTAGTAGC 2700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2531 cttgaactcctgggctcaagcaatcctcctgcctcagcctccctagtagc 2580 V.1 2701 TGGGACTTTAAGTGTACACCACTGTGCCTGCTTTGAATCCTTTACGAACA 2750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2581 tgggactttaagtgtacaccactgtgcctgctttgaatcctttacgaaca 2630 V.1 2751 GAAAAAAAAAATTAAAGAAAGCCTTTAGATTTATCCAATGTTTACTACTG 2800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2631 gaaaaaaaaaattaaagaaagcctttagatttatccaatgtttactactg 2680 V.1 2801 GGATTGCTTAAAGTGAGGCCCCTCCAACACCAGGGGGTTAATTCCTGTGA 2850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2681 ggattgcttaaagtgaggcccctccaacaccagggggttaattcctgtga 2730 V.1 2851 TTGTGAAAGGGGCTACTTCCAAGGCATCTTCATGCAGGCAGCCCCTTGGG 2900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2731 ttgtgaaaggggctacttccaaggcatcttcatgcaggcagccccttggg 2780 V.1 2901 AGGGCACCTGAGAGCTGGTAGAGTCTGAAATTAGGGATGTGAGCCTCGTG 2950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2781 agggcacctgagagctggtagagtctgaaattagggatgtgagcctcgtg 2830 V.1 2951 GTTACTGAGTAAGGTAAAATTGCATCCACCATTGTTTGTGATACCTTAGG 3000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2831 gttactgagtaaggtaaaattggatggaggattgtttgtgataggttagg 2880 V.1 3001 GAATTGCTTGGACCTGGTGACAAGGGCTCCTGTTCAATAGTGGTGTTGGG 3050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2881 gaattgcttggacctggtgacaagggctcctgttcaatagtggtgttggg 2930 V.1 3051 GAGAGAGAGAGCAGTGATTATAGACCGAGAGAGTAGGAGTTGAGGTGAGG 3100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2931 gagagagagagcagtgattatagaccgagagagtaggagttgaqgtgagg 2980 V.1 3101 TGAAGGAGGTGCTGGGGGTGAGAATGTCGCCTTTCCCCCTGGGTTTTGGA 3150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 2981 tgaaggaggtgctggqggtgagaatgtcgcctttccccctgggttttgga 3030 V.1 3151 TCACTAATTCAAGGCTCTTCTGGATGTTTCTCTGGGTTGGGGCTGGAGTT 3200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 3031 tcactaattcaaggctcttctggatgtttctctgggttggggctggagtt 3080 V.1 3201 CAATGAGGTTTATTTTTAGCTGGCCCACCCAGATACACTCAGCCAGAATA 3250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 3081 caatgaggtttatttttagctggcccacccagatacactcagccagaata 3130 V.1 3251 CCTAGATTTAGTACCCAAACTCTTCTTAGTCTGAAATCTGCTGGATTTCT 3300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 3131 cctagatttagtacccaaactcttcttagtctgaaatctgctggatttct 3180 V.1 3301 GGCCTAAGGGAGAGGCTCCCATCCTTCGTTCCCCAGCCAGCCTAGGACTT 3350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 3181 ggcctaagggagaggctcccatccttcgttccccagccagcctaggactt 3230 V.1 3351 CGAATGTGGAGCCTGAAGATCTAAGATCCTAACATGTACATTTTATGTAA 3400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 3231 cgaatgtggagcctgaagatctaagatcctaacatgtacattttatgtaa 3280 V.1 3401 ATATGTGCATATTTGTACATAAAATGATATTCTGTTTTTAAATAAACAGA 3450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 3281 atatgtgcatatttgtacataaaatgatattctgtttttaaataaacaga 3330 V.1 3451 CAAAACTTGaaaaa 3464 |||||||||||||| V.6 3331 caaaacttgaaaaa 3344

[1069] 65 TABLE LIV(a) Peptide seguences of protein coded by 191P4D12(b) v.6 (SEQ ID NO: 108) MNGQPLTCVV SHPGLLQDQR ITHILHVSFL AEASVRGLED QNLWHIGREG AMLKCLSBGQ 60 PPPSYNWTRL DGPLPSGVRV DGDTLGFPPL TTEHSGIYVC HVSNEFSSRD SQVTVDVLDP 120 QEDSGKQVDL VSASVVVVGV IAALLFCLLV VVVVLMSRYH RRKAQQMTQK YEEELTLTRE 180 NSIRRLHSHH TDPRSQPEES VGLPAEGHPD SLKDNSSCSV MSEEPEGRSY STLTTVREIE 240 TQTELLSPGS GRAEEEEDQD EGIKQAMNHF VQENGTLRAK PTGNGIYING RGHLV 295

[1070] 66 TABLE LV(a) Amino acid sequence alignment of 191P4D12(b) v.1 (SEQ ID NO: 109) and 191P4D12(b) v.6 (SEQ ID NO: 110) V.1 216 MNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREG 265 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 1 MNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASVRGLEDQNLWHIGREG 50 V.1 266 AMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVC 315 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 51 AMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTLGFPPLTTEHSGIYVC 100 V.1 316 HVSNEPSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLV 365 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 101 HVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASVVVVGVIAALLFCLLV 150 V.1 366 VVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEES 415 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 151 VVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRRLHSHHTDPRSQPEES 200 V.1 416 VGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGS 465 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 201 VGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTTVREIETQTELLSPGS 250 V.1 466 GRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV 510 |||||||||||||||||||||||||||||||||||||||||||||||||| V.6 251 GRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNGIYINGRGHLV 295

[1071] 67 TABLE LII(b) Nucleotide seguence of transcript variant 191P4D12(b) v.7 (SEQ ID NO: 111) ggccgtcgtt gttggccaca gcgtgggaag cagctctggg ggagctcgga gctcccgatc 60 acggcttctt gggggtagct acggctgggt gtgtagaacg gggccggggc tggggctggg 120 tcccctagtg gagacccaag tgcgagaggc aagaactctg cagcttcctg ccttctgggt 180 cagttcctta ttcaagtctg cagccggctc ccagggagat ctcggtggaa cttcagaaac 240 gctgggcagt ctgcctttca accatgcccc tgtccctggg agccgagatg tgggggcctg 300 aggcctggct gctgctgctg ctactgctgg catcatttac aggccggtgc cccgcgggtg 360 agctggagac ctcagacgtg gtaactgtgg tgctgggcca ggacgcaaaa ctgccctgct 420 tctaccgagg ggactccggc gagcaagtgg ggcaagtggc atgggctcgg gtggacgcgg 480 gcgaaggcgc ccaggaacta gcgctactgc actccaaata cgggcttcat gtgagcccgg 540 cttacgaggg ccgcgtggag cagccgccgc ccccacgcaa ccccctggac ggctcagtgc 600 tcctgcgcaa cgcagtgcag gcggatgagg gcgagtacga gtgccgggtc agcaccttcc 660 ccgccggcag cttccaggcg cggctgcggc tccgagtgct ggtgcctccc ctgccctcac 720 tgaatcctgg tccagcacta gaagagggcc agggcctgac cctggcagcc tcctgcacag 780 ctgagggcag cccagccccc agcgtgacct gggacacgga ggtcaaaggc acaacgtcca 840 gccgttcctt caagcactcc cgctctgctg ccgtcacctc agagttccac ttggtgccta 900 gccgcagcat gaatgggcag ccactgactt gtgtggtgtc ccatcctggc ctgctccagg 960 accaaaggat cacccacatc ctccacgtgt ccttccttgc tgaggcctct gtgaggggcc 1020 ttgaagacca aaatctgtgg cacattggca gagaaggagc tatgctcaag tgcctgagtg 1080 aagggcagcc ccctccctca tacaactgga cacggctgga tgggcctctg cccagtgggg 1140 tacgagtgga tggggacact ttgggctttc ccccactgac cactgagcac agcggcatct 1200 acgtctgcca tgtcagcaat gagttctcct caagggattc tcaggtcact gtggatgttc 1260 ttgaccccca ggaagactct gggaagcagg tggacctagt gtcagcctcg gtggtggtgg 1320 tgggtgtgat cgccgcactc ttgttctgcc ttctggtggt ggtggtggtg ctcatgtccc 1380 gataccatcg gcgcaaggcc cagcagatga cccagaaata tgaggaggag ctgaccctga 1440 ccagggagaa ctccatccgg aggctgcatt cccatcacac ggaccccagg agccagagtg 1500 aagagcccga gggccgcagt tactccacgc tgaccacggt gagggagata gaaacacaga 1560 ctgaactgct gtctccaggc tctgggcggg ccgaggagga ggaagatcag gatgaaggca 1620 tcaaacaggc catgaaccat tttgttcagg agaatgggac cctacgggcc aagcccacgg 1680 gcaatggcat ctacatcaat gggcggggac acctggtctg acccaggcct gcctcccttc 1740 cctaggcctg gctccttctg ttgacatggg agattttagc tcatcttggg ggcctcctta 1800 aacaccccca tttcttgcgg aagatgctcc ccatcccact gactgcttga cctttacctc 1860 caacccttct gttcatcggg agggctccac caattgagtc tctcccacca tgcatgcagg 1920 tcactgtgtg tgtgcatgtg tgcctgtgtg agtgttgact gactgtgtgt gtgtggaggg 1980 gtgactgtcc gtggaggggt gactgtgtcc gtggtgtgta ttatgctgtc atatcagagt 2040 caagtgaact gtggtgtatg tgccacggga tttgagtggt tgcgtgggca acactgtcag 2100 ggtttggcgt gtgtgtcatg tggctgtgtg tgacctctgc ctgaaaaagc aggtattttc 2160 tcagacccca gagcagtatt aatgatgcag aggttggagg agagaggtgg agactgtggc 2220 tcagacccag gtgtgcgggc atagctggag ctggaatctg cctccggtgt gagggaacct 2280 gtctcctacc acttcggagc catgggggca agtgtgaagc agccagtccc tgggtcagcc 2340 agaggcttga actgttacag aagccctctg ccctctggtg gcctctgggc ctgctgcatg 2400 tacatatttt ctgtaaatat acatgcgccg ggagcttctt gcaggaatac tgctccgaat 2460 cacttttaat ttttttcttt tttttttctt gccctttcca ttagttgtat tttttattta 2520 tttttatttt tatttttttt tagagatgga gtctcactat gttgctcagg ctggccttga 2580 actcctgggc tcaagcaatc ctcctgcctc agcctcccta gtagctggga ctttaagtgt 2640 acaccactgt gcctgctttg aatcctttac gaagagaaaa aaaaaattaa agaaagcctt 2700 tagatttatc caatgtttac tactgggatt gcttaaagtg aggcccctcc aacaccaggg 2760 ggttaattcc tgtgattgtg aaaggggcta cttccaaggc atcttcatgc aggcagcccc 2820 ttgggagggc acctgagagc tggtagagtc tgaaattagg gatgtgagcc tcgtggttac 2880 tgagtaaggt aaaattgcat ccaccattgt ttgtgatacc ttagggaatt gcttggacct 2940 ggtgacaagg gctcctgttc aatagtggtg ttggggagag agagagcagt gattatagac 3000 cgagagagta ggagttgagg tgaggtgaag gaggtgctgg gggtgagaat gtcgcctttc 3060 cccctgggtt ttggatcact aattcaaggc tcttctggat gtttctctgg gttggggctg 3120 gagttcaatg aggtttattt ttagctggcc cacccagata cactcagcca gaatacctag 3180 atttagtacc caaactcttc ttagtctgaa atctgctgga tttctggcct aagggagagg 3240 ctcccatcct tcgttcccca gccagcctag gacttcgaat gtggagcctg aagatctaag 3300 atcctaacat gtacatttta tgtaaatatg tgcatatttg tacataaaat gatattctgt 3360 ttttaaataa acagacaaaa cttgaaaaa 3389

[1072] 68 TABLE LIII(b) Nucleotide sequence alignment of 191P4D12(b) v.1 (SEQ ID NO: 112) and 191P4D12(b) v.7 (SEQ ID NO: 113) V.1 1 gGCCGTCGTTGTTGGCCACAGCGTGGGAAGCAGCTCTGGGGGAGCTCGGA 50 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1 ggccgtcgttgttggccacagcgtgggaagcagctctqggggagctcgga 50 V.1 51 GCTCCCGATCACGGCTTCTTGGGGGTAGCTACGGCTGGGTGTGTAGAACA 100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 51 gctcccgatcacggcttcttgggggtagctacggctgggtqtgtagaacg 100 V.1 101 GGGCCGGGGCTGGGGCTGGGTCCCCTAGTGGAGACCCAAGTGCGAGAGGC 150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 101 gggccggggctggggctgggtcccctagtggagacccaagtgcgagaggc 150 V.1 151 AAGAACTCTGCAGCTTCCTGCCTTCTGGGTCAGTTCCTTATTCAAGTCTG 200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 151 aagaactctgcagcttcctgccttctgggtcagttccttattcaagtctg 200 V.1 201 CAGCCGGCTCCCAGGGAGATCTCGGTGGAACTTCAGAAACGCTGGGCAGT 250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 201 cagccggctcccagggagatctcggtggaacttcagaaacgctgggcagt 250 V.1 251 CTGCCTTTCAACCATGCCCCTGTCCCTGGGAGCCGAGATGTGGGGGCCTG 300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 251 ctgcctttcaaccatgcccctgtccctgggagccgagatgtgggggcctg 300 V.1 301 AGGCCTGGCTGCTGCTGCTGCTACTGCTGGCATCATTTACAGGCCGGTGC 350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 301 aggcctggctgctgctgctgctactgctggcatcatttacaggccggtgc 350 V.1 351 CCCGCGGGTGAGCTGGAGACCTCAGACGTGGTAACTGTGGTGCTGGGCCA 400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 351 cccgcgggtgagctggagacctcagacgtggtaactgtggtgctgggcca 400 V.1 401 GGACCCAAAACTGCCCTGCTTCTACCGAGGGGACTCCGGCGAGCAAGTGG 450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 401 ggacccaaaactgccctgcttctaccgaggggactccggcgagcaagtgg 450 V.1 451 GGCAAGTGGCATGGGCTCGGGTGGACCCGCGCGAAGGCGCCCAGGAACTA 500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 451 ggcaagtggcatgggctcgggtqgacgcgggcgaaggcgcccaggaacta 500 V.1 501 GCGCTACTGCACTCCAAATACGGGCTTCATGTGAGCCCGGCTTACGAGGG 550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 501 gcgctactgcactccaaatacgggcttcatgtgagcccggcttacgaggg 550 V.1 551 CCGCGTGGAGCAGCCGCCGCCCCCACGCAACCCCCTGGACCCCTCAGTGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 551 ccgcgtggagcagccgccgcccccacgcaaccccctggacggctcagtgc 600 V.1 601 TCCTGCGCAACGCAGTGCAGGCGGATGAGGGCGAGTACGAGTGCCGGGTC 650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 601 tcctgcgcaacgcagtgcaggcggatgagggcgagtacgagtgccgggtc 650 V.1 651 AGCACCTTCCCCGCCGGCAGCTTCCAGGCGCGGCTGCGGCTCCGAGTGCT 700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 651 agcaccttccccgccggcagcttccaggcgcggctgcggctccgagtgct 700 V.1 701 GGTGCCTCCCCTGCCCTCACTGAATCCTGGTCCAGCACTAGAAGAGGGCC 750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 701 ggtgcctcccctgccctcactgaatcctggtccagcactagaagagggcc 750 V.1 751 AGGGCCTGACCCTGGCAGCCTCCTGCACAGCTGAGGGCAGCCCAGCCCCC 800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 751 agggcctgaccctggcagcctcctgcacagctgagggcagcccagccccc 800 V.1 801 AGCGTGACCTGGGACACGGAGGTCAAAGGCACAACGTCCAGCCGTTCCTT 850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 801 agcgtgacctgggacacggaggtcaaagqcacaacgtccagccgttcctt 850 V.1 851 CAAGCACTCCCGCTCTGCTGCCGTCACCTCAGAGTTCCACTTGGTGCCTA 900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 851 caagcactcccgctctgctgccgtcacctcagagttccacttggtgccta 900 V.1 901 GCCGCAGCATGAATGGGCAGCCACTGACTTGTGTGGTGTCCCATCCTGGC 950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 901 gccgcagcatgaatgggcagccactgacttgtgtggtgtcccatcctggc 950 V.1 951 CTGCTCCAGGACCAAAGGATCACCCACATCCTCCACGTGTCCTTCCTTGC 1000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 951 ctgctccaggaccaaaggatcacccacatcctccacgtgtccttccttgc 1000 V.1 1001 TGAGGCCTCTGTGAGGGGCCTTGAAGACCAAAATCTGTGGCACATTGGCA 1050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1001 tgaggcctctgtgaggggccttgaagaccaaaatctgtggcacattggca 1050 V.1 1051 GAGAAGGAGCTATGCTCAAGTGCCTGAGTGAAGGGCAGCCCCCTCCCTCA 1100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1051 gagaaggagctatgctcaagtgcctgagtgaagggcagccccctccctca 1100 V.1 1101 TACAACTGGACACGGCTGGATGGGCCTCTGCCCAGTGGGGTACGAGTGGA 1150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1101 tacaactggacacggctggatgggcctctgcccagtggggtacgagtgga 1150 V.1 1151 TGGGGACACTTTGGGCTTTCCCCCACTGACCACTGAGCACAGCGGCATCT 1200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1151 tggqgacactttgggctttcccccactgaccactgagcacagcggcatct 1200 V.1 1201 ACGTCTCCCATGTCAGCAATGAGTTCTCCTCAAGGGATTCTCAGGTCACT 1250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1201 acgtctgccatgtcagcaatgagttctcctcaagggattctcaggtcact 1250 V.1 1251 GTCGATGTTCTTGACCCCCAGGAAGACTCTGGGAAGCAGGTGGACCTAGT 1300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1251 gtggatgttcttgacccccaggaagactctgggaagcaggtggacctagt 1300 V.1 1301 GTCAGCCTCGGTGGTGGTGGTGGGTGTGATCGCCGCACTCTTGTTCTGCC 1350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1301 gtcagcctcggtggtggtggtgggtgtgatcgccgcactcttgttctgcc 1350 V.1 1351 TTCTGGTGGTGGTGGTGGTGCTCATGTCCCGATACCATCGGCGCAACGCC 1400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1351 ttctggtggtggtggtggtgctcatgtcccgataccatcggcgcaaggcc 1400 V.1 1401 CAGCAGATGACCCAGAAATATGAGGAGGAGCTGACCCTGACCAGGGAGAA 1450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1401 cagcagatgacccagaaatatgaggaggagctgaccctgaccagggagaa 1450 V.1 1451 CTCCATCCGGAGGCTGCATTCCCATCACACGGACCCCAGGAGCCAGCCGG 1500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1451 ctccatccggaggctgcattcccatcacacggaccccaggagcca----- 1495 V.1 1501 AGGAGAGTGTAGGGCTGAGAGCCGAGGGCCACCCTGATAGTCTCAAGGAC 1550 V.7 1496 -------------------------------------------------- 1495 V.1 1551 AACAGTAGCTGCTCTGTGATGAGTGAAGAGCCCGAGGGCCGCAGTTACTC 1600 V.7 1496 --------------------gagtgaagagcccgagggccgcagttactc 1525 V.1 1601 CACGCTCACCACGGTGAGGGAGATAGAAACACAGACTGAACTGCTCTCTC 1650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1526 cacgctgaccacggtgagggagatagaaacacagactgaactgctgtctc 1575 V.1 1651 CAGGCTCTGGGCGGGCCGAGGAGGAGGAAGATCAGGATGAAGGCATCAAA 1700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1576 caggctctgggcgggccgaggaggaggaagatcaggatgaaggcatcaaa 1625 V.1 1701 CAGGCCATGAACCATTTTGTTCAGGAGAATGGGACCCTACGGGCCAAGCC 1750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1626 caggccatgaaccattttgttcaggagaatgggaccctacgggccaagcc 1675 V.1 1751 CACGGGCAATGGCATCTACATCAATGGGCGGGGACACCTGGTCTGACCCA 1800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1676 cacgggcaatggcatctacatcaatgggcggggacacctggtctgaccca 1725 V.1 1801 GGCCTGCCTCCCTTCCCTAGGCCTGGCTCCTTCTGTTGACATGGGAGATT 1850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1726 ggcctgcctcccttccctaggcctggctccttctgttgacatgggagatt 1775 V.1 1851 TTAGCTCATCTTGGGGGCCTCCTTAAACACCCCCATTTCTTGCGGAAGAT 1900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1776 ttagctcatcttgggggcctccttaaacacccccatttcttgcggaagat 1825 V.1 1901 GCTCCCCATCCCACTGACTGCTTGACCTTTACCTCCAACCCTTCTGTTCA 1950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1826 gctccccatcccactgactgcttgacctttacctccaacccttctgttca 1875 V.1 1951 TCCGGAGGGCTCCACCAATTGAGTCTCTCCCACCATGCATGCAGGTCACT 2000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1876 tcgggagggctccaccaattgagtctctcccaccatgcatgcaggtcact 1925 V.1 2001 GTGTGTGTGCATGTGTGCCTGTGTGAGTGTTGACTGACTGTGTGTGTGTG 2050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1926 gtgtgtgtgcatgtgtgcctgtgtgagtgttgactgactgtgtgtgtgtg 1975 V.1 2051 GAGGGGTGACTGTCCGTGGAGGGGTGACTGTGTCCGTGGTGTGTATTATG 2100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1976 gaggggtgactgtccgtggaggggtgactgtgtccgtggtgtgtattatg 2025 V.1 2101 CTGTCATATCAGAGTCAAGTGAACTGTGGTGTATGTGCCACGGGATTTGA 2150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2026 ctgtcatatcagagtcaagtgaactgtggtgtatgtgccacgggatttga 2075 V.1 2151 GTGGTTGCGTGGGCAACACTGTCAGGGTTTGGCGTGTGTGTCATGTGGCT 2200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2076 gtggttgcgtgggcaacactgtcagggtttggcgtgtgtgtcatgtggct 2125 V.1 2201 GTGTGTGACCTCTGCCTGAAAAAGCAGGTATTTTCTCACACCCCAGAGCA 2250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2126 gtgtgtgacctctgcctgaaaaagcaggtattttctcagaccccagagca 2175 V.1 2251 GTATTAATGATGCAGACGTTGGAGGAGAGAGGTGGAGACTGTGGCTCAGA 2300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2176 gtattaatgatgcagaggttggaggagagaggtggagactgtggccCaga 2225 V.1 2301 CCCAGGTGTGCGGGCATAGCTGGAGCTGGAATCTGCCTCCGGTGTGAGGG 2350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2226 cccaggtgtgcgggcatagctggagctggaatctgcctccggtgtgaggg 2275 V.1 2351 AACCTGTCTCCTACCACTTCGGAGCCATGGGGGCAAGTGTGAAGCAGCCA 2400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2276 aacctgtctcctaccacttcggagccatgggggcaagtgtgaagcagcca 2325 V.1 2401 GTCCCTGGGTCAGCCAGAGGCTTGAACTGTTACAGAAGCCCTCTGCCCTC 2450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2326 gtccctgggtcagccagaggcttgaactgttacagaagccctctgccctc 2375 V.1 2451 TGGTGGCCTCTGGGCCTGCTGCATGTACATATTTTCTGTAAATATACATG 2500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2376 tggtggcctctgggcctgctgcatgtacatattttctgtaaatatacatg 2425 V.1 2501 CGCCGGGAGCTTCTTGCAGGAATACTGCTCCGAATCACTTTTAATTTTTT 2550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2426 cgccgggagcttcttgcaggaatactgctccgaatcacttttaatttttt 2475 V.1 2551 TCTTTTTTTTTTCTTGCCCTTTCCATTAGTTGTATTTTTTATTTATTTTT 2600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2476 tcttttttttttcttgccctttccattagttgtattttttatttattttt 2525 V.1 2601 ATTTTTATTTTTTTTTAGAGATGGAGTCTCACTATGTTGCTCAGGCTGGC 2650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2526 atttttatttttttttagagatggagtctcactatgttgctcaggctggc 2575 V.1 2651 CTTGAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCCTCCCTAGTAGC 2700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2576 cttgaactcctgggctcaagcaatcctcctgcctcagcctccctagtagc 2625 V.1 2701 TGGGACTTTAAGTGTACACCACTGTGCCTGCTTTGAATCCTTTACGAACA 2750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2626 tgggactttaagtgtacaccactgtgcctgctttgaatcctttacgaaga 2675 V.1 2751 GAAAAAAAAAATTAAAGAAAGCCTTTAGATTTATCCAATGTTTACTACTG 2800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2676 gaaaaaaaaaattaaagaaagcctttagatttatccaatgtttactactg 2725 V.1 2801 GGATTGCTTAAAGTGAGGCCCCTCCAACACCAGGGGGTTAATTCCTGTGA 2850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2726 ggattgcttaaagtgaggcccctccaacaccagggggttaattcctgtga 2775 V.1 2851 TTGTGAAAGGGGCTACTTCCAAGGCATCTTCATGCAGGCAGCCCCTTGGG 2900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2776 ttgtgaaaggggctacttccaaggcatcttcatgcaggcagccccttggg 2825 V.1 2901 AGGGCACCTGAGAGCTGGTAGACTCTGAAATTAGGGATGTGAGCCTCGTG 2950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2826 agggcacctgagagctggtagagtctgaaattagggatgtgagcctcgtg 2875 V.1 2951 GTTACTGAGTAAGGTAAAATTGCATCCACCATTGTTTGTGATACCTTAGG 3000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2876 gttactgagtaaggtaaaattgcatccaccattgtttgtgataccttagg 2925 V.1 3001 GAATTGCTTGGACCTGGTGACAAGGGcTCCTGTTCAATAGTGGTGTTGGG 3050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2926 gaattgcttggacctggtgacaagggctcctgttcaatagtggtgttggg 2975 V.1 3051 GAGAGAGAGAGCAGTGATTATAGACCGAGAGAGTAGGAGTTGAGGTGAGG 3100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 2976 gagagagagagcagtgattatagaccgagagagtaggagttgaggtgagg 3025 V.1 3101 TGAAGGAGGTGCTGGGGGTGAGAATGTCGCCTTTCCCCCTGGGTTTTGGA 3150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3026 tgaaggaggtgctgggggtgagaatgtcgcctttccccctgggttttgga 3075 V.1 3151 TCACTAATTCAAGCCTCTTCTGGATGTTTCTCTGGGTTGGGGCTGGAGTT 3200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3076 tcactaattcaaggctcttctggatgtttctctgggttggggctggagtt 3125 V.1 3201 CAATGAGGTTTATTTTTAGCTGGCCCACCCAGATACACTCAGCCAGAATA 3250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3126 caatgaggtttatttttagctggcccacccagatacactcagccagaata3175 V.1 3251 CCTAGATTTAGTACCCAAACTCTTCTTAGTCTGAAATCTGCTGGATTTCT 3300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3176 cctagatttagtacccaaactcttcttagtctgaaatctgctggatttct 3225 V.1 3301 GGCCTAAGGGAGAGGCTCCCATCCTTCGTTCCCCAGCCAGCCTAGGACTT 3350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3226 ggcctaagggagaggctcccatccttcgttccccagccagcctaggactt 3275 V.1 3351 CGAATGTGGAGCCTGAAGATCTAAGATCCTAACATGTACATTTTATGTAA 3400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3276 cgaatgtggagcctgaagatctaagatcctaacatgtacattttatgtaa 3325 V.1 3401 ATATGTGCATATTTGTACATAAAATCATATTCTGTTTTTAAATAAACAGA 3450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 3326 atatgtgcatatttgtacataaaatgatattctgtttttaaataaacaga 3375 V.1 3451 CAAAACTTGaaaaa 3464 |||||||||||||| V.7 3376 caaaacttgaaaaa 3389

[1073] 69 TABLE LIV(b) Peptide sequences of protein coded by 191P4D12(b) v.7 (SEQ ID NO: 114) MPLSLGAEMW GPEAWLLLLL LLASFTGRCP AGELETSDVV TVVLGQDAKL PCFYRGDSGE 60 QVGQVAWARV DAGEGAQELA LLHSKYGLHV SPAYEGRVEQ PPPPRNPLDG SVLLRNAVQA 120 DEGEYECRVS TFPAGSFQAR LRLRVLVPPL PSLNPGPALE EGQGLTLAAS CTAEGSPAPS 180 VTWDTEVKGT TSSRSFKHSR SAAVTSEFHL VPSRSMNGQP LTCVVSHPGL LQDQRITHIL 240 HVSFLAEASV RGLEDQNLWH IGREGAMLKC LSEGQPPPSY NWTRLDGPLP SGVRVDGDTL 300 GFPPLTTEHS GIYVCHVSNE FSSRDSQVTV DVLDPQEDSG KQVDLVSASV VVVGVIAALL 360 FCLLVVVVVL MSRYHRRKAQ QMTQKYEEEL TLTRENSIRR LHSHHTDPRS QSEEPEGRSY 420 STLTTVREIE TQTELLSPGS GRAEEEEDQD EGIKQAMNHF VQENGTLRAK PTGNGIYING 480 RGHLV 485

[1074] 70 TABLE LV(b) Amino acid sequence alignment of 191P4D12(b) v.1 (SEQ ID NO: 115) and 191P4D12(b) v.7 (SEQ ID NO: 116). V.1 1 MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKL 50 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 1 MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKL 50 V.1 51 PCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQ 100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 51 PCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQ 100 V.1 101 PPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPL 150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 101 PPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPL 150 V.1 151 PSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSR 200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 151 PSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSR 200 V.1 201 SAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASV 250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 201 SAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASV 250 V.1 251 RGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL 300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 251 RGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL 300 V.1 301 GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV 350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 301 GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV 350 V.1 351 VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRR 400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 351 VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRR 400 V.1 401 LHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTT 450 |||||||||||               |||||||||||||| V.7 401 LHSHHTDPRSQ-------------------------SEEPEGRSYSTLTT 425 V.1 451 VREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNG 500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.7 426 VREIETQTELLSPGSGRAEEEEDQDEGIKQANNHFVQENGTLRAKPTGNG 475 V.1 501 IYINGRGHLV 510 |||||||||| V.7 476 IYINGRGHLV 485

[1075] 71 TABLE LII(c) Nucleotide sequence of transcript variant 191P4D12(b) v.8 (SEQ ID NO:117) ggccgtcgtt gttggccaca gcgtgggaag cagctctggg ggagctcgga gctcccgatc 60 acggcttctt gggggtagct acggctgggt gtgtagaacg gggccggggc tggggctggg 120 tcccctagtg gagacccaag tgcgagaggc aagaactctg cagcttcctg ccttctgggt 180 cagttcctta ttcaagtctg cagccggctc ccagggagat ctcggtggaa cttcagaaac 240 gctgggcagt ctgcctttca accatgcccc tgtccctggg agccgagatg tgggggcctg 300 aggcctggct gctgctgctg ctactgctgg catcatttac aggccggtgc cccgcgggtg 360 agctggagac ctcagacgtg gtaactgtgg tgctgggcca ggacgcaaaa ctgccctgct 420 tctaccgagg ggactccggc gagcaagtgg ggcaagtggc atgggctcgg gtggacgcgg 480 gcgaaggcgc ccaggaacta gcgctactgc actccaaata cgggcttcat gtgagcccgg 540 cttacgaggg ccgcgtggag cagccgccgc ccccacgcaa ccccctggac ggctcagtgc 600 tcctgcgcaa cgcagtgcag gcggatgagg gcgagtacga gtgccgggtc agcaccttcc 660 ccgccggcag cttccaggcg cggctgcggc tccgagtgct ggtgcctccc ctgccctcac 720 tgaatcctgg tccagcacta gaagagggcc agggcctgac cctggcagcc tcctgcacag 780 ctgagggcag cccagccccc agcgtgacct gggacacgga ggtcaaaggc acaacgtcca 840 gccgttcctt caagcactcc cgctctgctg ccgtcacctc agagttccac ttggtgccta 900 gccgcagcat gaatgggcag ccactgactt gtgtggtgtc ccatcctggc ctgctccagg 960 accaaaggat cacccacatc ctccacgtgt ccttccttgc tgaggcctct gtgaggggcc 1020 ttgaagacca aaatctgtgg cacattggca gagaaggagc tatgctcaag tgcctgagtg 1080 aagggcagcc ccctccctca tacaactgga cacggctgga tgggcctctg cccagtgggg 1140 tacgagtgga tggggacact ttgggctttc ccccactgac cactgagcac agcggcatct 1200 acgtctgcca tgtcagcaat gagttctcct caagggattc tcaggtcact gtggatgttc 1260 ttgaccccca ggaagactct gggaagcagg tggacctagt gtcagcctcg gtggtggtgg 1320 tgggtgtgat cgccgcactc ttgttctgcc ttctggtggt ggtggtggtg ctcatgtccc 1380 gataccatcg gcgcaaggcc cagcagatga cccagaaata tgaggaggag ctgaccctga 1440 ccagggagaa ctccatccgg aggctgcatt cccatcacac ggaccccagg agccagccgg 1500 aggagagtgt agggctgaga gccgagggcc accctgatag tctcaaggac aacagtagct 1560 gctctgtgat gagtgaagag cccgagggcc gcagttactc cacgctgacc acggtgaggg 1620 agatagaaac acagactgaa ctgctgtctc caggctctgg gcgggccgag gaggaggaag 1680 atcaggatga aggcatcaaa caggccatga accattttgt tcaggagaat gggaccctac 1740 gggccaagcc cacgggcaat ggcatctaca tcaatgggcg gggacacctg gtctgaccca 1800 ggcctgcctc ccttccctag gcctggctcc ttctgttgac atgggagatt ttagctcatc 1860 ttgggggcct ccttaaacac ccccatttct tgcggaagat gctccccatc ccactgactg 1920 cttgaccttt acctccaacc cttctgttca tcgggagggc tccaccaatt gagtctctcc 1980 caccatgcat gcaggtcact gtgtgtgtgc atgtgtgcct gtgtgagtgt tgactgactg 2040 tgtgtgtgtg gaggggtgac tgtccgtgga ggggtgactg tgtccgtggt gtgtattatg 2100 ctgtcatatc agagtcaagt gaactgtggt gtatgtgcca cgggatttga gtggttgcgt 2160 gggcaacact gtcagggttt ggcgtgtgtg tcatgtggct gtgtgtgacc tctgcctgaa 2220 aaagcaggta ttttctcaga ccccagagca gtattaatga tgcagaggtt ggaggagaga 2280 ggtggagact gtggctcaga cccaggtgtg cgggcatagc tggagctgga atctgcctcc 2340 ggtgtgaggg aacctgtctc ctaccacttc ggagccatgg gggcaagtgt gaagcagcca 2400 gtccctgggt cagccagagg cttgaactgt tacagaagcc ctctgccctc tggtggcctc 2460 tgggcctgct gcatgtacat attttctgta aatatacatg cgccgggagc ttcttgcagg 2520 aatactgctc cgaatcactt ttaatttttt tctttttttt ttcttgccct ttccattagt 2580 tgtatttttt atttattttt atttttattt ttttttagag atggagtctc actatgttgc 2640 tcaggctggc cttgaactcc tgggctcaag caatcctcct gcctcagcct ccctagtagc 2700 tgggacttta agtgtacacc actgtgcctg ctttgaatcc tttacgaaga gaaaaaaaaa 2760 attaaagaaa gcctttagat ttatccaatg tttactactg ggattgctta aagtgaggcc 2820 cctccaacac cagggggtta attcctgtga ttgtgaaagg ggctacttcc aaggcatctt 2880 catgcaggca gccccttggg agggcacctg agagctggta gagtctgaaa ttagggatgt 2940 gagcctcgtg ctggtgacaa gggctcctgt tcaatagtgg tgttggggag agagagagca 3000 gtgattatag accgagagag taggagttga ggtgaggtga aggaggtgct gggggtgaga 3060 atgtcgcctt tccccctggg ttttggatca ctaattcaag gctcttctgg atgtttctct 3120 gggttggggc tggagttcaa tgaggtttat ttttagctgg cccacccaga tacactcagc 3180 cagaatacct agatttagta cccaaactct tcttagtctg aaatctgctg gatttctggc 3240 ctaagggaga ggctcccatc cttcgttccc cagccagcct aggacttcga atgtggagcc 3300 tgaagatcta agatcctaac atgtacattt tatgtaaata tgtgcatatt tgtacataaa 3360 atgatattct gtttttaaat aaacagacaa aacttgaaaa a 3401

[1076] 72 TABLE LIII(c) Nucleotide seguence alignment of 191P4D12(b) v.1 (SEQ ID NO: 118) and 191P4D12(b) v.8 (SEQ ID NO: 119) V.1 1 gGCCGTCGTTGTTGGCCACAGCGTGGGAAGCAGCTCTGGGGGAGCTCGGA 50 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1 ggccgtcgttgttggccacagcgtgggaagcagctctgggggagctcgga 50 V.1 51 GCTCCCGATCACGGCTTCTTGGGGGTAGCTACGGCTGGGTGTGTAGAACG 100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 51 gctcccgatcacggcttcttgggggtagctacggctgggtgtgtagaacg 100 V.1 101 GGGCCGGGGCTGGGGCTGGGTCCCCTAGTGGAGACCCAAGTGCGAGAGGC 150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 101 gggccggggctggggctgggtcccctagtggagacccaagtgcgagaggc 150 V.1 151 AAGAACTCTGCAGCTTCCTGCCTTCTGGGTCAGTTCCTTATTCAAGTCTG 200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 151 aagaactctgcagcttcctgccttctgggtcagttccttattcaagtctg 200 V.1 201 CAGCCGGCTCCCAGGGAGATCTCGGTGGAACTTCAGAAACGCTGGGCAGT 250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 201 cagccggctcccagggagatctcggtggaacttcagaaacgctgggcagt 250 V.1 251 CTGCCTTTCAACCATGCCCCTGTCCCTGGGAGCCGAGATGTGGGGGCCTG 300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 251 ctgcctttcaaccatgcccctgtccctgggagccgagatgtgggggcctg 300 V.1 301 AGGCCTGGCTGCTGCTGCTGCTACTGCTGGCATCATTTACAGGCCGGTGC 350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 301 aggcctggctgctgctgctgctactgctggcatcatttacaggccggtgc 350 V.1 351 CCCGCGGGTGAGCTGGAGACCTCAGACGTGGTAACTGTGGTGCTGGGCCA 400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 351 cccgcgggtgagctggagacctcagacgtggtaactgtggtgctgggcca 400 V.1 401 GGACGCAAAACTGCCCTGCTTCTACCGAGGGGACTCCGGCGAGCAAGTGG 450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 401 ggacgcaaaactgccctgcttctaccgaggggactccggcgagcaagtgg 450 V.1 451 GGCAAGTGGCATGGGCTCGGGTGGACGCGGGCGAAGGCGCCCAGGAACTA 500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 451 ggcaagtggcatgggctcgggtggacgcgggcgaaggcgcccaggaacta 500 V.1 501 GCGCTACTGCACTCCAAATACGGGCTTCATGTGAGCCCGGCTTACGAGGG 550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 501 gcgctactgcactccaaatacggccttcatgtgagcccggcttacgaggg 550 V.1 551 CCGCGTGGAGCAGCCGCCGCCCCCACGCAACCCCCTGGACGGCTCAGTGC 600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 551 ccgcgtggagcagccgccgcccccacgcaaccccctggacggctcagtgc 600 V.1 601 TCCTGCGCAACGCAGTGCAGGCGGATGAGGGCGAGTACGAGTGCCGGGTC 650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 601 tcctgcgcaacgcagtgcaggcggatgagggcgagtacgagtgccgggtc 650 V.1 651 AGCACCTTCCCCGCCGGCAGCTTCCAGGCGCGGCTGCGGCTCCGAGTGCT 700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 651 agcaccttccccgccggcagcttccaggcgcggctgcggctccgagtgct 700 V.1 701 GGTGCCTCCCCTGCCCTCACTGAATCCTGGTCCAGCACTAGAAGAGGGCC 750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 701 ggtgcctcccctgccctcactgaatcctggtccagcactagaagagggcc 750 V.1 751 AGGGCCTGACCCTGGCAGCCTCCTGCACAGCTGAGGGCAGCCCAGCCCCC 800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 751 agggcctgaccctggcagcctcctgcacagctgagggcagcccagccccc 800 V.1 801 AGCGTGACCTGGGACACGGAGGTCAAAGGCACAACGTCCAGCCGTTCCTT 850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 801 agcgtgacctgggacacggaggtcaaaggcacaacgtccagccgttcctt 850 V.1 851 CAAGCACTCCCGCTCTGCTGCCGTCACCTCAGAGTTCCACTTCGTGCCTA 900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 851 caagcactcccgctctgctgccgtcacctcagagttccacttggtgccta 900 V.1 901 GCCGCACCATGAATGGGCAGCCACTGACTTGTGTGGTGTCCCATCCTGGC 950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 901 gccgcagcatgaatgggcagccactgacttgtgtggtgtcccatcctggc 950 V.1 951 CTGCTCCAGGACCAAACGATCACCCACATCCTCCACGTGTCCTTCCTTGC 1000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 951 ctgctccaggaccaaaggatcacccacatcctccacgtgtccttccttgc 1000 V.1 1001 TGAGGCCTCTGTGAGGGGCCTTGAAGACCAAAATCTGTGGCACATTGGCA 1050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1001 tgaggcctctgtgaggggccttgaagaccaaaatctgtggcacattggca 1050 V.1 1051 GAGAAGGAGCTATGCTCAAGTGCCTGAGTGAAGGGCAGCCCCCTCCCTCA 1100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1051 gagaaggagctatgctcaagtgcctgagtgaagggcagccccctccctca 1100 V.1 1101 TACAACTGGACACGGCTGGATGCCCCTCTGCCCAGTGGGGTACGAGTGGA 1150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1101 tacaactggacacggctggatgggcctctgcccagtggggtacgagtgga 1150 V.1 1151 TGGGGACACTTTGGGCTTTCCCCCACTGACCACTGAGCACAGCGGCATCT 1200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1151 tggggacactttgggctttcccccactgaccactgagcacagcggcatct 1200 V.1 1201 ACGTCTGCCATGTCAGCAATGAGTTCTCCTCAAGGGATTCTCAGGTCACT 1250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1201 acgtctgccatgtcagcaatgagttctcctcaagggattctcaggtcact 1250 V.1 1251 GTGGATGTTCTTGACCCCCAGGAAGACTCTGGGAAGCAGGTGGACCTAGT 1300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1251 gtggatgttcttgacccccaggaagactctgggaagcaggtggacctagt 1300 V.1 1301 GTCAGCCTCGGTGGTGGTGGTGGGTGTGATCGCCGCACTCTTGTTCTGCC 1350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1301 gtcagcctcggtggtggtggtgggtgtgatcgccgcactcttgttctgcc 1350 V.1 1351 TTCTGGTGGTGGTCGTGGTGCTCATGTCCCGATACCATCGGCGCAAGGCC 1400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1351 ttctggtggtggtggtggtgctcatgtcccgataccatcggcgcaaggcc 1400 V.1 1401 CAGCAGATGACCCAGAAATATGAGGAGGAGCTGACCCTGACCAGGGAGAA 1450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1401 cagcagatgacccagaaatatgaggaggagctgaccctgaccagggagaa 1450 V.1 1451 CTCCATCCGGAGGCTGCATTCCCATCACACGGACCCCAGGAGCCAGCCGG 1500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1451 ctccatccggaggctgcattcccatcacacggaccccaggagccagccgg 1500 V.1 1501 AGGAGAGTGTAGGGCTGAGAGCCCAGGGCCACCCTGATAGTCTCAAGGAC 1550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1501 aggagagtgtagggctgagagccgagggccaccctgatagtctcaaggac 1550 V.1 1551 AACAGTAGCTGCTCTGTGATGAGTGAAGAGCCCGAGGGCCGCAGTTACTC 1600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1551 aacagtagctgctctgtgatgagtgaagagcccgagggccgcagttactc 1600 V.1 1601 CACGCTGACCACGGTGAGGGAGATAGAAACACAGACTGAACTGCTGTCTC 1650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1601 cacgctgaccacggtgagggagatagaaacacagactgaactgctgtctc 1650 V.1 1651 CAGGCTCTGGGCGGGCCGAGGAGGAGGAAGATCAGGATGAAGGCATCAAA 1700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1651 caggctctgggcgggccgaggaggaggaagatcaggatgaaggcatcaaa 1700 V.1 1701 CAGGCCATGAACCATTTTGTTCAGGAGAATGGGACCCTACGGGCCAAGCC 1750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1701 caggccatgaaccattttgttcaggagaatgggaccctacgggccaagcc 1750 V.1 1751 CACGGGCAATGGCATCTACATCAATGGGCGGGGACACCTGGTCTGACCCA 1800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1751 cacgggcaatggcatctacatcaatgggcggggacacctggtctgaccca 1800 V.1 1801 GGCCTGCCTCCCTTCCCTAGGCCTGGCTCCTTCTGTTGACATGGGAGATT 1850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1801 ggcctgcctcccttccctaggcctggctccttctgttgacatgggagatt 1850 V.1 1851 TTAGCTCATCTTGGGGGCCTCCTTAAACACCCCCATTTCTTGCGGAAGAT 1900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1851 ttagctcatcttgggggcctccttaaacacccccatttcttgcggaagat 1900 V.1 1901 GCTCCCCATCCCACTGACTGCTTGACCTTTACCTCCAACCCTTCTGTTCA 1950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1901 gctccccatcccactgactgcttgacctttacctccaacccttctgttca 1950 V.1 1951 TCGGGAGGGCTCCACCAATTGAGTCTCTCCCACCATGCATGCACGTCACT 2000 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1951 tcgggagggctccaccaattgagtctctcccaccatgcatgcaggtcact 2000 V.1 2001 GTGTGTGTGCATGTGTGCCTGTGTGAGTGTTGACTGACTGTGTGTGTGTG 2050 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2001 gtgtgtgtgcatgtgtgcctgtgtgagtgttgactgactgtgtgtgtgtg 2050 V.1 2051 GAGGGGTGACTGTCCGTGGAGGGGTGACTGTGTCCGTGGTGTGTATTATG 2100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2051 gaggggtgactgtccgtggaggggtgactgtgtccgtggtgtgtattatg 2100 V.1 2101 CTGTCATATCAGAGTCAAGTGAACTGTGGTGTATGTGCCACGGGATTTGA 2150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2101 ctgtcatatcagagtcaagtgaactgtggtgtatgtgccacgggatttga 2150 V.1 2151 GTGGTTGCGTGGGCAACACTGTCAGGGTTTGGCGTGTGTGTCATGTGGCT 2200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2151 gtggttgcgtgggcaacactgtcagggtttggcgtgtgtgtcatgtggct 2200 V.1 2201 GTGTGTGACCTCTGCCTCACAAAGCAGGTATTTTCTCAGACCCCAGAGCA 2250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2201 gtgtgtgacctctgcctgaaaaagcaggtattttctcagaccccagagca 2250 V.1 2251 GTATTAATGATGCAGAGGTTGGAGGAGAGAGGTGGAGACTGTGGCTCAGA 2300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2251 gtattaatgatgcagaggttggaggagagaggtggagactgtggctcaga 2300 V.1 2301 CCCAGGTGTGCGGGCATACCTGGAGCTGGAATCTGCCTCCGGTGTGAGGG 2350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2301 cccaggtgtgcgggcatagctggagctggaatctgcctccggtgtgaggg 2350 V.1 2351 AACCTGTCTCCTACCACTTCGGAGCCATGGGGGCAAGTGTGAAGCAGCCA 2400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2351 aacctgtctcctiaccacttcggagccatgggggcaagtgtgaagcagcca 2400 V.1 2401 GTCCCTGGGTCAGCCAGAGGCTTGAACTGTTACAGGAAGCCCTCTGCCCTC 2450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2401 gtccctgggtcagccagaggcttgaactgttacagaagccctctgccctc 2450 V.1 2451 TGGTGGCCTCTGCGCCTGCTGCATGTACATATTTTCTGTAAATATACATG 2500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2451 tggtggcctctgggcctgctgcatgtacatattttctgtaaatatacatg 2500 V.1 2501 CGCCGGGAGCTTCTTGCAGGAATACTGCTCCGAATCACTTTTAATTTTTT 2550 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2501 cgccgggagcttcttgcaggaatactgctccgaatcacttttaatttttt 2550 V.1 2551 TCTTTTTTTTTTCTTGCCCTTTCCATTAGTTGTATTTTTTATTTATTTTT 2600 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2551 tcttttttttttcttgccctttccattagttgtattttttatttattttt 2600 V.1 2601 ATTTTTATTTTTTTTTAGAGATGGAGTCTCACTATGTTGCTCAGGCTGGC 2650 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2601 atttttatttttttttagagatggagtctcactatgttgctcaggctggc 2650 V.1 2651 CTTGAACTCCTGGGCTCAAGCAATCCTCCTGCCTCAGCCTCCCTAGTAGC 2700 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2651 cttgaactcctgggctcaagcaatcctcctgcctcagcctccctagtagc 2700 V.1 2701 TGGGACTTTAAGTGTACACCACTGTGCCTGCTTTGAATCCTTTACGAAGA 2750 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2701 tgggactttaagtgtacaccactgtgcctgctttgaatcctttacgaaga 2750 V.1 2751 GAAAAAAAAAATTAAAGAAAGCCTTTAGATTTATCCAATGTTTACTACTG 2800 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2751 gaaaaaaaaaattaaagaaagcctttagatttatccaatgtttactactg 2800 V.1 2801 GGATTGCTTAAAGTGAGGCCCCTCCAACACCAGGGGGTTAATTCCTGTGA 2850 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2801 ggattgcttaaagtgaggcccctccaacaccagggggttaattcctgtga 2850 V.1 2851 TTGTGAAAGGGGCTACTTCCAAGGCATCTTCATGCAGGCAGCCCCTTGGG 2900 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2851 ttgtgaaaggggctacttccaaggcatcttcatgcaggcagccccttggg 2900 V.1 2901 AGGGCACCTGAGAGCTGGTAGAGTCTGAAATTAGGGATGTGAGCCTCGTG 2950 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2901 agggcacctgagagctggtagagtctgaaattagggatgtgagcctcgtg 2950 V.1 2951 GTTACTGAGTAACGTAAAATTGCATCCACCATTGTTTGTGATACCTTAGG 3000 V.8 2951 -------------------------------------------------- 2950 V.1 3001 GAATTGCTTGGACCTGGTGACAAGGGCTCCTGTTCAATAGTGGTGTTGGG 3050              ||||||||||||||||||||||||||||||||||||| V.8 2951 -------------ctggtgacaagggctcctgttcaatagtggtgttggg 2987 V.1 3051 GAGAGAGAGAGCAGTGATTATAGACCGAGAGAGTAGGAGTTGAGGTGAGG 3100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 2988 gagagagagagcagtgattatagaccgagagagtaggagttgaggtgagg 3037 V.1 3101 TGAAGCAGGTGCTGGGGGTGAGAATGTCGCCTTTCCCCCTGGGTTTTGGA 3150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3038 tgaaggaggtgctgggggtgagaatgtcgcctttccccctgggttttgga 3087 V.1 3151 TCACTAATTCAAGGCTCTTCTGGATGTTTCTCTGGGTTGGGGCTGGAGTT 3200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3088 tcactaattcaaggctcttctggatgtttctctgggttggygctggagtt 3137 V.1 3201 CAATGAGGTTTATTTTTAGCTGGCCCACCCAGATACACTCAGCCAGAATA 3250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3138 caatgaggtttatttttagctggcccacccagatacactcagccagaata 3187 V.1 3251 CCTAGATTTAGTACCCAAACTCTTCTTAGTCTGAAATCTGCTGGATTTCT 3300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3188 cctagatttagtacccaaactcttcttagtctgaaatctgctggatttct 3237 V.1 3301 GGCCTAAGGGAGAGGCTCCCATCCTTCGTTCCCCAGCCAGCCTAGGACTT 3350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3238 ggcctaagggagaggctcccatccttcgttccccagccagcctaggactt 3287 V.1 3351 CGAATGTGGAGCCTGAAGATCTAAGATCCTAACATGTACATTTTATGTAA 3400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3288 cgaatgtggagcctgaagatctaagatcctaacatgtacattttatgtaa 3337 V.1 3401 ATATGTGCATATTTGTACATAAAATGATATTCTGTTTTTAAATAAACAGA 3450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 3338 atatgtgcatatttgtacataaaatgatattctgtttttaaataaacaga 3387 V.1 3451 CAAAACTTGaaaaa 3464 |||||||||||||| V.8 3388 caaaacttgaaaaa 3401

[1077] 73 TABLE LIV(c) Peptide seguences of protein coded by 191P4D12(b) v.8 (SEQ ID NO:120) MPLSLGAEMW GPEAWLLLLL LLASFTGRCP AGELETSDVV TVVLGQDAKL PCFYRGDSGE 60 QVGQVAWARV DAGEGAQELA LLHSKYGLHV SPAYEGRVEQ PPPPRNPLDG SVLLRNAVQA 120 DEGEYECRVS TFPAGSFQAR LRLRVLVPPL PSLNPGPALE EGQGLTLAAS CTAEGSPAPS 180 VTWDTEVKGT TSSRSFKHSR SAAVTSEFHL VPSRSMNGQP LTCVVSHPGL LQDQRITHIL 240 HVSFLAEASV RGLEDQNLWH IGREGAMLKC LSEGQPPPSY NWTRLDGPLP SGVRVDGDTL 300 GFPPLTTEHS GIYVCHVSNE FSSRDSQVTV DVLDPQEDSG KQVDLVSASV VVVGVIAALL 360 FCLLVVVVVL MSRYHRRKAQ QMTQKYEEEL TLTRENSIRR LHSHHTDPRS QPEESVGLRA 420 EGHPDSLKDN SSCSVMSEEP EGRSYSTLTT VREIETQTEL LSPGSGRAEE EEDQDEGIKQ 480 AMNHFVQENG TLRAKPTGNG IYINGRGHLV 510

[1078] 74 TABLE LV(c) Amino acid seguence alignment of 191P4012(b) v.1 (SEQ ID NO: 121) and 191P4D12(b) v.8 (SEQ ID NO: 122) V.1 1 MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKL 50 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 1 MPLSLGAEMWGPEAWLLLLLLLASFTGRCPAGELETSDVVTVVLGQDAKL 50 V.1 51 PCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQ 100 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 51 PCFYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAYEGRVEQ 100 V.1 101 PPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPL 150 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 101 PPPPRNPLDGSVLLRNAVQADEGEYECRVSTFPAGSFQARLRLRVLVPPL 150 V.1 151 PSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSR 200 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 151 PSLNPGPALEEGQGLTLAASCTAEGSPAPSVTWDTEVKGTTSSRSFKHSR 200 V.1 201 SAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASV 250 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 201 SAAVTSEFHLVPSRSMNGQPLTCVVSHPGLLQDQRITHILHVSFLAEASV 250 V.1 251 RGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL 300 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 251 RGLEDQNLWHIGREGAMLKCLSEGQPPPSYNWTRLDGPLPSGVRVDGDTL 300 V.1 301 GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV 350 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 301 GFPPLTTEHSGIYVCHVSNEFSSRDSQVTVDVLDPQEDSGKQVDLVSASV 350 V.1 351 VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRR 400 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 351 VVVGVIAALLFCLLVVVVVLMSRYHRRKAQQMTQKYEEELTLTRENSIRR 400 V.1 401 LHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTT 450 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 401 LHSHHTDPRSQPEESVGLRAEGHPDSLKDNSSCSVMSEEPEGRSYSTLTT 450 V.1 451 VREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNG 500 |||||||||||||||||||||||||||||||||||||||||||||||||| V.8 451 VREIETQTELLSPGSGRAEEEEDQDEGIKQAMNHFVQENGTLRAKPTGNG 500 V.1 501 IYINGRGHLV 510 |||||||||| V.8 501 IYINGRGHLV 510

[1079] 75 TABLE LII(d) Nucleotide seguence of transcript variant 191P4012(b) v.9 (SEQ ID NO: 123) gtctgaccca ggcctgcctc ccttccctag gcctggctcc ttctgttgac atgggagatt 60 ttagctcatc ttgggggcct ccttaaacac ccccatttct tgcggaagat gctccccatc 120 ccactgactg cttgaccttt acctccaacc cttctgttca tcgggagggc tccaccaatt 180 gagtctctcc caccatgcat gcaggtcact gtgtgtgtgc atgtgtgcct gtgtgagtgt 240 tgactgactg tgtgtgtgtg gaggggtgac tgtccgtgga ggggtgactg tgtccgtggt 300 gtgtattatg ctgtcatatc agagtcaagt gaactgtggt gtatgtgcca cgggatttga 360 gtggttgcgt gggcaacact gtcagggttt ggcgtgtgtg tcatgtggct gtgtgtgacc 420 tctgcctgaa aaagcaggta ttttctcaga ccccagagca gtattaatga tgcagaggtt 480 ggaggagaga ggtggagact gtggctcaga cccaggtgtg cgggcatagc tggagctgga 540 atctgcctcc ggtgtgaggg aacctgtctc ctaccacttc ggagccatgg gggcaagtgt 600 gaagcagcca gtccctgggt cagccagagg cttgaactgt tacagaagcc ctctgccctc 660 tggtggcctc tgggcctgct gcatgtacat attttctgta aatatacatg cgccgggagc 720 ttcttgcagg aatactgctc cgaatcactt ttaatttttt tctttttttt ttcttgccct 780 ttccattagt tgtatttttt atttattttt atttttattt ttttttagag atggagtctc 840 actatgttgc tcaggctggc cttgaactcc tgggctcaag caatcctcct gcctcagcct 900 ccctagtagc tgggacttta agtgtacacc actgtgcctg ctttgaatcc tttacgaaga 960 gaaaaaaaaa attaaagaaa gcctttagat ttatccaatg tttactactg ggattgctta 1020 aagtgaggcc cctccaacac cagggggtta attcctgtga ttgtgaaagg ggctacttcc 1080 aaggcatctt catgcaggca gccccttggg agggcacctg agagctggta gagtctgaaa 1140 ttagggatgt gagcctcgtg gttactgagt aaggtaaaat tgcatccacc attgtttgtg 1200 ataccttagg gaattgcttg gacctggtga caagggctcc tgttcaatag tggtgttggg 1260 gagagagaga gcagtgatta tagaccgaga gagtaggagt tgaggtgagg tgaaggaggt 1320 gctgggggtg agaatgtcgc ctttccccct gggttttgga tcactaattc aaggctcttc 1380 tggatgtttc tctgggttgg ggctggagtt caatgaggtt tatttttagc tggcccaccc 1440 agatacactc agccagaata cctagattta gtacccaaac tcttcttagt ctgaaatctg 1500 ctggatttct ggcctaaggg agaggctccc atccttcgtt ccccagccag cctaggactt 1560 cgaatgtgga gcctgaagat ctaagatcct aacatgtaca ttttatgtaa atatgtgcat 1620 atttgtacat aaaatgatat tctgttttta aataaacaga caaaacttg 1669

[1080] 76 TABLE LIII(d) Nucleotide seguence alignment of 191P4D12(b) v.1 (SEQ ID NO: 124) and 191P4D12(b) v.9 (SEQ ID NO: 125) v.1 1791 GTCTGACCCAGGCCTGCCTCCCTTCCCTAGGCCTGGCTCCTTCTGTTGAC 1840 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1 gtctgacccaggcctgcctcccttccctaggcctggctccttctgttgac 50 v.1 1841 ATGGGAGATTTTAGCTCATCTTGGGGGCCTCCTTAAACACCCCCATTTCT 1890 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 51 atgggagattttagctcatcttgggggcctccttaaacacccccatttct 100 v.1 1891 TGCGGAAGATGCTCCCCATCCCACTGACTGCTTGACCTTTACCTCCAACC 1940 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 101 tgcggaagatgctccccatcccactgactgcttgacctttacctccaacc 150 v.1 1941 CTTCTGTTCATCGGGAGGGCTCCACCAATTGAGTCTCTCCCACCATGCAT 1990 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 151 cttctgttcatcgggagggctccaccaattgagtctctcccaccatgcat 200 v.1 1991 GCAGCTCACTGTGTGTGTGCATGTGTGCCTGTGTGAGTGTTGACTGACTG 2040 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 201 gcaggtcactgtgtgtgtgcatgtgtgcctgtgtgagtgttgactgactg 250 v.1 2041 TGTGTGTGTGGAGGGGTGACTGTCCGTGGAGGGGTGACTGTGTCCGTGGT 2090 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 251 tgtgtgtgtggaggggtgactgtccgtggaggggtgactgtgtccgtggt 300 v.1 2091 GTGTATTATGCTGTCATATCACAGTCAAGTGAACTGTGGTGTATGTGCCA 2140 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 301 gtgtattatgctgtcatatcagagtcaagtgaactgtggtgtatgtgcca 350 v.1 2141 CGGGATTTGAGTGGTTGCGTGGGCAACACTGTCAGGGTTTGGCGTGTCTG 2190 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 351 cgggatttgagtggttgcgtgggcaacactgtcagggtttggcgtgtgtg 400 v.1 2191 TCATGTGGCTGTGTGTGACCTCTGCCTGAAAAAGCAGGTATTTTCTCAGA 2240 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 401 tcatgtggctgtgtgtgacctctgcctgaaaaagcaggtattttctcaga 450 v.1 2241 CCCCAGAGCAGTATTAATGATGCAGAGGTTGGAGGAGAGAGGTGGAGACT 2290 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 451 ccccagagcagtattaatgatgcagaggttggaggagagaggtggagact 500 v.1 2291 GTGGCTCAGACCCAGGTGTGCGGGCATAGCTGGAGCTGGAATCTGCCTCC 2340 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 501 gtggctcagacccaggtgtgcgggcatagctggagctggaatctgcctcc 550 v.1 2341 GGTCTGAGGGAACCTGTCTCCTACCACTTCGGAGCCATGGGGGCAAAGTGT 2390 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 551 ggtgtgagggaacctgtctcctaccacttcggagccatgggggcaagtgt 600 v.1 2391 GAAGCAGCCAGTCCCTGGGTCAGCCAGAGGCTTGAACTGTTACAGAAGCC 2440 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 601 gaagcagccagtccctgggtcagccagaggcttgaactgttacagaagcc 650 v.1 2441 CTCTGCCCTCTGGTGGCCTCTGCGCCTGCTGCATGTACATATTTTCTGTA 2490 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 651 ctctgccctctggtggcctctgggcctgctgcatgtacatattttctgta 700 v.1 2491 AATATACATCCGCCGGGAGCTTCTTGCAGGAATACTGCTCCGPATCACTT 2540 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 701 aatatacatgcgccgggagcttcttgcaggaatactgctccgaatcactt 750 v.1 2541 TTAATTTTTTTCTTTTTTTTTTCTTGCCCTTTCCATTAGTTGTATTTTTT 2590 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 751 ttaatttttttcttttttttttcttgccctttccattagttgtatttttt 800 v.1 2591 ATTTATTTTTATTTTTATTTTTTTTTAGAGATGGAGTCTCACTATGTTGC 2640 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 801 atttatttttatttttatttttttttagagatggagtctcactatgttgc 850 v.1 2641 TCAGGCTGGCCTTGAACTCCTGGCCTCAAGCAATCCTCCTGCCTCAGCCT 2690 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 851 tcaggctggccttgaactcctgggctcaagcaatcctcctgcctcagcct 900 v.1 2691 CCCTAGTAGCTGGGACTTTAAGTGTACACCACTGTGCCTGCTTTGAATCC 2740 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 901 ccctagtagctgggactttaagtgtacaccactgtgcctgctttgaatcc 950 v.1 2741 TTTACGAAGAGAAAAAAAAAATTAAAGAAAGCCTTTAGATTTATCCAATG 2790 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 951 tttacgaagagaaaaaaaaaattaaagaaagcctttagatttatccaatg 1000 v.1 2791 TTTACTACTGGGATTGCTTAAAGTGAGGCCCCTCCAACACCAGGGGGTTA 2840 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1001 tttactactgggattgcttaaagtgaggcccctccaacaccagggggtta 1050 v.1 2841 ATTCCTGTGATTGTGAAAGGGGCTACTTCCAAGGCATCTTCATGCAGGCA 2890 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1051 attcctgtgattgtgaaaggggctacttccaaggcatcttcatgcaggca 1100 v.1 2891 GCCCCTTGGGAGGGCACCTGAGAGCTGGTAGAGTCTGAAATTAGGGATGT 2940 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1101 gccccttgggagggcacctgagagctggtagagtctgaaattagggatgt 1150 v.1 2941 GAGCCTCGTGGTTACTGAGTAAGGTAAAATTGCATCCACCATTGTTTGTG 2990 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1151 gagcctcgtggttactgagtaaggtaaaattgcatccaccattgtttgtg 1200 v.1 2991 ATACCTTAGGGAATTGCTTGGACCTGGTGACAAGGGCTCCTGTTCAATAG 3040 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1201 ataccttagggaattgcttggacctggtgacaagggctcctgttcaatag 1250 v.1 3041 TGGTGTTGGGGAGAGAGAGAGCAGTGATTATAGACCGAGAGAGTAGGAGT 3090 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1251 tggtgttggggagagagagagcagtgattatagaccgagagagtaggagt 1300 v.1 3091 TGAGGTGAGGTGAAGGAGGTGCTGGGGGTGAGAATGTCGCCTTTCCCCCT 3140 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1301 tgaggtgaggtgaaggaggtgctgggggtgagaatgtcgcctttccccct 1350 v.1 3141 GGGTTTTGGATCACTAATTCAAGGCTCTTCTGGATGTTTCTCTGGGTTGG 3190 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1351 gggttttggatcactaattcaaggctcttctggatgtttctctgggttgg 1400 v.1 3191 CGCTGGAGTTCAATGAGGTTTATTTTTAGCTGGCCCACCCAGATACACTC 3240 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1401 ggctggagttcaatgaggtttatttttagctggcccacccagatacactc 1450 v.1 3241 AGCCAGAATACCTAGATTTAGTACCCAAACTCTTCTTAGTCTGAAATCTG 3290 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1451 agccagaatacctagatttagtacccaaactcttcttagtctgaaatctg 1500 v.1 3291 CTGGATTTCTGGCCTAAGGGACAGGCTCCCATCCTTCGTTCCCCAGCCAG 3340 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1501 ctggatttctggcctaagggagaggctcccatccttcgttccccagccag 1550 v.1 3341 CCTAGGACTTCGAATGTGGAGCCTGAAGATCTAAGATCCTAACATGTACA 3390 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1551 cctaggacttcgaatgtggagcctgaagatctaagatcctaacatgtaca 1600 v.1 3391 TTTTATGTAAATATGTGCATATTTGTACATAAAATGATATTCTGTTTTTA 3440 |||||||||||||||||||||||||||||||||||||||||||||||||| v.9 1601 ttttatgtaaatatgtgcatatttgtacataaaatgatattctgttttta 1650 v.1 3441 AATAAACAGACAAAACTTG 3459 ||||||||||||||||||| v.9 1651 aataaacagacaaaacttg 1669

[1081] 77 TABLE LIV(d) Peptide seguences of protein coded by 191P4D12(b) v.9 (SEQ ID NO: 126) MRRELLAGIL LRITFNFFLF FFLPFPLVVF FIYFYFYFFL EMESHYVAQA GLELLGSSNP 60 PASASLVAGT LSVHHCACFE SFTKRKKKLK KAFRFIQCLL LGLLKVRPLQ HQGVNSCDCE 120 RGYFQGIFMQ AAPWEGT 137

[1082] 78 TABLE LV(d) Amino acid sequence alignment of 191P4D12(b) v.1 and 191P4D12(b) v.9 (NO SIGNIFICANT MATCH)

[1083]

Claims

1. A composition that comprises, consists essentially of, or consists of:

a) a peptide of eight, nine, ten, or eleven contiguous amino acids of a protein of FIG. 2;
b) a peptide of Tables VIII-XXI;
c) a peptide of Tables XXII to XLV; or,
d) a peptide of Tables XLVI to XLIX.

2. A composition of claim 1 that comprises a protein related to a protein of FIG. 2.

3. A protein of claim 2 that is at least 90, 91, 92, 93, 94, 95, 96, 97, 98, or 99% homologous to an entire amino acid sequence shown in FIG. 2.

4. A composition of claim 1 wherein the substance comprises a CTL polypeptide or an analog thereof, from the amino acid sequence of a protein of FIG. 2.

5. A composition of claim 4 further limited by a proviso that the epitope is not an entire amino acid sequence of FIG. 2.

6. A composition of claim 1 further limited by a proviso that the polypeptide is not an entire amino acid sequence of a protein of FIG. 2.

7. A composition of claim 1 that comprises an antibody polypeptide epitope from an amino acid sequence of FIG. 2.

8. A composition of claim 7 further limited by a proviso that the epitope is not an entire amino acid sequence of FIG. 2.

9. A composition of claim 7 wherein the antibody epitope comprises a peptide region of at least 5 amino acids of FIG. 2 in any whole number increment up to the end of said peptide, wherein the epitope comprises an amino acid position selected from:

a) an amino acid position having a value greater than 0.5 in the Hydrophilicity profile of FIG. 5,
b) an amino acid position having a value less than 0.5 in the Hydropathicity profile of FIG. 6;
c) an amino acid position having a value greater than 0.5 in the Percent Accessible Residues profile of FIG. 7;
d) an amino acid position having a value greater than 0.5 in the Average Flexibility profile of FIG. 8;
e) an amino acid position having a value greater than 0.5 in the Beta-turn profile of FIG. 9;
f) a combination of at least two of a) through e);
g) a combination of at least three of a) through e);
h) a combination of at least four of a) through e); or
i) a combination of five of a) through e).

10. A polynucleotide that encodes a protein of claim 1.

11. A polynucleotide of claim 10 that comprises a nucleic acid molecule set forth in FIG. 2.

12. A polynucleotide of claim 10 further limited by a proviso that the encoded protein is not an entire amino acid sequence of FIG. 2.

13. A composition of claim 11 wherein the substance comprises a polynucleotide that comprises a coding sequence of a nucleic acid sequence of FIG. 2.

14. A polynucleotide of claim 11 that further comprises an additional nucleotide sequence that encodes an additional peptide of claim 1.

15. A composition comprising a polynucleotide that is fully complementary to a polynucleotide of claim 10.

16. A method of generating a mammalian immune response directed to a protein of FIG. 2, the method comprising:

exposing cells of the mammal's immune system to a portion of
a) a 191P4D12(b)-related protein and/or
b) a nucleotide sequence that encodes said protein,
whereby an immune response is generated to said protein.

17. A method of generating an immune response of claim 16, said method comprising:

providing a 191P4D12(b)-related protein that comprises at least one T cell or at least one B cell epitope; and,
contacting the epitope with a mammalian immune system T cell or B cell respectively, whereby the T cell or B cell is activated.

18. A method of claim 17 wherein the immune system cell is a B cell, whereby the induced B cell generates antibodies that specifically bind to the 191P4D12(b)-related protein.

19. A method of claim 17 wherein the immune system cell is a T cell that is a cytotoxic T cell (CTL), whereby the activated CTL kills an autologous cell that expresses the 191P4D12(b)-related protein.

20. A method of claim 17 wherein the immune system cell is a T cell that is a helper T cell (HTL), whereby the activated HTL secretes cytokines that facilitate the cytotoxic activity of a cytotoxic T cell (CTL) or the antibody-producing activity of a B cell.

21. Amethod for detecting, in a sample, the presence of a 191P4D12(b)-related protein or a 191P4D12(b)-related polynucleotide, comprising steps of:

contacting the sample with a substance that specifically binds to the 191P4D12(b)-related protein or to the 191P4D12(b)-related polynucleotide, respectively; and,
determining that there is a complex of the substance with the 191P4D12(b)-related protein or the substance with the 191P4D12(b)-related polynucleotide, respectively.

22. A method of claim 21 for detecting the presence of a 191P4D12(b)-related protein in a sample comprising steps of:

contacting the sample with an antibody or fragment thereof either of which specifically bind to the 191P4D12(b)-related protein; and,
determining that there is a complex of the antibody or fragment thereof and the 191P4D12(b)-related protein.

23. A method of claim 21 further comprising a step of:

taking the sample from a patient who has or who is suspected of having cancer.

24. A method of claim 21 for detecting the presence of a protein of FIG. 2 mRNA in a sample comprising:

producing cDNA from the sample by reverse transcription using at least one primer;
amplifying the cDNA so produced using 191P4D12(b) polynucleotides as sense and antisense primers, wherein the 191P4D12(b) polynucleotides used as the sense and antisense primers serve to amplify a 191P4D12(b) cDNA; and,
detecting the presence of the amplified 191P4D12(b) cDNA.

25. A method of claim 21 for monitoring one or more 191P4D12(b) gene products in a biological sample from a patient who has or who is suspected of having cancer, the method comprising:

determining the status of one or more 191P4D12(b) gene products expressed by cells in a tissue sample from an individual;
comparing the status so determined to the status of one or more 191P4D12(b) gene products in a corresponding normal sample; and,
identifying the presence of one or more aberrant gene products of 191P4D12(b) in the sample relative to the normal sample.

26. The method of claim 25 further comprising a step of determining if there are one or more elevated gene products of a 191P4D12(b) mRNA or a 191P4D12(b) protein, whereby the presence of one or more elevated gene products in the test sample relative to the normal tissue sample indicates the presence or status of a cancer.

27. A method of claim 26 wherein the cancer occurs in a tissue set forth in Table I.

28. A composition comprising:

a substance that a) modulates the status of a protein of FIG. 2, or b) a molecule that is modulated by a protein of FIG. 2, whereby the status of a cell that expresses a protein of FIG. 2 is modulated.

29. A composition of claim 28, further comprising a physiologically acceptable carrier.

30. A pharmaceutical composition that comprises the composition of claim 28 in a human unit dose form.

31. A composition of claim 28 wherein the substance comprises an antibody or fragment thereof that specifically binds to a protein of FIG. 2.

32. An antibody or fragment thereof of claim 31, which is monoclonal.

33. An antibody of claim 31, which is a human antibody, a humanized antibody or a chimeric antibody.

34. A non-human transgenic animal that produces an antibody of claim 31.

35. A hybridoma that produces an antibody of claim 32.

36. A method of delivering a cytotoxic agent or a diagnostic agent to a cell that expresses a protein of FIG. 2, said method comprising:

providing the cytotoxic agent or the diagnostic agent conjugated to an antibody or fragment thereof of claim 4; and,
exposing the cell to the antibody-agent or fragment-agent conjugate.

37. A composition of claim 28 wherein the substance comprises a polynucleotide that encodes an antibody or fragment thereof, either of which immunospecifically bind to a protein of FIG. 2.

38. A composition of claim 28 wherein the substance comprises a) a ribozyme that cleaves a polynucleotide having a 191P4D12(b) coding sequence, or b) a nucleic acid molecule that encodes the ribozyme; and, a physiologically acceptable carrier.

39. A composition of claim 28 wherein the substance comprises human T cells, wherein said T cells specifically recognize a 191P4D12(b) peptide subsequence in the context of a particular HLA molecule.

40. A method of inhibiting growth of cancer cells that express a protein of FIG. 2, the method comprising:

administering to the cells the composition of claim 28.

41. A method of claim 40 of inhibiting growth of cancer cells that express a protein of FIG. 2, the method comprising steps of:

administering to said cells an antibody or fragment thereof, either of which specifically bind to a 191P4D12(b)-related protein.

42. A method of claim 40 of inhibiting growth of cancer cells that express a protein of FIG. 2, the method comprising steps of:

administering to said cells a 191P4D12(b)-related protein.

43. A method of claim 40 of inhibiting growth of cancer cells that express a protein of FIG. 2, the method comprising steps of:

administering to said cells a polynucleotide comprising a coding sequence for a 191P4D12(b)-related protein or comprising a polynucleotide complementary to a coding sequence for a 191P4D12(b)-related protein.

44. A method of claim 40 of inhibiting growth of cancer cells that express a protein of FIG. 2, the method comprising steps of:

administering to said cells a ribozyme that cleaves a polynucleotide that encodes a protein of FIG. 2.

45. A method of claim 40 of inhibiting growth of cancer cells that express a protein of FIG. 2 and a particular HLA molecule, the method comprising steps of:

administering human T cells to said cancer cells, wherein said T cells specifically recognize a peptide subsequence of a protein of FIG. 2 while the subsequence is in the context of the particular HLA molecule.

46. A method of claim 40, the method comprising steps of:

administering a vector that delivers a nucleotide that encodes a single chain monoclonal antibody, whereby the encoded single chain antibody is expressed intracellularly within cancer cells that express a protein of FIG. 2.
Patent History
Publication number: 20040083497
Type: Application
Filed: Apr 23, 2003
Publication Date: Apr 29, 2004
Inventors: Arthur B. Raitano (Los Angeles, CA), Pia M. Challita-Eid (Encino, CA), Aya Jakobovits (Beverly Hills, CA), Mary Faris (Los Angeles, CA), Wangmao Ge (Culver City, CA)
Application Number: 10422571