Abstract: A biosensor includes a first working electrode that a biocatalyst, which has a property that reacts on a specified ground substance, is disposed, a second working electrode that the biocatalyst, which the property is lost, is disposed, and at least one counter electrode for respectively applying a voltage to the first working electrode and the second working electrode.
Abstract: To provide a molecular probe for imaging of pancreatic islets. A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe includes any one of the following polypeptides: polypeptides represented by the following formulae (1), (5), and (9); and polypeptides having homology with the foregoing polypeptides: Z-DLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (1) Z-DLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2? (5) B-DLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2? (9) where X in the formulae (1) and (5) and B- in the formula (9) indicate that an amino group is labeled with a group represented by the formula (I) below having an aromatic ring, wherein A represents either an aromatic hydrocarbon group or an aromatic heterocyclic group, R1 represents a substituent that contains radioactive iodine, R2 represents either a hydrogen atom or a substituent different from that represented by R1, and R3 represents any one of a bond, a methylene group, and an oxymethylene group.
Abstract: The present invention provides a method for measuring a substrate concentration by accumulating an energy resulting from a reaction between a biocatalyst and a substrate recognized by the biocatalyst to a certain level; and using a dependency of an accumulation rate on the substrate concentration as an index; and a apparatus therefor. In particular, the present invention provides a method in which the measurement of the accumulation rate is carried out by measuring a frequency of an energy release in a certain amount of time when the energy accumulated in the capacitor reaches the certain level and is then released.
Type:
Grant
Filed:
July 26, 2012
Date of Patent:
February 4, 2014
Assignees:
Bioengineering Laboratories, LLC, Arkray, Inc., Ultizyme International Ltd.
Abstract: The present invention provides a method for measuring a substrate concentration by accumulating an energy resulting from a reaction between a biocatalyst and a substrate recognized by the biocatalyst to a certain level; and using a dependency of an accumulation rate on the substrate concentration as an index; and a apparatus therefor. In particular, the present invention provides a method in which the measurement of the accumulation rate is carried out by measuring a frequency of an energy release in a certain amount of time when the energy accumulated in the capacitor reaches the certain level and is then released.
Type:
Grant
Filed:
July 26, 2012
Date of Patent:
February 4, 2014
Assignees:
Bioengineering Laboratories, LLC, Arkray, Inc., Ultizyme International Ltd.
Abstract: A new method of diagnosing postprandial hyperglycemia by indirectly measuring a blood glucose level is provided. Postprandial hyperglycemia is detected by measuring a glycation degree of lysine in hemoglobin, in which a side chain amino group of lysine is glycated (GHbLys %). Measurement of GHbLys % can be performed by cleaving hemoglobin by protease, treating a glycated part of a lysine residue in the obtained cleavage product of hemoglobin with fructosyl amino acid oxidase, and measuring a redox reaction between the glycated part and fructosyl amino acid oxidase.
Abstract: A method is provided in which with respect to an optical detection apparatus including an optical detection unit and a temperature control unit, whether optical signal detection and temperature control are performed accurately, i.e. the performance thereof, can be verified simply with high reliability. With respect to an optical detection apparatus including an optical detection unit for detecting an optical signal of a sample and a temperature control unit for controlling temperature of the sample, the optical signal detection performance and temperature control performance are verified by the following method. First, a standard sample containing a nucleic acid sequence and a strand complementary thereto that have a known optical signal intensity and Tm value is provided, the temperature of the standard sample is increased or decreased with the temperature control unit, and optical signal intensity of the standard sample is measured with the detection unit.
Abstract: A probe for detecting polymorphism in the ABCG2 gene is constituted by including, for example, an oligonucleotide which is complementary to a base sequence including the 301st to the 311th bases of the base sequence indicated in SEQ ID NO:1 and having a length of from 11 bases to 50 bases, and has an identity of at least 80%, and in which a base corresponding to the 311th base has been labeled with a fluorescent dye.
Abstract: A probe for detecting polymorphism in the ABCC2 gene is constituted by including, for example, an oligonucleotide which is complementary to a base sequence including the 207th to the 217th bases of the base sequence indicated in SEQ ID NO:1 and having a length of from 11 bases to 60 bases, and has an identity of at least 80%, and in which a base corresponding to the 217th base has been labeled with a fluorescent dye.
Abstract: The present invention relates to an analytical tool (X) which includes a substrate (1), a flow path for moving a sample along the substrate (1), a reagent portion (14) provided in the flow path, and an insulating film (13) covering the substrate (1) and including an opening (15a) for defining a region for forming the reagent portion (14). The insulating film (13) further includes at least one additional opening (15b) positioned in a longitudinal direction (N1) relative to the opening (15a). For instance, the flow path is configured to move the sample by capillary force.
Abstract: A liquid chromatography apparatus having: a column that adsorbs analysis components within a specimen; a plunger pump that feeds eluent A, that elutes the analysis components adsorbed at the column, in an amount greater than or equal to an amount needed for analysis of one specimen from a cylinder portion by a one-time pushing operation of a rod; a photometric unit that analyzes analysis components eluted by eluent A; an eluent loop that holds eluent B; a liquid feeding flow path that communicates the plunger pump and the column; and a first switching valve that switches the liquid feeding flow path to either of a first flow path, that causes eluent A to flow from the plunger pump to the column, and a second flow path, that causes eluent A to flow from the plunger pump through the first eluent holding loop to the column, is provided.
Abstract: A channel bubble reduction device includes a liquid accommodation portion, that accommodates a liquid, a liquid supply apparatus that, with a pushing operation of a rod, discharges the liquid through an aperture portion of a tube portion, a first channel that connects the aperture portion of the liquid supply apparatus with the liquid accommodation portion, and an air layer formation apparatus that forms an air layer in at least one of the first channel or the tube portion.
Abstract: A bubble reduction device, chromatography device, bubble reduction method and bubble reduction program capable of reducing bubbles in an eluent. Included are a liquid accommodation portion, a liquid supply apparatus, an air layer formation apparatus, a first channel and an evacuation portion. The liquid accommodation portion accommodates a liquid that is to elute an analysis component from a specimen adsorbed to an adsorption portion. The liquid supply apparatus, by operation of a rod pushing up and polling down, sucks and discharges the liquid through an aperture portion of a tube portion, the aperture portion being oriented upward. The air layer formation apparatus forms an air layer in the tube portion. The first channel connects the liquid supply apparatus with the liquid accommodation portion. The evacuation portion is connected to the first channel via a first switching valve and evacuates the air layer through the first channel.
Abstract: A biosensor is capable of preventing a sample from flowing out of the air hole to the outside with superior accuracy. The biosensor includes: a first substrate having an air hole; and a second substrate, the first and second substrates being laminated on each other, wherein the biosensor has a sample flow path between the first and second substrates, in a sample flow direction in the flow path, an upstream end of the flow path is in communication with a sample introduction port, and a downstream end of the flow path is in communication with the air hole, an upper surface of the flow path is formed of a surface of the first substrate facing the second substrate, and a region on the introduction port side of the upper surface of the flow path is a hydrophilic region, and a region on the air hole side of the upper surface of the flow path is a water-repellent region.
Abstract: An analysis method using an analysis apparatus are described herein. By way of an example, the analysis method includes a first step of driving a pressurizing pump and a pressure-reduction pump, and of filling a liquid from a supply piping in an interior of a resistive body through which a sample passes, a second step of discharging, from a discharging piping, some of the liquid filled in the interior of the resistive body, and of securing a space in the interior of the resistive body for filling the sample, a third step of supplying the sample into the space, a fourth step of causing the sample to travel in the interior of the resistive body, and a fifth step of measuring a travel time of the sample in the interior of the resistive body by using the flow rate sensor.
Abstract: The present invention provides a colorimetric method that can perform a simple and reliable analysis in a short time. The method includes transferring an electron from an analyte to a coloring reagent that produces color by reduction via a mediator by using an oxidoreductase; and performing qualitative or quantitative analysis of the analyte by measuring color produced in the coloring reagent. The enzyme reaction of this method is a single stage reaction, and the color production reaction occurs via the mediator. Therefore, the measurement can be performed in a short time. Since this reaction requires neither hydrogen peroxide nor oxygen, the measured values are highly reliable.
Abstract: It is an object to provide a test instrument and an optical measurement apparatus which enable easy matching of test results when tests by optical measurement are performed with respect to a large number of patients. To the above end, a test instrument B is provided, which includes reagent retaining portions 8A, 8B, 8C retaining a reagent which reacts with a sample to produce a color reaction. The test instrument B includes a patient information entry section 64 as an example of patient identifying information region in which patient identifying information is to be written.
Abstract: A method for detecting a cancer cell, including: contacting in vitro a peripheral blood-containing sample including test cells and a labeling substance; allowing the test cells to incorporate the labeling substance to label the test cells; and detecting, as a cancer cell, a cell showing a higher degree of labeling with the labeling substance than that shown by a normal cell in the peripheral blood-containing sample.
Abstract: The present invention provides a probe for detecting a V600 polymorphism in the BRAF gene, which is (P1) a fluorescently labeled oligonucleotide which has an identity of at least 80% to a base sequence having a length of 10 to 50 bases including the 228th to the 237th bases of the base sequence indicated in SEQ ID NO:1, wherein the base corresponding to the 237th base is cytosine labeled with a fluorescent dye, the oligonucleotide recognizing a polymorphism in at least one of the 228th to the 230th bases of the base sequence indicated in SEQ ID NO:1 (with the proviso that the oligonucleotide is not the one indicated in SEQ ID NO:7 or 19).