Abstract: A lactate sensor capable of accurately measuring a lactate concentration in a short period of time. The lactate sensor includes an insulating substrate, an electrode system including at least a working electrode and a counter electrode provided on the substrate, and a reagent layer provided on the electrode system. The reagent layer contains lactate oxidase, it mediator, and N-(2-acetamide)-2-aminoethanesulfonic acid.

Abstract: A lancing device includes a housing, a lancing unit capable of reciprocating relative to the housing, an elastic member for causing the lancing unit to reciprocate, and a resistance generator for applying resistance to the lancing unit in motion. The reciprocating motion of the lancing unit includes a puncture section or interval and a retreat section following the puncture section. The puncture section includes a puncture point at which a lancing element of the lancing unit can prick the skin of a human subject, for example. The resistance generator is configured to apply a greater resistance to the lancing unit in the retreat section than in the puncture section.

Abstract: A continuous analysis apparatus capable of transmitting information about components in body fluid to another apparatus such as medicine dosing apparatus more correctly without giving a user displeasure. The continuous analysis apparatus according to the present invention includes a sensing unit 2 including a sensor that is held in subcutaneous tissue for obtaining information with respect to an objective substance in a sample; and a data holding unit 3 having a storage means for storing the information obtained from the sensor or data corresponding to the information, the sensing unit and the data holding unit having configuration so that they are separably joined to each other.

Abstract: Provided is a prozone phenomenon detecting method, by which generation of a prozone phenomenon can be detected even when a conventional specimen analysis tool is used, and examinations using an immunochromatography method and the like can be performed efficiently.

Abstract: Provided are an analytical instrument and an analytical method that allow for the direct analysis of a target substance in an undiluted specimen by a transmission photometry in a tightly closed cell container space. An analytical instrument is an analytical instrument for analyzing a target substance contained in a specimen flown in the tightly closed cell container by utilizing an oxidative color-developing agent and an oxidative enzyme reaction, in which an upper substrate and a lower substrate are arranged facing each other and at least a part of the upper substrate and/or at least a part of the lower substrate are/is made of a material transmitting light used for the analysis and having oxygen transmission properties.

Abstract: A method for processing a blood sample is provided that can improve the recovery rate of deformable rare cells that would easily pass through a filter and small rare cells while reducing the filtration area of the filter, and that can recover the rare cells alive.

Abstract: During execution of software, additional information can be displayed in such a manner that the additional information attracts a user's attention while being unlikely to bother the user. An electronic device includes a display panel, the display panel having a display screen and a detection unit that detects a position on the display screen that is designated with a finger or a pointing tool, and a control unit that executes software involving an output of an image to the display panel. On detecting a sliding motion of a user's finger or a pointing tool on the display panel on which the image is displayed, the control unit executes processing that is necessary in order to realize the function of the software, and in accordance with the sliding motion of the finger or the pointing tool, displays the image while sliding the image and displays additional information.

Abstract: A molecular probe for use in imaging of pancreatic islets is provided. The molecular probe comprises a polypeptide represented by the following formula (1), (2), or (3), or a polypeptide having homology with the foregoing polypeptide, (SEQ?ID?NO.?1) Z-HGEGTFTSDLSXQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(1) (SEQ?ID?NO.?2) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLXNGGPSSGAPPPS-NH2?(2) (SEQ?ID?NO.?3) B-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2?(3) where, in the formulae (1) and (2), “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a radioactive nuclide, and “Z—” indicates that an ?-amino group at an N-terminus is not modified, or is modified with a modifying group having no electric charge; in the formula (3), “B—” indicates that an ?-amino group at an N-terminus is labeled with a radioactive nuclide; and in the formulae (1), (2), and (3), “—NH2” indicates that a carboxyl group at a C-terminus is amidated.

Abstract: The base plate is transmissive to terahertz waves, and a sample is disposed at the base plate. In the conductive periodic structure, plural transmission portions that transmit terahertz waves are arrayed with a predetermined period. The conductive periodic structure is disposed apart from a position at which the sample is disposed. The waveguide includes a total reflection surface provided at a boundary face with the conductive periodic structure. The total reflection surface totally reflects incident terahertz waves, and the waveguide guides incident terahertz waves toward the total reflection surface. The magnitudes of one or more of a distance between the position at which the sample is disposed and the conductive periodic structure, a property of the base plate, and the predetermined period are set such that a dip showing a characteristic absorption is formed in a predetermined frequency region of a spectrum of terahertz waves.

Abstract: A biosensor manufacturing method including a sheet material forming process and a dicing process. In the sheet material forming process a sheet material with plural biosensor forming sections is formed. Each of the biosensor forming sections includes a first base plate, a second base plate stacked on the first base plate and forming a capillary between the second base plate and the leading end portion of the first base plate for sucking in sample liquid, and a hydrophilic layer formed on the second base plate at least in a region facing the capillary. In the dicing process plural biosensors are obtained by dicing the sheet material with a blade from the first base plate side at the leading end of each of the biosensor forming sections, such that the leading end of the capillary opens onto the leading end face of the first base plate and the second base plate.

Abstract: A modified pyrroloquinoline quinone glucose dehydrogenase that exhibits a high selectivity for glucose is provided. A modified pyrroloquinoline quinone glucose dehydrogenase is disclosed in which the amino acid residue G at Position 99 of a pyrroloquinoline quinone glucose dehydrogenase (PQQGDH) represented by SEQ ID NO: 1, or the amino acid residue G at Position 100 of the pyrroloquinoline quinone glucose dehydrogenase (PQQGDH) represented by SEQ ID NO: 3, is substituted by the amino acid sequence TGZN (where Z is SX, S, or N and X is any amino acid residue). The modified PQQGDH of the present invention may additionally comprise one or more mutations selected from the group consisting of Q192G, Q192A, or Q192S; L193X; E277X; A318X; Y367A, Y367F, or Y367W; G451C; and N452X (where X is any amino acid residue).

Abstract: Means of determining the condition of the oral cavity in a subject is provided. The condition of the oral cavity in the subject is determined by using an analytical tool comprising the following (A), (B), and (C): (A) a reagent for measuring one or more parameters that reflect the dental caries risk for a test sample obtained from the oral cavity, (B) a reagent for measuring one or more parameters that reflect the periodontal disease risk for the test sample obtained from the oral cavity, and (C) a reagent for measuring one or more parameters that reflect the degree of oral cleanliness for the test sample obtained from the oral cavity.

Abstract: An analyzing device includes a feeder connected to a container in which a sample is contained for sucking the sample from the container and feeding the sample, and a controller for performing control for feeding from the feeder to a measurer. In measuring the sample, the controller performs control so that results of a plurality of times of measurement are obtained with respect to the single container in which the sample is contained, without changing the container. This arrangement allows quick accuracy check.

Abstract: An information acquisition device 10 includes a data acquisition unit 11 acquiring measurement data from an external measuring device 20; a code reading unit 12 reading a code to acquire the information represented by the code; and a data processing unit 13 that associates the information acquired by the code reading unit 12 with the measurement data acquired by the data acquisition unit 11. Medical measuring devices used to measure patient status can be suggested as the measuring device 20. In such a case, for example, codes representing identifiers that identify patients can be used as the code.

Abstract: A portable analyzer A1 includes: hole forming means designed to form a hole 3 for insertion of a specimen sampling implement 6 therein; and analyzing means capable of analyzing a specimen when the sampling implement 6 is inserted into the hole 3, the hole forming means including a first member 1 having a first region R1 corresponding to a portion of an internal surface of the hole 3, and a second member 2 having a second region R2 corresponding to another portion of the internal surface of the hole 3. The first and second members 1 and 2 are capable of relative movement while being coupled to each other, the relative movement causing at least one of the first and second regions R1 and R2 to be exposed to outside for easy cleaning thereof.

Abstract: In the measuring equipment, a nozzle driving unit 10 equipped with a bar code reader decides whether the cartridge container being set is a special-purpose container, in which a predetermined reagent is injected separately in advance and to which a bar code is attached, or a general-purpose container that is prepared by separately injecting reagents by hand into an empty cartridge container, and when the cartridge container is a special-purpose container, a CPU 1 reads out measurement conditions from a measurement condition storage part for special-purpose reagents 3a based on the information included in the bar code, and when the cartridge container is a general-purpose container, the CPU1 reads out measurement conditions for items of a measurement object selected and input by a measurer from a measurement condition storage part for general-purpose reagents 3b to conduct a measurement.

Abstract: A monitoring device which measures numerical value information on a subject substance in a body fluid has an electrochemical sensor including a sensor unit for detecting the subject substance which is used in the way of being embedded subcutaneously and generating an electric signal correlating to the numerical value information on the subject substance, and a temperature control unit which adjusts the detected ambient temperature as a temperature ambient to a sensor unit when detecting the subject substance so as to reach a target setting temperature when measuring the subject substance.