Abstract: The present invention provides a polymorphism detection probe that can identify a polymorphism in an EGFR gene easily and with high reliability and a polymorphism detection method using the probe. The probe of the present invention is a probe for detecting a polymorphism in an EGFR gene, including at least one of an oligonucleotide (P1) and an oligonucleotide (P2), wherein: (P1) is a 22- to 50-mer oligonucleotide composed of a base sequence complementary to a base sequence including 334th to 355th bases in SEQ ID NO: 1 and having a base complementary to the 334th base in its 3? end region; and (P2) is an oligonucleotide composed of a base sequence complementary to the oligonucleotide (P1).

Abstract: An oligonucleotide for a detection test of a polymorphism of EGFR exon 19, the oligonucleotide being at least one selected from the group consisting of a P1 oligonucleotide and a P1? oligonucleotide, the P1 oligonucleotide having a 3? end subjected to an extension inhibition treatment, which has an identity of at least 80% with respect to a base sequence including at least the 115th to the 123rd bases of the base sequence indicated in SEQ ID NO: 1 and has a length of from 9 to 80 bases; and the P1? oligonucleotide having a 3? end subjected to an extension inhibition treatment, which hybridizes under stringent conditions with a complementary strand of a base sequence including at least the 115th to the 123rd bases of the base sequence indicated in SEQ ID NO: 1 and having a length of from 9 to 80 bases.

Abstract: A new measurement method by which LDL cholesterol can be measured readily and precisely is provided. The measurement method is for measuring LDL cholesterol in a sample.

Abstract: A method for measuring a target object in a sample by using an oxidase, wherein the influence of dissolved oxygen in the sample can be corrected, is provided. The method comprises: obtaining measurement values by causing the target object in the sample to react with the oxidase under different conditions of two or more types; and performing a correction based on the obtained two or more measurement values and a correction method preliminarily set so as to correct the influence of dissolved oxygen in the sample.

Abstract: An analysis apparatus is an apparatus that performs electrophoresis using a microchip provided with a channel. The analysis apparatus includes a cooling unit (an electron cooling element and a driving circuit) that cools the microchip, a voltage application unit (electrodes and a power supply circuit) that applies voltage to a buffer solution filled in the channel of the microchip, an optical analysis unit (a light source, a light receiving element, and an analysis unit) that conducts, through the microchip, optical analysis of a sample introduced in the channel, and a control unit that controls the cooling unit, the voltage application unit, and the optical analysis unit. The control unit causes the cooling unit to start cooling the microchip, and after the microchip has been cooled, causes the voltage application unit and the optical analysis unit to operate.

Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.

Abstract: A measuring apparatus for measuring a predetermined physical property of a liquid measuring sample comprises a preparing unit in which a plurality of materials including at least a liquid material are mixed; a supply route which supplies the liquid material to the preparing unit; a withdrawing unit which withdraws the measuring sample from the preparing unit into the supply route, the measuring sample being prepared to contain the liquid material supplied to the preparing unit via the supply route; and a measuring unit which measures the predetermined physical property of the measuring sample withdrawn into the supply route by the withdrawing unit.

Abstract: The present invention relates to analytical apparatus comprising: a passage (45) in which an analytical tool (2) is moved from above to below; and a movement block (51), made capable of reciprocatory movement in the horizontal directions (D1, D2), for moving the analytical tool (2) incoming through the passage (45) in the direction (D1). This analytical apparatus is constructed such that, by erecting the analytical tool (2) on the movement block (51) positioned directly below the outlet (45B) of the passage (45) and causing the movement block (51) to move in the D1 or D2 direction, the analytical tool (2) is tipped over, and the analytical tool (2) is placed in a horizontal condition on the movement block (51).

Abstract: A method for recovering a metal, capable of recovering a metal easily without requiring the use of an organic medium, is provided. A complex between a chelating agent and a metal present in a sample is formed in a mixture prepared by mixing the chelating agent and the sample under pH conditions where the chelating agent can be insoluble in an aqueous medium. Then, the complex is recovered from the mixture, and further, the metal is recovered by dissolving the recovered complex in an aqueous medium under pH conditions that are different from the pH conditions where the chelating agent can be insoluble in an aqueous medium. By this method, a metal can be recovered easily without requiring the use of the use of an organic medium.

Abstract: The present invention relates to an analyzing apparatus (1) for analyzing a sample using a container (2) accommodating reagents sealed therein, while raising the temperature of the reagents up to a predetermined temperature. The analyzing apparatus (1) comprises a first temperature measuring means (31) for measuring temperature of the container (2), a second temperature measuring means (32) for measuring temperature around the container (2), a heater (4) for supplying heat energy to the container (2), and a controller for controlling the heater (4) based on a measurement result at the first and second measuring means (31, 32).

Abstract: The base plate is transmissive to terahertz waves, and a sample is disposed at the base plate. In the conductive periodic structure, plural transmission portions that transmit terahertz waves are arrayed with a predetermined period. The conductive periodic structure is disposed apart from a position at which the sample is disposed. The waveguide includes a total reflection surface provided at a boundary face with the conductive periodic structure. The total reflection surface totally reflects incident terahertz waves, and the waveguide guides incident terahertz waves toward the total reflection surface. The magnitudes of one or more of a distance between the position at which the sample is disposed and the conductive periodic structure, a property of the base plate, and the predetermined period are set such that a dip showing a characteristic absorption is formed in a predetermined frequency region of a spectrum of terahertz waves.

Abstract: The present invention provides a probe for detecting a mutation in the ALK gene, which is at least one fluorescently labeled oligonucleotide selected from the group consisting of P1 to P4, P7 and P8 oligonucleotides; an application thereof; and an oligonucleotide for the application.

Abstract: A biosensor includes a first working electrode that a biocatalyst, which has a property that reacts on a specified ground substance, is disposed, a second working electrode that the biocatalyst, which the property is lost, is disposed, and at least one counter electrode for respectively applying a voltage to the first working electrode and the second working electrode.

Abstract: An analytical device is provided that can easily determine whether analysis results are affected by drug administration for the test subject when a sample such as urine or blood is analyzed. The analytical device includes reading means capable of reading test subject identification information recorded on an information recording portion of a sample container, and data output means capable of outputting data on analysis results of a sample contained in the sample container, the analytical device further having: information acquiring means capable of acquiring, from a source external to the analytical device, drug administration information on the test subject corresponding to the test subject identification information read by the reading means, wherein when the data on analysis results of a sample are outputted by the data output means, data on the drug administration information on the test subject corresponding thereto are also outputted.

Abstract: When light beams of two different wavelengths applied from an excitation light source are made incident on a nonlinear optical crystal having a unique nonlinear coefficient, the nonlinear optical crystal generates THz waves resulting from difference frequency generation according to the nonlinear coefficient that the crystal itself has and SHG waves in which the light beams of two different wavelengths have been wavelength converted in accordance with the nonlinear coefficient. The generated THz waves pass through or are reflected from a sample and are detected by a THz detector. The SHG waves are detected by a SHG detector. A control unit acquires THz measurement values T from the THz detector, acquires SHG measurement values S from the SHG detector, and uses baseline THz measurement values TB and baseline SHG measurement values SB acquired without the sample to perform baseline correction using (T/S)/(TB/SB).

Abstract: A liquid droplet introducing tank 3A includes a tank body 31, which is formed by mutually opposing top surface 31a and bottom surface 31b, and a side surface 31c. The tank also includes an injection hole 32 that is opened in the top surface 31a. Liquid droplets Dr are injected from the injection hole 32. The center of the injection hole 32 is closer to the side surface 31c than the center of the top surface 31a. The liquid droplet introducing tank 3A enables liquid droplets to be suitably injected therein and is suitable for reducing size.

Abstract: Provided is a glucose sensor that is capable of measuring a glucose concentration even in the case where Aspergillus oryzae type FAD-GDH (flavin adenine dinucleotide-glucose dehyrogenase) and a ruthenium compound are used in combination. The glucose sensor includes an insulative substrate, an electrode system having a working electrode and a counter electrode provided on the substrate, and a reagent layer provided on the electrode system, wherein the reagent layer contains Aspergillus oryzae type FAD-GDH, a ruthenium compound, and PMS (phenazine methosulfate).

Abstract: An analyzing apparatus includes a microchip, a detecting unit and an analyzing-measuring unit. The microchip is formed of a light transmissive material formed with a separation fluid channel that is a light measuring part. The detecting unit includes an emitted-light guiding unit that emits light to the separation fluid channel, and a received-light guiding unit that receives light through the separation fluid channel. The emitted-light guiding unit or the received-light guiding unit placed at a position facing a microchip support table via the microchip abuts the microchip, and pushes the microchip in a direction toward the microchip support table. The analyzing-measuring unit includes the detecting unit, the emitted-light guiding unit and the received-light guiding unit, and detects a constituent of a sample filled in the separation fluid channel.

Abstract: A method for detecting a DNA having the mitochondrial DNA 3243 mutation is disclosed. Quantitative PCR is used with a primer having a nucleotide sequence complementary to the nucleotide sequence starting from the nucleotide number 243 in SEQ ID NO: 2 and having a length of 12 to 30 nucleotides. A method is also disclosed for detecting a DNA having the mitochondrial DNA 3243 mutation by using a nucleic acid probe which is end labeled with a fluorescent dye. The fluorescence of the fluorescent dye decreases upon hybridization. The nucleic acid probe has a nucleotide sequence complementary to the nucleotide sequence starting from nucleotide number 230 in the nucleotide sequence of SEQ ID NO: 2 and a length of 14 to 40 nucleotides. The 3? end of the probe is labeled with the fluorescent dye.