Acting On Beta-1, 4-glucosidic Bond (e.g., Cellulase, Etc. (3.2.1.4)) Patents (Class 435/209)
  • Patent number: 11001827
    Abstract: The present disclosure relates to detergent compositions comprising xanthan lyase variants and methods for use of said compositions.
    Type: Grant
    Filed: August 24, 2017
    Date of Patent: May 11, 2021
    Assignee: Henkel AG & Co. KGaA
    Inventors: Nina Mussmann, Susanne Wieland, Daniela Herbst, Lars Anderson, Jens Erik Nielsen, Allan Svendsen, Rune Nygaard Monrad, Rajendra Kulothungan Sainathan, Geetha Hiremath Mendez, Sohel Dalal, Shilpi Agarwal, Kasper D. Rand, Pernille F. Jensen
  • Patent number: 10988747
    Abstract: The present disclosure relates to a detergent composition comprising endoglucanase variants and methods for use of said compositions.
    Type: Grant
    Filed: August 24, 2017
    Date of Patent: April 27, 2021
    Assignee: Henkel AG & Co. KGaA
    Inventors: Nina Mussmann, Susanne Wieland, Daniela Herbst, Lars Anderson, Jens Erik Nielsen, Allan Svendsen, Rune Nygaard Monrad, Lars Giger, Vasudeva P. Rao, Sohel Dalal, Santhosh Vasu Mepadam, Marie T. Kruse, Kasper D. Rand, Pernille F. Jensen
  • Patent number: 10907140
    Abstract: A mutant ?-glucosidase polypeptide exhibits enhanced thermostability and has the amino acid sequence: MAKFPRDFVWGTATSSYQIEGAVNEDGRTPSIWDTFSKTX1GKTYKGHT GDVACDHYHRYKEDVEILKEIGVKAYRFSIAWPRIFPEEGKYNPKGMDF YKKLIDELQKRDIX2PAATIYHWDLPQWAYDKGGGWLNRESIKWYVEYA TKLFEELGDAIPLWITHNEPWCSSILSYGIGEHAPGHKNYREALIAAHH ILLSHGEAVKAFREMNIKGSKIGITLNLTPAYPASEKEEDKLAAQYADG FANRWELDPIFKGNYPEDMMELYSKIIGEFDFIKEGDLETISVPIDFLG X3NYYTRSIVKYDEDSMLKAENVPGPGKRTEMGWEISPESLYDLLKRLD REYTKLPMYITENGAAFKDEVTEDGRVHDDERIEYIKEHLKAAAKFIGE GGNLKGYFVWSLMDNFEWAHGYSKRFGIVYVDYX4TQKRILKDSALWYK EVIX5DDGIED, wherein X1 is selected from E, P, T, M, A, S and G; X2 is selected from V, K, R and H; X3 is selected from I, L, M, P, T and A; X4 is selected from T, E, D, N, Q, M and P; and X5 is selected from L, R, K and H.
    Type: Grant
    Filed: September 5, 2016
    Date of Patent: February 2, 2021
    Assignee: Technische Universitaet Muenchen
    Inventors: Vladimir Zverlov, Wolfgang Schwarz, Roman Prechtl, Benedikt Leis, Claudia Held, Wolfgang Liebl
  • Patent number: 10808235
    Abstract: The application relates to a polypeptide having beta-glucosidase activity, its method of production and its uses.
    Type: Grant
    Filed: December 8, 2016
    Date of Patent: October 20, 2020
    Assignee: DSM IP Assets B.V.
    Inventor: Johannes Gustaaf Ernst Van Leeuwen
  • Patent number: 10745679
    Abstract: The present invention relates to the expression and optimization of enzymes involved in the breakdown of lignocellulosic biomass. Disclosed are variants of the exoglucanase 1 of Trichoderma reesei, as well as the use of said variants with improved efficiency in methods for breaking down cellulose and for producing biofuel.
    Type: Grant
    Filed: June 12, 2015
    Date of Patent: August 18, 2020
    Assignees: IFP Energies Nouvelles, Centre National De La Recherche Scientifique—CNRS, Proteus
    Inventors: Cecile Persillon, Christophe Ullmann, Celine Ayrinhac, Olivier Bonzom, Sebastien Fort, Sylvie Armand, Stephanie Pradeau, Antoine Margeot, Lionel Rousseau, Françoise Le Roux
  • Patent number: 10738292
    Abstract: The present invention relates to a novel endoglucanase gene (GH5 family) from the soil metagenome. More specifically, this invention provides a recombinant plasmid and the recombinant hosts for the expression of novel gene sequence having cellulase activity. The cellulase in the invention has high specific activity towards ?-1,4 linkages in substrates such as carboxy-methyl cellulose and barley-?-glucan etc. This novel cellulase can have many industrial applications eg. food and feed industry, detergent, textile and biofuel industry etc.
    Type: Grant
    Filed: November 11, 2016
    Date of Patent: August 11, 2020
    Assignee: Council of Scientific & Industrial Research
    Inventors: Roma Garg, Vijaya Brahma, Lata Verma, Girish Sahni
  • Patent number: 10597673
    Abstract: The present invention refers to a plant or plant part comprising a polynucleotide encoding a wildtype or mutated cellulose synthase (CESA) polypeptide, the expression of said polynucleotide confers to the plant or plant part tolerance to CESA-inhibiting herbicides, such as azines.
    Type: Grant
    Filed: April 22, 2015
    Date of Patent: March 24, 2020
    Assignee: BASF SE
    Inventors: Stefan Tresch, Doreen Schachtschabel, Mihiret Tekeste Sisay, Jens Lerchl, Julia Major, Florian Vogt, Frederick Calo, Jill Marie Paulik
  • Patent number: 10538753
    Abstract: Disclosed herein are methods of making multifunctional microbial cellulases. The engineered multifunctional microbial cellulases disclosed herein exhibit improved activity over native cellulases.
    Type: Grant
    Filed: March 6, 2018
    Date of Patent: January 21, 2020
    Assignee: Alliance for Sustainably Enegry, LLC
    Inventors: Roman Brunecky, Venkataramanan Subramanian, Stephen Robert Decker, Michael E. Himmel
  • Patent number: 10526568
    Abstract: The present invention is directed to a cleaning composition including one or more Class III or Class IV BslA (Biofilm surface layer A) proteins and a surfactant system including one or more anionic surfactants and one or more co-surfactants, in a weight of ratio of less than 9:1. Methods of making and using such compositions are also provided.
    Type: Grant
    Filed: November 13, 2018
    Date of Patent: January 7, 2020
    Assignee: The Procter & Gamble Company
    Inventors: Jean-Luc Philippe Bettiol, Denis Alfred Gonzales, Juan Esteban Velasquez, Nicholas William Geary
  • Patent number: 10494622
    Abstract: The aim of the invention is to improve the secretion of a protein from a host cell in order to increase the product yield of protein in a fermentation process. This is achieved by an expression vector comprising a) a promoter sequence and b) a nucleic acid sequence that codes for a protein. The protein comprises a signal peptide and an additional amino acid sequence, and the signal peptide comprises an amino acid sequence that is at least 80% identical to the amino acid sequence specified in SEQ ID NO: 2, at least 80% identical to the amino acid sequence specified in SEQ ID NO: 4, at least 80% identical to the amino acid sequence specified in SEQ ID NO: 6, or the signal peptide comprises an amino acid sequence that is structurally homologous to at least one of said sequences.
    Type: Grant
    Filed: September 22, 2017
    Date of Patent: December 3, 2019
    Assignee: BASF SE
    Inventors: Christian Degering, Thorsten Eggert, Stefan Evers, Karl-Heinz Maurer, Johannes Bongaerts
  • Patent number: 10385324
    Abstract: The present invention relates to variants of cellobiohydrolase, preferably Cbh1, which have greater cellobiohydrolase activity. The invention also relates to a genetic construct, a host cell and to an enzyme composition comprising said variants. The invention further relates to a procedure for producing fermentable sugar and a procedure for producing a bioproduct, such as bioethanol, from cellulose material with the cellobiohydrolase variants, the host cell or the enzyme composition comprising said variants.
    Type: Grant
    Filed: April 8, 2016
    Date of Patent: August 20, 2019
    Assignee: ABENGOA BIOENERGÍA NUEVAS TECNOLOGÍAS, S.A.
    Inventors: Bruno Díez García, Noelia Valbuena Crespo, Francisco Manuel Reyes Sosa, Antonio Javier Moreno Pérez, Dolores Pérez Gómez, Ana Isabel Platero Gómez, Lucia Martín Pérez, Sandra Gavaldá Martín, Laura Viñas De La Cruz, Laura Sánchez Zamorano, Consolación Álvarez Núñez, María de los Ángeles Bermúdez Alcántara, Javier Rocha Martín, Laura Ledesma García, Juan Luis Ramos Martín, Laura Benítez Casanova, Macarena López Morales
  • Patent number: 10385346
    Abstract: A xylosidase having improved enzymatic activity is disclosed. The amino acid sequence of the xylosidase is a modified amino acid sequence of SEQ ID NO: 2, wherein the modification is a substitution of phenylalanine at position 35 with glutamate, and/or a substitution of glutamine at position 41 with histidine.
    Type: Grant
    Filed: October 11, 2018
    Date of Patent: August 20, 2019
    Assignee: DONGGUAN APAC BIOTECHNOLOGY CO., LTD.
    Inventors: Ya-Shan Cheng, Tzu-Hui Wu, Cheng-Yen Lin, Hui-Lin Lai, Cheng-Bin Zheng, Ting-Yung Huang, I-Hsuan Lin, Jian-Wen Huang, Chun-Chi Chen, Rey-Ting Guo
  • Patent number: 10174301
    Abstract: The present invention relates to isolated polypeptides having protease activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides in e.g. animal feed and detergents.
    Type: Grant
    Filed: December 20, 2012
    Date of Patent: January 8, 2019
    Assignee: Novozymes A/S
    Inventors: Tine Hoff, Carsten Sjoeholm, Peter Rahbek Oestergaard, Katrine Pontoppidan
  • Patent number: 10059932
    Abstract: An object is to provide a mutant of a cellulase-producing microorganism which produces a cellulase capable of preferentially producing a cello-oligosaccharide during the selective production of the cello-oligosaccharide through enzymolysis of a cellulosic material in the presence of the cellulase, a method for producing the cellulase and a method for producing a cello-oligosaccharide using the cellulase. The present invention relates to a mutant of a cellulase-producing microorganism, in which cellobiohydrolase and ?-glucosidase genes are disrupted.
    Type: Grant
    Filed: March 14, 2014
    Date of Patent: August 28, 2018
    Assignees: NAGAOKA UNIVERSITY OF TECHNOLOGY, INPEX CORPORATION
    Inventors: Wataru Ogasawara, Takashi Yamaguchi, Yosuke Shida, Yoshiro Ishii, Tatsuki Wakayama, Yoshiro Konda
  • Patent number: 10041055
    Abstract: The present invention relates to polypeptides having mannanase activity, catalytic domains, and carbohydrate binding modules, and polynucleotides encoding the polypeptides, catalytic domains, and carbohydrate binding modules. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains, and carbohydrate binding modules.
    Type: Grant
    Filed: September 19, 2014
    Date of Patent: August 7, 2018
    Assignee: NOVOZYMES A/S
    Inventors: Kristian Bertel Roemer M. Krogh, Nikolaj Spodsberg, Klaus Gori, Pernille Von Freiesleben
  • Patent number: 10006068
    Abstract: Disclosed herein is a pulverulent ceramide producing method that enables easily and efficiently extracting and separating ceramide from sugar beet pulp, and efficiently pulverizing the ceramide by spray drying. The pulverulent ceramide can be efficiently obtained by a process that includes concentrating, with and/or without adding water, a sugar beet pulp ethanol extract obtained by extraction of a sugar beet pulp (for example, such as a beet fiber) with ethanol, adding pectinase to the resulting concentrate and performing an enzymatic reaction, performing emulsification after inactivating the enzyme, and pulverizing the resulting emulsion using spray drying.
    Type: Grant
    Filed: July 29, 2014
    Date of Patent: June 26, 2018
    Assignees: Nippon Beet Sugar Manufacturing., Co., Ltd., T. HASEGAWA CO., LTD.
    Inventors: Keisuke Takahashi, Taizo Nagura, Hiroto Kikuchi, Teruhisa Ohashi, Natsumi Suzuki, Tadashi Yoshimoto, Tomohiro Hosogai
  • Patent number: 10006014
    Abstract: A novel insecticidal chitinase protein from fern Tectaria sp., a process for preparation of the insecticidal protein and nucleic acid sequence encoding for said insecticidal protein and its application for insect control purposes.
    Type: Grant
    Filed: March 29, 2016
    Date of Patent: June 26, 2018
    Assignee: Council of Scientific & Industrial Research
    Inventors: Pradhyumna K. Singh, Santosh K. Upadhyay, Chandrashekar Krishnappa, Sharad Saurabh, Rahul Singh, Preeti Rai, Harpal Singh, Manisha Mishra, Ajit P. Singh, Praveen C. Verma, Kuttan P. Narayanan, Rakesh Tuli
  • Patent number: 9994836
    Abstract: The invention relates to novel variants of fungal endoglucanases, their production and means for their production. Especially the invention relates to variants of Acremonium thermophilum Cel45A. The invention further relates to enzyme preparations and detergent compositions comprising at least one novel variant endoglucanase as well as to processes for treating cellulosic material therewith. The novel variant endoglucanase polypeptides have improved performance in textile applications, especially in biofinishing and biostoning, and in detergent applications, in fabric care and color maintenance, especially in prevention and removal of fuzz and pills, in color care and revival.
    Type: Grant
    Filed: October 23, 2015
    Date of Patent: June 12, 2018
    Assignee: AB Enzymes Oy
    Inventors: Kari Juntunen, Marika Alapuranen, Leena Valtakari, Hanna-Mari Meriläinen, Terhi Puranen
  • Patent number: 9969993
    Abstract: The present invention relates to cellulolytic compositions for degrading or converting cellulose-containing material and methods of producing and using the compositions.
    Type: Grant
    Filed: May 30, 2008
    Date of Patent: May 15, 2018
    Assignee: Novozymes, Inc.
    Inventors: Sandra Merino, Keith McFarland, Joel Cherry, Sarah Teter
  • Patent number: 9926547
    Abstract: The present invention relates to isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains or cellulose binding domains.
    Type: Grant
    Filed: April 26, 2012
    Date of Patent: March 27, 2018
    Assignee: Novozymes, Inc.
    Inventors: Nikolaj Spodsberg, Brett McBrayer, Pierre Cassland
  • Patent number: 9926548
    Abstract: Polypeptides having endoglucanase activity, catalytic domains, and polynucleotides encoding the polypeptides or catalytic domains. Nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides or catalytic domains.
    Type: Grant
    Filed: October 23, 2014
    Date of Patent: March 27, 2018
    Assignee: Novozymes A/S
    Inventors: Weijian Lai, Lan Tang, Marc Dominique Morant, Paul Harris
  • Patent number: 9771569
    Abstract: The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: May 4, 2016
    Date of Patent: September 26, 2017
    Assignee: NOVOZYMES A/S
    Inventors: Alfredo Lopez de Leon, Michael Rey
  • Patent number: 9687531
    Abstract: Methods to introduce highly phosphorylated mannopyranosyl oligosaccharide derivatives containing mannose-6-phosphate (M6P), or other oligosaccharides bearing other terminal hexoses, to carbonyl groups on oxidized glycans of glycoproteins while retaining their biological activity are described. The methods are useful for modifying glycoproteins, including those produced by recombinant protein expression systems, to increase uptake by cell surface receptor-mediated mechanisms, thus improving their therapeutic efficacy in a variety of applications.
    Type: Grant
    Filed: August 20, 2014
    Date of Patent: June 27, 2017
    Assignee: Genzyme Corporation
    Inventor: Yunxiang Zhu
  • Patent number: 9688974
    Abstract: An Aspergillus mutant strain characterized in that it is an auxotrophic mutant strain of Aspergillus oryzae strain AOK27L.
    Type: Grant
    Filed: January 20, 2015
    Date of Patent: June 27, 2017
    Assignee: HONDA MOTOR CO., LTD.
    Inventors: Satoru Shinkawa, Shigenobu Mitsuzawa, Maiko Tanaka
  • Patent number: 9683224
    Abstract: The present invention relates to new enzymes with improved properties and to compositions comprising these enzymes suitable for use in the production of a food, feed, or malt beverage product, such as in a brewing process.
    Type: Grant
    Filed: September 14, 2012
    Date of Patent: June 20, 2017
    Assignee: DuPont Nutrition Biosciences ApS
    Inventors: Jens Frisbæk Sørensen, Lone Brønd Miller
  • Patent number: 9663774
    Abstract: The present invention relates to isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides, catalytic domains or cellulose binding domains.
    Type: Grant
    Filed: May 29, 2015
    Date of Patent: May 30, 2017
    Assignee: NOVOZYMES, INC.
    Inventors: Nikolaj Spodsberg, Tarana Shagasi
  • Patent number: 9663808
    Abstract: The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and an organic compound. The present invention also relates to methods of using the compositions.
    Type: Grant
    Filed: September 29, 2014
    Date of Patent: May 30, 2017
    Assignees: Novozymes, Inc., Novozymes A/S
    Inventors: Jason Quinlan, Feng Xu, Matthew Sweeney, Katja Salomon Johansen
  • Patent number: 9644223
    Abstract: A hyperthermostable endoglucanase including an endoglucanase catalytic domain, the endoglucanase catalytic domain including: (A) a polypeptide including an amino acid sequence represented by SEQ ID NO: 1; (B) a polypeptide including an amino acid sequence in which at least one amino acid is deleted, substituted, or added in the amino acid sequence represented by SEQ ID NO: 1, and having hydrolytic activity using p-nitrophenyl-?-D-cellobioside as a substrate at least under conditions of a temperature of 100° C. and a pH of 5.5; or (C) a polypeptide including an amino acid sequence having at least 70% sequence identity with the amino acid sequence represented by SEQ ID NO: 1, and having hydrolytic activity using p-nitrophenyl-?-D-cellobioside as a substrate at least under conditions of a temperature of 100° C. and a pH of 5.5.
    Type: Grant
    Filed: August 3, 2015
    Date of Patent: May 9, 2017
    Assignee: Honda Motor Co., Ltd.
    Inventors: Asuka Yamaguchi, Jiro Okuma, Yoshitsugu Hirose, Migiwa Suda, Yasuhiro Kondo, Tomohiko Kato, Daisuke Shibata
  • Patent number: 9624518
    Abstract: The present invention relates to methods for degrading or converting a cellulosic material and for producing substances from the cellulosic material under high temperature conditions.
    Type: Grant
    Filed: April 27, 2012
    Date of Patent: April 18, 2017
    Assignee: Novozymes, Inc.
    Inventors: Tarana Shaghasi, Brett McBrayer
  • Patent number: 9617528
    Abstract: Provided are isolated polypeptides having endoglucanase activity, catalytic domains, cellulose binding domains and polynucleotides encoding the polypeptides, catalytic domains or cellulose binding domains. Also provided are nucleic acid constructs, vectors and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides catalytic domains or cellulose binding domains.
    Type: Grant
    Filed: February 19, 2013
    Date of Patent: April 11, 2017
    Assignee: Novozymes A/S
    Inventors: Weijian Lai, Nikolaj Spodsberg, Lars Anderson
  • Patent number: 9593324
    Abstract: The present invention relates to the production of sugar hydrolysates from cellulosic material. The method may be used e.g. for producing fermentable sugars for the production of bioethanol from lignocellulosic material. Cellulolytic enzymes and their production by recombinant technology is described, as well as uses of the enzymes and enzyme preparations.
    Type: Grant
    Filed: October 3, 2013
    Date of Patent: March 14, 2017
    Assignee: Roal Oy
    Inventors: Jari Vehmaanperä, Marika Alapuranen, Terhi Puranen, Matti Siika-Aho, Jarno Kallio, Satu Jamsa, Sanni Voutilainen, Teemu Halonen, Liisa Viikari
  • Patent number: 9562222
    Abstract: The present invention relates to isolated polypeptides having beta-glucosidase activity, beta-xylosidase activity, or beta-glucosidase and beta-xylosidase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: November 16, 2012
    Date of Patent: February 7, 2017
    Assignees: NOVOZYMES A/S, NOVOZYMES, INC.
    Inventor: Marc Morant
  • Patent number: 9447400
    Abstract: The present disclosure is generally directed to enzymes and in particular beta-glucosidase variants. Also described are nucleic acids encoding beta-glucosidase variants, compositions comprising beta-glucosidase variants, methods of using beta-glucosidase variants, and methods of identifying additional useful beta-glucosidase variants.
    Type: Grant
    Filed: November 19, 2010
    Date of Patent: September 20, 2016
    Assignee: DANISCO US INC.
    Inventors: Richard R. Bott, Thijs Kaper, Bradley Kelemen, Frits Goedegebuur, Ronaldus Wilhelmus Hommes, Slavko Kralj, Paulien Kruithof, Igor Nikolaev, Wilhelmus Antonious Hendricus Van Der Kley, Johannes Franciscus Thomas Van Lieshout, Sander Van Stigt Thans, Gudrun Vogtentanz, Mats Sandgren
  • Patent number: 9410165
    Abstract: The present invention relates to isolated polypeptides having cellulolytic enhancing activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods for producing and using the polypeptides.
    Type: Grant
    Filed: September 29, 2014
    Date of Patent: August 9, 2016
    Assignee: Novozymes, Inc.
    Inventors: Kimberly Brown, Paul Harris, Elizabeth Zaretsky, Edward Re, Elena Vlasenko, Keith McFarland, Alfredo Lopez de Leon
  • Patent number: 9394555
    Abstract: The present invention relates to compositions comprising: a polypeptide having cellulolytic enhancing activity and a dioxy compound. The present invention also relates to methods of using the compositions.
    Type: Grant
    Filed: August 5, 2011
    Date of Patent: July 19, 2016
    Assignee: NOVOZYMES, INC.
    Inventors: Matthew Sweeney, Feng Xu, Jason Quinlan
  • Patent number: 9353360
    Abstract: The present invention relates to isolated polypeptides having xylanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: January 26, 2015
    Date of Patent: May 31, 2016
    Assignee: Novozymes, Inc.
    Inventors: Alfredo Lopez de Leon, Michael Rey
  • Patent number: 9328456
    Abstract: The present invention relates to the method for manufacturing textile, by treating textile with an isolated polypeptide having endoglucanase activity, especially in biostoning and bio-polishing process.
    Type: Grant
    Filed: August 16, 2013
    Date of Patent: May 3, 2016
    Assignee: Novozymes A/S
    Inventors: Weijian Lai, Lan Tang, Kirk Matthew Schnorr, Lars Anderson
  • Patent number: 9295274
    Abstract: Methods for hydrolyzing okara using endopeptidase and/or endoglucanase enzymes are disclosed. The hydrolyzed okara has a diminished water-holding capacity and is useful for supplementing the protein and fiber content of food products.
    Type: Grant
    Filed: April 14, 2008
    Date of Patent: March 29, 2016
    Assignee: Delavau L.L.C.
    Inventors: Gregory E. Urbanski, Kevin W. Lang
  • Patent number: 9267126
    Abstract: The present invention relates to isolated polypeptides having endoglucanase activity and isolated polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: August 30, 2011
    Date of Patent: February 23, 2016
    Assignee: NOVOZYMES, INC.
    Inventor: Nikolaj Spodsberg
  • Patent number: 9260705
    Abstract: The present invention relates to cellobiohydrolase variants having improved thermostability in comparison to wild-type CBH2a.
    Type: Grant
    Filed: December 31, 2014
    Date of Patent: February 16, 2016
    Assignee: Codexis, Inc.
    Inventors: Dipnath Baidyaroy, Louis Clark, David Elgart, Rama Voladri, Xiyun Zhang
  • Patent number: 9249474
    Abstract: Methods for consolidated pretreatment and hydrolysis of genetically engineered plants expressing cell wall degrading enzymes are provided. Expression cassettes and vectors for making transgenic plants are described. Plants engineered to express one or more cell wall degrading enzymes using expression cassettes and vectors of the invention are also provided.
    Type: Grant
    Filed: March 7, 2012
    Date of Patent: February 2, 2016
    Assignee: Agrivida, Inc.
    Inventors: R. Michael Raab, Dongcheng Zhang, Oleg Bougri
  • Patent number: 9238806
    Abstract: The present invention relates to a depilling composition comprising an enzyme mixture that comprises a Family 45 cellulase and one or more additional cellulases selected from a Family 5 cellulase, a Family 6 cellulase or a combination thereof. The enzyme mixture may be characterized in that the Family 45 and Family 5 cellulases or the Family 45 and Family 6 cellulases are present at a weight ratio that exhibits synergy in an assay that measures specific depilling activity. The enzyme mixture may be secreted by a genetically modified microbe overexpressing the foregoing cellulases. Also provided is a process for depilling that comprises a step of contacting cellulose-containing goods with the depilling composition.
    Type: Grant
    Filed: February 9, 2012
    Date of Patent: January 19, 2016
    Assignee: Novozymes A/S
    Inventors: Christopher Hill, John J. Tomashek, Loreta Gudynaite-Savitch, Guylaine Therrien, Sophie Calixte
  • Patent number: 9234216
    Abstract: In alternative embodiments, the invention provides polypeptides having a lignocellulolytic (lignocellulosic) activity, e.g., a ligninolytic and cellulolytic activity, including, e.g., a glycosyl hydrolase, a cellulase, an endoglucanase, a cellobiohydrolase (cbhl) (e.g., an exo-cellobiohydrolase, e.g., having an “exo” activity that can processively release cellobiose units ?-1,4 glucose-glucose disaccharide), a beta-glucosidase, a xylanase, a mannanse, a xylosidase (e.g., a (?-xylosidase) and/or an arabinofuranosidase activity, polynucleotides encoding these polypeptides, and methods of making and using these polynucleotides and polypeptides. In one embodiment, the invention provides thermostable and thermotolerant forms of polypeptides of the invention. The polypeptides and nucleic acids of the invention are used in a variety of pharmaceutical, agricultural and industrial contexts; for example, as enzymes for the bioconversion of a biomass, e.g.
    Type: Grant
    Filed: October 6, 2011
    Date of Patent: January 12, 2016
    Assignee: BP Corporation North America Inc.
    Inventors: Justin T. Stege, Alexander Varvak, John Poland, Chris S. Lyon, Shaun Healey, Peter Luginbuhl
  • Patent number: 9206405
    Abstract: A novel glycosyl hydrolase with activities of beta-xylosidase and beta-glucosidase is provided. Said glycosyl hydrolase can convert 7-xylosyltaxane compounds to 7-hydroxyltaxane compounds.
    Type: Grant
    Filed: April 12, 2011
    Date of Patent: December 8, 2015
    Assignee: Institute of Materia Medica, Chinese Academy of Medical Sciences
    Inventors: Ping Zhu, Haili Cheng, Ruiyu Zhao, Kedi Cheng, Huixia He, Chao Meng, Huixin Zhu
  • Patent number: 9187740
    Abstract: The present invention relates to isolated polypeptides having cellobiohydrolase activity and polynucleotides encoding the polypeptides. The invention also relates to nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: June 24, 2013
    Date of Patent: November 17, 2015
    Assignee: Novozymes Inc.
    Inventor: Nikolaj Spodsberg
  • Patent number: 9133448
    Abstract: The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 93% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 93% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.
    Type: Grant
    Filed: February 11, 2011
    Date of Patent: September 15, 2015
    Assignee: DSM IP ASSETS B.V.
    Inventors: Cornelis Maria Jacobus Sagt, Margot Elisabeth Francoise Schooneveld-Bergmans, Johannes Andries Roubos, Alrik Pieter Los
  • Patent number: 9121013
    Abstract: The invention relates to a polypeptide comprising the amino acid sequence set out in SEQ ID NO: 2 or an amino acid sequence encoded by the nucleotide sequence of SEQ ID NO: 1, or a variant polypeptide or variant polynucleotide thereof, wherein the variant polypeptide has at least 70% sequence identity with the sequence set out in SEQ ID NO: 2 or the variant polynucleotide encodes a polypeptide that has at least 70% sequence identity with the sequence set out in SEQ ID NO: 2. The invention features the full length coding sequence of the novel gene as well as the amino acid sequence of the full-length functional polypeptide and functional equivalents of the gene or the amino acid sequence. The invention also relates to methods for using the polypeptide in industrial processes. Also included in the invention are cells transformed with a polynucleotide according to the invention suitable for producing these proteins.
    Type: Grant
    Filed: June 23, 2011
    Date of Patent: September 1, 2015
    Assignee: DSM IP ASSETS B.V.
    Inventors: Margot Elisabeth Francoise Schooneveld-Bergmans, Wilbert Herman Marie Heijne, Rene Marcel De Jong, Robbertus Antonius Damveld
  • Patent number: 9096871
    Abstract: The present disclosure relates to variant CBH I polypeptides that have reduced product inhibition, and compositions, e.g., cellulase compositions, comprising variant CBH I polypeptides. The variant CBH I polypeptides and related compositions can be used in variety of agricultural and industrial applications. The present disclosure further relates to nucleic acids encoding variant CBH I polypeptides and host cells that recombinantly express the variant CBH I polypeptides.
    Type: Grant
    Filed: October 6, 2011
    Date of Patent: August 4, 2015
    Assignee: BP Corporation North America Inc.
    Inventors: Justin T. Stege, Alexander Varvak, John Poland, Chris S. Lyon, Shaun Healey, Peter Luginbuhl
  • Patent number: 9080160
    Abstract: The present invention provides isolated polypeptides having cellobiohydrolase activity and isolated polynucleotides encoding the polypeptides. The invention also provides nucleic acid constructs, vectors, and host cells comprising the polynucleotides as well as methods of producing and using the polypeptides.
    Type: Grant
    Filed: November 4, 2011
    Date of Patent: July 14, 2015
    Assignee: Novozymes, Inc.
    Inventors: Ye Liu, Lan Tang
  • Patent number: 9074231
    Abstract: A system is provided for reducing non-specific binding of an enzyme to lignin to enhance an enzymatic processing of a lignocellulosic material. The enhancements provide economic and process advantages to any process that converts a lignocellulosic biomass into a product using an enzyme. Systems are provided comprising a reaction vessel; a lignocellulosic feedstock comprising a component selected from the group consisting of a hardwood, a softwood, or a non-wood material; an enzyme component including a cellulase, a hemicellulase, or a combination thereof; and, water. The reaction vessel can contain a combination of the lignocellulosic feedstock, the water, and the enzyme component at a pH ranging from about 5.2 to about 6.2; and, the lignocellulosic feedstock can be saccharified in the reaction vessel. Moreover, the systems can include a lignosulfonate, with or without a pH of about 5.2 to about 6.2, to also reduce non-specific binding and enhance enzymatic activity.
    Type: Grant
    Filed: October 15, 2012
    Date of Patent: July 7, 2015
    Assignee: The United States of America as represented by the Secretary of Agriculture
    Inventor: JunYong Zhu