Human receptor proteins; related reagents and methods
Nucleic acids encoding mammalian, e.g., human receptors, purified receptor proteins and fragments thereof. Antibodies, both polyclonal and monoclonal, are also provided. Methods of using the compositions for both diagnostic and therapeutic utilities are provided.
[0001] This filing is a conversion Utility Patent Application which claims priority to U.S. Ser. No. 60/065,776 filed Nov. 17, 1997; U.S. Ser. No. 60/078,008 filed Mar. 12, 1998; U.S. Ser. No. 60/081,883 filed Apr. 15, 1998; U.S. Ser. No. 60/095,987 filed Aug. 10, 1998; U.S. Ser. No. 60/078,416 filed Mar. 18, 1998; and U.S. Ser. No. 60/062,066 filed Oct. 15, 1997; each of which is incorporated herein by reference.
FIELD OF THE INVENTION[0002] The present invention relates to compositions and methods for affecting mammalian physiology, including, e.g., morphogenesis or immune system function. In particular, it provides nucleic acids, proteins, and antibodies, e.g., which regulate development and/or the immune system along with related reagents and methods. Diagnostic and therapeutic uses of these materials are also disclosed.
BACKGROUND OF THE INVENTION[0003] Recombinant DNA technology refers generally to techniques of integrating genetic information from a donor source into vectors for subsequent processing, such as through introduction into a host, whereby the transferred genetic information is copied and/or expressed in the new environment. Commonly, the genetic information exists in the form of complementary DNA (cDNA) derived from messenger RNA (mRNA) coding for a desired polypeptide product. The carrier is frequently a plasmid having the capacity to incorporate cDNA for later replication and/or expression in a host and, in some cases, actually to control expression of the cDNA and thereby direct synthesis of the encoded product in the host.
[0004] For some time, it has been known that the mammalian immune response is based on a series of complex cellular interactions, called the “immune network”. Recent research has provided new insights into the inner workings of this network. While it remains clear that much of the immune response does, in fact, revolve around the network-like interactions of lymphocytes, macrophages, granulocytes, and other cells, immunologists now generally hold the opinion that soluble proteins, known as lymphokines, cytokines, or monokines, play critical roles in controlling these cellular interactions. Thus, there is considerable interest in the isolation, characterization, and mechanisms of action of cell modulatory factors, an understanding of which will lead to significant advancements in the diagnosis and therapy of numerous medical abnormalities, e.g., immune system disorders.
[0005] Lymphokines apparently mediate cellular activities in a variety of ways. They have been shown to support the proliferation, growth, and/or differentiation of pluripotential hematopoietic stem cells into vast numbers of progenitors comprising diverse cellular lineages which make up a complex immune system. Proper and balanced interactions between the cellular components are necessary for a healthy immune response. The different cellular lineages often respond in a different manner when lymphokines are administered in conjunction with other agents.
[0006] Cell lineages especially important to the immune response include two classes of lymphocytes: B-cells, which can produce and secrete immunoglobulins (proteins with the capability of recognizing and binding to foreign matter to effect its removal), and T-cells of various subsets that secrete lymphokines and induce or suppress the B-cells and various other cells (including other T-cells) making up the immune network. These lymphocytes interact with many other cell types.
[0007] Another important cell lineage is the mast cell (which has not been positively identified in all mammalian species), which is a granule-containing connective tissue cell located proximal to capillaries throughout the body. These cells are found in especially high concentrations in the lungs, skin, and gastrointestinal and genitourinary tracts. Mast cells play a central role in allergy-related disorders, particularly anaphylaxis as follows: when selected antigens crosslink one class of immunoglobulins bound to receptors on the mast cell surface, the mast cell degranulates and releases mediators, e.g., histamine, serotonin, heparin, and prostaglandins, which cause allergic reactions, e.g., anaphylaxis.
[0008] Research to better understand and treat various immune disorders has been hampered by the general inability to maintain cells of the immune system in vitro. Immunologists have discovered that culturing many of these cells can be accomplished through the use of T-cell and other cell supernatants, which contain various growth factors, including many of the lymphokines.
[0009] The interleukin-1 family of proteins includes the IL-1&agr;, the IL-1&bgr;, the IL-1RA, and recently the IL-1&ggr; (also designated Interferon-Gamma Inducing Factor, IGIF). This related family of genes has been implicated in a broad range of biological functions. See Dinarello (1994) FASEB J. 8:1314-1325; Dinarello (1991) Blood 77:1627-1652; and Okamura, et al. (1995) Nature 378:88-91.
[0010] From the foregoing, it is evident that the discovery and development of new soluble proteins and their receptors, including ones similar to lymphokines, should contribute to new therapies. A number of degenerative or abnormal conditions directly or indirectly involve development, differentiation, or function, e.g., of the immune system and/or hematopoietic cells. In particular, the discovery and understanding of novel receptors for lymphokine-like molecules which enhance or potentiate the beneficial activities of other lymphokines, would be highly advantageous. The present invention provides new receptors for ligands exhibiting similarity to interleukin-1 like compositions and related compounds, and methods for their use.
SUMMARY OF THE INVENTION[0011] The present invention is directed to novel receptors related to IL-1 receptors and their biological activities. These receptors, e.g., primate or rodent, are designated IL-1 receptor like molecular structures, IL-1 Receptor DNAX designation 8 (IL-1RD8), IL-1 Receptor DNAX designation 9 (IL-1RD9) and IL-1 Receptor DNAX designation 10 (IL-1RD10). The invention includes nucleic acids coding for the polypeptides themselves and methods for their production and use. The nucleic acids of the invention are characterized, in part, by their homology to cloned complementary DNA (cDNA) sequences enclosed herein.
[0012] In certain embodiments, the invention provides a composition of matter selected from the group of: an isolated or recombinant IL-1RD8 polypeptide comprising a segment of at least 12 contiguous amino acids of SEQ ID NO: 2 or 4, a natural sequence IL-1RD8 polypeptide comprising SEQ ID NO: 2 or 4, a fusion protein comprising IL-1RD8 sequence; an isolated or recombinant IL-1RD9 polypeptide comprising at least 12 contiguous amino acids of SEQ ID NO: 6, 8, 10, 12, 14, or 16; a natural sequence IL-1RD9 comprising SEQ ID NO: 6, 8, 10, 12, 14, or 16; a fusion protein comprising IL-1RD9 sequence; an isolated or recombinant IL-1RD10 polypeptide comprising at least 12 contiguous amino acids of SEQ ID NO: 18, 20, or 35; a natural sequence IL-1RD10 comprising SEQ ID NO: 18, 20, or 35; and a fusion protein comprising IL-1RD10 sequence. In various embodiments, the recombinant or isolated polypeptide comprises a segment identical to a corresponding portion of an IL-1RD8, as described, wherein: the number of contiguous amino acid residues is: at least 17 amino acids; at least 21 amino acids; or at least 25 amino acids; or to a corresponding portion of an IL-1RD9, as described, wherein the number of identical contiguous amino acid residues is: at least 17 amino acids; at least 21 amino acids; or at least 25 amino acids; or of an IL-1RD10, as described, wherein the number of identical contiguous amino acid residues is: at least 17 amino acids; at least 21 amino acids;or at least 25 amino acids.
[0013] In polypeptide embodiments, the invention provides a composition of matter wherein the IL-1RD8 comprises a mature sequence of Table 1; an IL-1RD9 that comprises a mature sequence of Table 2; an IL-1RD10 that comprises a mature sequence of Table 3; or the IL-1RD8, IL-1RD9, or IL-1RD10 polypeptide: is from a warm blooded animal, e.g., a primate, such as a human; comprises at least one polypeptide segment of SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, or 35; exhibits a plurality of portions having segments identical to specific sequence identifiers; is a natural allelic variant of a primate IL-1RD8; a primate or rodent IL-1RD9; or a primate IL-1RD10; has a length at least about 30 amino acids; exhibits at least two non-overlapping epitopes that are specific for: a primate IL-1RD8, a primate or rodent IL-1RD9, or primate IL-1RD10; exhibits a sequence identity over a length of at least about 20 amino acids to: a primate IL-1RD8, a primate or rodent IL-1RD9, or a primate IL-1RD10; has a molecular weight of at least 100 kD with natural glycosylation; is a synthetic polypeptide; is attached to a solid substrate; is conjugated to another chemical moiety; is a 5-fold or less substitution from natural sequence; or is a deletion or insertion variant from a natural sequence. Certain preferred embodiments include compositions comprising: a sterile IL-1RD8, IL-1RD9, or IL-1RD10 polypeptide; or the IL-1RD8, IL-1RD9, or IL-1RD10 polypeptide and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration; a sterile IL-1RD8, IL-1RD9, or IL-1RD10 polypeptide; or the IL-1RD8, IL-1RD9, or IL-1RD10 polypeptide, as described, and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
[0014] Certain fusion proteins are provided, e.g., comprising: mature polypeptide sequence of Table 1, 2, or 3; a detection or purification tag, including a FLAG, His6, or Ig sequence; or sequence of another receptor protein. Kit embodiments include a kit comprising such a polypeptide, and: a compartment comprising the polypeptide; and/or instructions for use or disposal of reagents in the kit.
[0015] In binding compound embodiments, the invention provides a binding compound comprising an antigen binding site from an antibody, which specifically binds to a natural: IL-1RD8, IL-1RD9, or IL-1RD10 polypeptide, wherein: the polypeptide is a primate or rodent protein; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised to a polypeptide sequence of a mature polypeptide comprising sequence of Table 1, 2, or 3; is raised to a mature primate or rodent IL-1RD8; is raised to a purified human IL-1RD8; is raised to a purified mouse IL-1RD9; is immunoselected; is a polyclonal antibody; binds to a denatured IL-1RD8, IL-1RD9, or IL-1RD10; exhibits a Kd to antigen of at least 30 &mgr;M; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label; IL-1RD9 protein, wherein: the polypeptide is a primate or rodent protein; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised against a polypeptide sequence of a mature polypeptide comprising sequence of Table 1, 2, or 3; is raised against a mature primate IL-1RD9; is raised to a purified human IL-1RD9; is immunoselected; is a polyclonal antibody; binds to a denatured IL-1RD9; exhibits a Kd to antigen of at least 30 &mgr;M; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label; IL-1RD10 protein, wherein: the polypeptide is a primate or rodent protein; the binding compound is an Fv, Fab, or Fab2 fragment; the binding compound is conjugated to another chemical moiety; or the antibody: is raised against a polypeptide sequence of a mature polypeptide comprising sequence of Table 1, 2, or 3; is raised against a mature primate IL-1RD10; is raised to a purified human IL-1RD10; is immunoselected; is a polyclonal antibody; binds to a denatured IL-1RD10; exhibits a Kd to antigen of at least 30 &mgr;M; is attached to a solid substrate, including a bead or plastic membrane; is in a sterile composition; or is detectably labeled, including a radioactive or fluorescent label. Kits are provided, e.g., those comprising the binding compound, and: a compartment comprising the binding compound; and/or instructions for use or disposal of reagents in the kit. Preferably, the kit is capable of making a qualitative or quantitative analysis.
[0016] Other embodiments include a composition comprising: a sterile binding compound, or the binding compound and a carrier, wherein the carrier is: an aqueous compound, including water, saline, and/or buffer; and/or formulated for oral, rectal, nasal, topical, or parenteral administration.
[0017] Nucleic acid embodiments include an isolated or recombinant nucleic acid encoding a polypeptide or fusion protein, wherein: the IL-1RD8, IL-1RD9, or 1L-1RD10 is from a mammal; said nucleic acid: encodes an antigenic polypeptide sequence of Table 1, 2, or 3; encodes a plurality of antigenic polypeptide sequences of Table 1, 2, or 3; exhibits at least about 30 nucleotides to a natural cDNA encoding the segment; is an expression vector; further comprises an origin of replication; is from a natural source; comprises a detectable label; comprises synthetic nucleotide sequence; is less than 6 kb, preferably less than 3 kb; is from a mammal, including a primate; comprises a natural full length coding sequence; is a hybridization probe for a gene encoding said IL-1RD8, IL-1RD9, or IL-1RD10; comprises a plurality of nonoverlapping segments of at least 15, 18, 21, or 25 nucleotides from Table 1, 2, or 3; or is a PCR primer, PCR product, or mutagenesis primer. The invention further provides a cell comprising such a recombinant nucleic acid, e.g., where the cell is: a prokaryotic cell; a eukaryotic cell; a bacterial cell; a yeast cell; an insect cell; a mammalian cell; a mouse cell; a primate cell; or a human cell. Certain kit embodiments include a comprising the nucleic acid, and: a compartment comprising the nucleic acid; a compartment further comprising: a primate IL-1RD8, a primate or rodent IL-1RD9, or a primate IL-1RD10 polypeptide; and/or instructions for use or disposal of reagents in the kit. Preferably, the kit is capable of making a qualitative or quantitative analysis.
[0018] In other nucleic acid embodiments, the nucleic acid is one which: hybridizes under wash conditions of 40° C. and less than 2M salt to either SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, or 34; or exhibits identity over a stretch of at least about 30 nucleotides to a primate IL-1RD8, a primate or rodent IL-1RD9, or a primate IL-1RD10. In various preferred embodiments: the wash conditions are: at 45° C. and/or 500 mM salt; at 55° C. and/or 150 mM salt; or the stretch is at least 55 nucleotides; or at least 75 nucleotides.
[0019] Methods of modulating physiology or development of a cell or tissue culture cells are provided, e.g., comprising contacting the cell with an agonist or antagonist of a primate IL-1RD8, a primate or rodent IL-1RD9, or a primate IL-1RD10. Preferably, the cell is transformed with a nucleic acid encoding either IL-1RD8, IL-1RD9, or IL-1RD10, and another IL-1R.
DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS[0020] OUTLINE
[0021] I. General
[0022] II. Activities
[0023] III. Nucleic acids
[0024] A. encoding fragments, sequence, probes
[0025] B. mutations, chimeras, fusions
[0026] C. making nucleic acids
[0027] D. vectors, cells comprising
[0028] IV. Proteins, Peptides
[0029] A. fragments, sequence, immunogens, antigens
[0030] B. muteins
[0031] C. agonists/antagonists, functional equivalents
[0032] D. making proteins
[0033] V. Making nucleic acids, proteins
[0034] A. synthetic
[0035] B. recombinant
[0036] C. natural sources
[0037] VI. Antibodies
[0038] A. polyclonals
[0039] B. monoclonal
[0040] C. fragments; Kd
[0041] D. anti-idiotypic antibodies
[0042] E. hybridoma cell lines
[0043] VII. Kits and Methods to quantify IL-1Rs
[0044] A. ELISA
[0045] B. assay mRNA encoding
[0046] C. qualitative/quantitative
[0047] D. kits
[0048] VIII. Therapeutic compositions, methods
[0049] A. combination compositions
[0050] B. unit dose
[0051] C. administration
[0052] IX. Ligands
[0053] I. General
[0054] The present invention provides the amino acid sequence and DNA sequence of mammalian, herein, e.g., primate and rodent IL-1 receptor-like molecules, these molecules IL-1 Receptor DNAX designation 8 (IL-1RD8), IL-1 Receptor DNAX designation 9 (IL-1RD9) and IL-1 Receptor DNAX designation 10 (IL-1RD10) having particular defined properties, both structural and/or biological. These embodiments increase the number of members of the human IL-1 receptor-like family from 7 to at least 10. These receptors have been numbered internally as DNAX designations D1, D2, D3, D4, D5, D6, and now D8, D9, and D10, and are referred to as IL-1RD1 through D10. Various cDNAs encoding these molecules were obtained from primate, e.g., human, or rodent, e.g., mouse, cDNA sequence libraries. Other primate, rodent, or other mammalian counterparts would also be desired.
[0055] Some of the standard methods applicable are described or referenced, e.g., in Maniatis, et al. (1982) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor Press; Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual, (2d ed.), vols. 1-3, CSH Press, NY; Ausubel, et al. Biology, Greene Publishing Associates, Brooklyn, N.Y.; or Ausubel, et al. (1987 and periodic supplements) Current Protocols in Molecular Biology, Greene/Wiley, New York; each of which is incorporated herein by reference.
[0056] A partial nucleotide (SEQ ID NO: 1) and corresponding amino acid sequence (SEQ ID NO: 2) of a human IL-1RD8 coding segment is shown in Table 1. Supplemental human IL-1RD8 sequence is provided in SEQ ID NO: 3 and 4.
[0057] Similarly for primate IL-1RD9, partial nucleotide (SEQ ID NO: 5) and corresponding amino acid sequence (SEQ ID NO: 6) of a primate IL-1RD9 coding segment are provided. Supplemental primate IL-1RD9 is provided in SEQ ID NO: 7, 8, 9, and 10. Rodent embodiments of IL-1RD9 are provided in SEQ ID NO: 11, 12, with supplemental IL-1RD9 rodent sequence in SEQ ID NO: 13, 14, 15, and 16.
[0058] For an embodiment of primate, e.g., human, IL-1RD10, a partial nucleotide (SEQ ID NO: 17) and corresponding partial amino acid sequence (SEQ ID NO: 18) are provided in Table 3, with supplemental primate IL-1RD10 sequence provided in SEQ ID NO: 19, 20, 34, and 35.
[0059] Some sequences provided lack some portions of these receptors, as suggested by alignment of sequences (see Table 4). Note the alignment of IL-1RD10 with IL-1RD8 and D3s, which are alpha type receptor subunits, in Table 4. Table 4 also exhibits alignment of primate and rodent IL-1RD9.
[0060] It is to be understood that this invention is not limited to the particular methods, compositions and receptors specifically embodied herein, as such methods, compositions and receptors may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention which is only limited by the appended claims.
[0061] As used herein, including the appended claims, singular forms of words such as “a,” “an,” and “the” include their corresponding plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “an organism” includes one or more different organisms, reference to “a cell” includes one or more of such cells, and reference to “a method” includes reference to equivalent steps and methods known to a person of ordinary skill in the art, and so forth.
[0062] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art to which this invention belongs. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present invention, suitable methods and materials are described below. All publications, patent applications, patents, and other references discussed above are provided solely for their disclosure prior to the filing date of the present application. Nothing herein is to be construed as an admission that the invention is not entitled to antedate any such disclosure by virtue of its prior invention. All publications, patent applications, patents, and other references mentioned herein are incorporated by reference in their entirety including all figures, graphs, and drawings. 1 TABLE 1 Nucleotide and amino acid sequences (see SEQ ID NO: 1 and 2) of a primate, e.g., human, IL-1 receptor like embodiment DNAX designated 8 (IL-1RD8). TTA CTG CTC ACA CTA TTA GTG TCA ACA ATG CTC ACT GTA TCT TAT ACC 48 Leu Leu Leu Thr Leu Leu Val Ser Thr Met Leu Thr Val Ser Tyr Thr 1 5 10 15 TCT TCT GAT TTT CTT TCA GTG GAT GGC TGC ATT GAC TGG TCA GTG GAT 96 Ser Ser Asp Phe Leu Ser Val Asp Gly Cys Ile Asp Trp Ser Val Asp 20 25 30 CTC AAG ACA TAC ATG GCT TTG GCA GGT GAA CCA GTC CGA GTG AAA TGT 144 Leu Lys Thr Tyr Met Ala Leu Ala Gly Glu Pro Val Arg Val Lys Cys 35 40 45 GCC CTT TTC TAC AGT TAT ATT CGT ACC AAC TAT AGC ACG GCC CAG AGC 192 Ala Leu Phe Tyr Ser Tyr Ile Arg Thr Asn Tyr Ser Thr Ala Gln Ser 50 55 60 ACT GGG CTC AGG CTT ATG TGG TAC AAA AAC AAA GGT GAT TTG GAA GAG 240 Thr Gly Leu Arg Leu Met Trp Tyr Lys Asn Lys Gly Asp Leu Glu Glu 65 70 75 80 CCC ATC ATC TTT TCA GAG GTC AGG ATG AGC AAA GAG GAA GAT TCA ATA 288 Pro Ile Ile Phe Ser Glu Val Arg Met Ser Lys Glu Glu Asp Ser Ile 85 90 95 TGG TTT CAC TCA GCT GAG GCA CAA GAC AGT GGA TTC TAC ACT TGT GTT 336 Trp Phe His Ser Ala Glu Ala Gln Asp Ser Gly Phe Tyr Thr Cys Val 100 105 110 TTA AGG AAC TCA ACA TAT TGC ATG AAG GTG TCA ATG TCC TTG ACT GTT 384 Leu Arg Asn Ser Thr Tyr Cys Met Lys Val Ser Met Ser Leu Thr Val 115 120 125 GCA GAG AAT GAA TCA GGC CTG TGC TAC AAC AGC AGG ATC CGC TAT TTA 432 Ala Glu Asn Glu Ser Gly Leu Cys Tyr Asn Ser Arg Ile Arg Tyr Leu 130 135 140 GAA AAA TCT GAA GTC ACT AAA AGA AAG GAG ATC TCC TGT CCA GAC ATG 480 Glu Lys Ser Glu Val Thr Lys Arg Lys Glu Ile Ser Cys Pro Asp Met 145 150 155 160 GAT GAC TTT AAA AAG TCC GAT CAG GAG CCT GAT GTT GTG TGG TAT AAG 528 Asp Asp Phe Lys Lys Ser Asp Gln Glu Pro Asp Val Val Trp Tyr Lys 165 170 175 GAA TGC AAG CCA AAA ATG TGG AGA AGC ATA ATA ATA CAG AAA GGA AAT 576 Glu Cys Lys Pro Lys Met Trp Arg Ser Ile Ile Ile Gln Lys Gly Asn 180 185 190 GCT CTT CTG ATC CAA GAA GTT CAA GAA GAA GAT GGA GGA AAT TAC ACA 624 Ala Leu Leu Ile Gln Glu Val Gln Glu Glu Asp Gly Gly Asn Tyr Thr 195 200 205 TGT GAA CTT AAA TAT GAA GGA AAA CTT GTA AGA CGA ACA ACT GAA TTG 672 Cys Glu Leu Lys Tyr Glu Gly Lys Leu Val Arg Arg Thr Thr Glu Leu 210 215 220 AAA GTT ACA GCT TTA CTC ACA GAC AAG CCT CCC AAG CCA TTG TTC CCC 720 Lys Val Thr Ala Leu Leu Thr Asp Lys Pro Pro Lys Pro Leu Phe Pro 225 230 235 240 ATG GAG AAT CAG CGA AGT GTT ATA GAT GTC GAG CTG GGT AAG CCT CTG 768 Met Glu Asn Gln Pro Ser Val Ile Asp Val Gln Leu Gly Lys Pro Leu 245 250 255 AAC ATC CCC TGC AAA GCA TTC TTC GGA TTC AGT GGA GAG TCT GGG CCA 816 Asn Ile Pro Cys Lys Ala Phe Phe Gly Phe Ser Gly Glu Ser Gly Pro 260 265 270 ATG ATC TAC TGG ATG AAA GGA GAA AAG TTT ATT GAA GAA CTG GCA GGT 864 Met Ile Tyr Trp Met Lys Gly Glu Lys Phe Ile Glu Glu Leu Ala Gly 275 280 285 CAC ATT AGA GAA GGT GAA ATA AGG CTT CTC AAA GAG CAT CTT GGA GAA 912 His Ile Arg Glu Gly Glu Ile Arg Leu Leu Lys Glu His Leu Gly Glu 290 295 300 AAA GAA GTT GAA TTG GCA CTC ATC TTT GAC TCA GTT GTG GAA GCT GAC 960 Lys Glu Val Glu Leu Ala Leu Ile Phe Asp Ser Val Val Glu Ala Asp 305 310 315 320 CTG GCG AAT TAT ACC TGC CAT GTT GAA AAC CGA AAT GGA CGG AAA CAT 1008 Leu Ala Asn Tyr Thr Cys His Val Glu Asn Arg Asn Gly Arg Lys His 325 330 335 GCC AGT GTT TTG CTG CGT AAA AAG GAT TTA ATC TAT AAA ATT GAG CTT 1056 Ala Ser Val Leu Leu Arg Lys Lys Asp Leu Ile Tyr Lys Ile Glu Leu 340 345 350 GCA GGG GGC CTG GGA GCA ATC TTC CTC CTC CTT GTA GTG CTG GTG GTC 1104 Ala Gly Gly Leu Gly Ala Ile Phe Leu Leu Leu Val Leu Leu Val Val 355 360 365 ATT TAC AAA TGC TAC AAC ATT GAA TTG ATG CTC TTC TAC AGG CAG CAC 1152 Ile Tyr Lys Cys Tyr Asn Ile Glu Leu Met Leu Phe Tyr Arg Gln His 370 375 380 TTT GGA GCT GAT GAA ACT AAT GAT GAC AAC AAG GAA TAT GAT GCC TAT 1200 Phe Gly Ala Asp Glu Thr Asn Asp Asp Asn Lys Glu Tyr Asp Ala Tyr 385 390 395 400 CTC TCT TAC ACA AAA GTG GAC CAA GAT ACT TTA GAC TGT GAC AAT CCT 1248 Leu Ser Tyr Thr Lys Val Asp Gln Asp Thr Leu Asp Cys Asp Asn Pro 405 410 415 GAA GAA GAG CAG TTT GCT CTT GAA GTA CTG CCA GAT GTC CTG GAA AAA 1296 Glu Glu Glu Gln Phe Ala Leu Glu Val Leu Pro Asp Val Leu Glu Lys 420 425 430 CAC TAT GGA TAT AAA CTC TTC ATC CCA GAA AGA GAC CTG ATT CCA AGT 1344 His Tyr Gly Tyr Lys Leu Phe Ile Pro Glu Arg Asp Leu Ile Pro Ser 435 440 445 GGA AGT GCA TAC ATG GAA GAT CTC ACA AGA TAT GTT GAA CAA AGC AGA 1392 Gly Ser Ala Tyr Met Glu Asp Leu Thr Arg Tyr Val Glu Gln Ser Arg 450 455 460 AGA CTT ATT ATC GTG CTA ACT CCA GAC TAT ATT CTC AGA CGG GGA TGG 1440 Arg Leu Ile Ile Val Leu Thr Pro Asp Tyr Ile Leu Arg Arg Gly Trp 465 470 475 480 AGT ATT TTC GAA CTG GAA AGC AGA CTC CAT AAC ATG CTA GTC AGT GGA 1488 Ser Ile Phe Glu Leu Glu Ser Arg Leu His Asn Met Leu Val Ser Gly 485 490 495 GAA ATC AAA GTG ATT TTG ATT GAG TGT ACA GAA TTA AAA GGG AAA GTG 1536 Glu Ile Lys Val Ile Leu Ile Glu Cys Thr Glu Leu Lys Gly Lys Val 500 505 510 AAT TGC CAG GAA GTG GAA TCA CTA AAG CGT AGC ATC AAA CTT CTG TCC 1584 Asn Cys Gln Glu Val Glu Ser Leu Lys Arg Ser Ile Lys Leu Leu Ser 515 520 525 CTG ATC AAG TGG AAG GGA TCC AAA AGC AGC AAA TTA AAT TCT AAG TTT 1632 Leu Ile Lys Trp Lys Gly Ser Lys Ser Ser Lys Leu Asn Ser Lys Phe 530 535 540 TGG AAG CAC TTA GTA TAT GAA ATG CCC ATC AAG AAA AAA GAA ATG CTA 1680 Trp Lys His Leu Val Tyr Glu Met Pro Ile Lys Lys Lys Glu Met Leu 545 550 555 560 CCT CGG TGC CAT GTT CTG GAC TCC GCA GAA CAA GGA CTT TTT GGA GAA 1728 Pro Arg Cys His Val Leu Asp Ser Ala Glu Gln Gly Leu Phe Gly Glu 565 570 575 CTC CAG CCT 1737 Leu Gln Pro Updated and corrected nucleotide and amino acid sequences of primate, e.g., human, IL-1RD8 (SEQ ID NO: 3 and 4). ATG AAG CCA CCA TTT CTT TTG GCC CTT GTG GTC TGT TCT GTA GTC AGC 48 Met Lys Pro Pro Phe Leu Leu Ala Leu Val Val Cys Ser Val Val Ser 1 5 10 15 ACA AAT CTG AAG ATG GTG TCA AAG AGA AAT TCT GTG GAT GGC TGC ATT 96 Thr Asn Leu Lys Met Val Ser Lys Arg Asn Ser Val Asp Gly Cys Ile 20 25 30 GAC TGG TCA GTG GAT CTC AAG ACA TAC ATG GCT TTG GCA GGT GAA CCA 144 Asp Trp Ser Val Asp Leu Lys Thr Tyr Met Ala Leu Ala Gly Glu Pro 35 40 45 GTC CGA GTG AAA TGT GCC CTT TTC TAC AGT TAT ATT CGT ACC AAC TAT 192 Val Arg Val Lys Cys Ala Leu Phe Tyr Ser Tyr Ile Arg Thr Asn Tyr 50 55 60 AGC ACG GCC CAG AGC ACT GGG CTC AGG CTT ATG TGG TAC AAA AAC AAA 240 Ser Thr Ala Gln Ser Thr Gly Leu Arg Leu Met Trp Tyr Lys Asn Lys 65 70 75 80 GGT GAT TTG GAA GAG CCC ATC ATC TTT TCA GAG GTC AGG ATG AGC AAA 288 Gly Asp Leu Glu Glu Pro Ile Ile Phe Ser Glu Val Arg Met Ser Lys 85 90 95 GAG GAA GAT TCA ATA TGG TTT CAC TCA GCT GAG GCA CAA GAC AGT GGA 336 Glu Glu Asp Ser Ile Trp Phe His Ser Ala Glu Ala Gln Asp Ser Gly 100 105 110 TTC TAC ACT TGT GTT TTA AGG AAC TCA ACA TAT TGC ATG AAG GTG TCA 384 Phe Tyr Thr Cys Val Leu Arg Asn Ser Thr Tyr Cys Met Lys Val Ser 115 120 125 ATG TCC TTG ACT GTT GCA GAG AAT GAA TCA GGC CTG TGC TAC AAC AGC 432 Met Ser Leu Thr Val Ala Glu Asn Glu Ser Gly Leu Cys Tyr Asn Ser 130 135 140 AGG ATC CGC TAT TTA GAA AAA TCT GAA GTC ACT AAA AGA AAG GAG ATC 480 Arg Ile Arg Tyr Leu Glu Lys Ser Glu Val Thr Lys Arg Lys Glu Ile 145 150 155 160 TCC TGT CCA GAC ATG GAT GAC TTT AAA AAG TCC GAT CAG GAG CCT GAT 528 Ser Cys Pro Asp Met Asp Asp Phe Lys Lys Ser Asp Gln Glu Pro Asp 165 170 175 GTT GTG TGG TAT AAG GAA TGC AAG CCA AAA ATG TGG AGA AGC ATA ATA 576 Val Val Trp Tyr Lys Glu Cys Lys Pro Lys Met Trp Arg Ser Ile Ile 180 185 190 ATA CAG AAA GGA AAT GCT CTT CTG ATC CAA GAA GTT CAA GAA GAA GAT 624 Ile Gln Lys Gly Asn Ala Leu Leu Ile Gln Glu Val Gln Glu Glu Asp 195 200 205 GGA GGA AAT TAC ACA TGT GAA CTT AAA TAT GAA GGA AAA CTT GTA AGA 672 Gly Gly Asn Tyr Thr Cys Glu Leu Lys Tyr Glu Gly Lys Leu Val Arg 210 215 220 CGA ACA ACT GAA TTG AAA GTT ACA GCT TTA CTC ACA GAC AAG CCT CCC 720 Arg Thr Thr Glu Leu Lys Val Thr Ala Leu Leu Thr Asp Lys Pro Pro 225 230 235 240 AAG CCA TTG TTC CCC ATG GAG AAT CAG CCA AGT GTT ATA GAT GTC CAG 768 Lys Pro Leu Phe Pro Met Glu Asn Gln Pro Ser Val Ile Asp Val Gln 245 250 255 CTG GGT AAG CCT CTG AAC ATC CCC TGC AAA GCA TTC TTC GGA TTC AGT 816 Leu Gly Lys Pro Leu Asn Ile Pro Cys Lys Ala Phe Phe Gly Phe Ser 260 265 270 GGA GAG TCT GGG CCA ATG ATC TAC TGG ATG AAA GGA GAA AAG TTT ATT 864 Gly Glu Ser Gly Pro Met Ile Tyr Trp Met Lys Gly Glu Lys Phe Ile 275 280 285 GAA GAA CTG GCA GGT CAC ATT AGA GAA GGT GAA ATA AGG CTT CTC AAA 912 Glu Glu Leu Ala Gly His Ile Arg Glu Gly Glu Ile Arg Leu Leu Lys 290 295 300 GAG CAT CTT GGA GAA AAA GAA GTT GAA TTG GCA CTC ATC TTT GAC TCA 960 Glu His Leu Gly Glu Lys Glu Val Glu Leu Ala Leu Ile Phe Asp Ser 305 310 315 320 GTT GTG GAA GCT GAC CTG GCG AAT TAT ACC TGC CAT GTT GAA AAC CGA 1008 Val Val Glu Ala Asp Leu Ala Asn Tyr Thr Cys His Val Glu Asn Arg 325 330 335 AAT GGA CGG AAA CAT GCC AGT GTT TTG CTG CGT AAA AAG GAT TTA ATC 1056 Asn Gly Arg Lys His Ala Ser Val Leu Leu Arg Lys Lys Asp Leu Ile 340 345 350 TAT AAA ATT GAG CTT GCA GGG GGC CTG GGA GCA ATC TTC CTC CTC CTT 1104 Tyr Lys Ile Glu Leu Ala Gly Gly Leu Gly Ala Ile Phe Leu Leu Leu 355 360 365 GTA CTG CTG GTG GTC ATT TAC AAA TGC TAC AAC ATT GAA TTG ATG CTC 1152 Val Leu Leu Val Val Ile Tyr Lys Cys Tyr Asn Ile Glu Leu Met Leu 370 375 380 TTC TAC AGG CAG CAC TTT GGA GCT GAT GAA ACT AAT GAT GAC AAC AAG 1200 Phe Tyr Arg Gln His Phe Gly Ala Asp Glu Thr Asn Asp Asp Asn Lys 385 390 395 400 GAA TAT GAT GCC TAT CTC TCT TAC ACA AAA GTG GAC CAA GAT ACT TTA 1248 Glu Tyr Asp Ala Tyr Leu Ser Tyr Thr Lys Val Asp Gln Asp Thr Leu 405 410 415 GAC TGT GAC AAT CCT GAA GAA GAG CAG TTT GCT CTT GAA GTA CTG CCA 1296 Asp Cys Asp Asn Pro Glu Glu Glu Gln Phe Ala Leu Glu Val Leu Pro 420 425 430 GAT GTC CTG GAA AAA CAC TAT GGA TAT AAA CTC TTC ATC CCA GAA AGA 1344 Asp Val Leu Glu Lys His Tyr Gly Tyr Lys Leu Phe Ile Pro Glu Arg 435 440 445 GAC CTG ATT CCA AGT GGA ACA TAC ATG GAA GAT CTC ACA AGA TAT GTT 1392 Asp Leu Ile Pro Ser Gly Thr Tyr Met Glu Asp Leu Thr Arg Tyr Val 450 455 460 GAA CAA AGC AGA AGA CTT ATT ATC GTG CTA ACT CCA GAC TAT ATT CTC 1440 Glu Gln Ser Arg Arg Leu Ile Ile Val Leu Thr Pro Asp Tyr Ile Leu 465 470 475 480 AGA CGG GGA TGG AGT ATT TTC GAA CTG GAA AGC AGA CTC CAT AAC ATG 1488 Arg Arg Gly Trp Ser Ile Phe Glu Leu Glu Ser Arg Leu His Asn Met 485 490 495 CTA GTC AGT GGA GAA ATC AAA GTG ATT TTG ATT GAG TGT ACA GAA TTA 1536 Leu Val Ser Gly Glu Ile Lys Val Ile Leu Ile Glu Cys Thr Glu Leu 500 505 510 AAA GGG AAA GTG AAT TGC CAG GAA GTG GAA TCA CTA AAG CGT AGC ATC 1584 Lys Gly Lys Val Asn Cys Gln Glu Val Glu Ser Leu Lys Arg Ser Ile 515 520 525 AAA CTT CTG TCC CTG ATC AAG TGG AAG GGA TCC AAA AGC AGC AAA TTA 1632 Lys Leu Leu Ser Leu Ile Lys Trp Lys Gly Ser Lys Ser Ser Lys Leu 530 535 540 AAT TCT AAG TTT TGG AAG CAC TTA GTA TAT GAA ATG CCC ATC AAG AAA 1680 Asn Ser Lys Phe Trp Lys His Leu Val Tyr Glu Met Pro Ile Lys Lys 545 550 555 560 AAA GAA ATG CTA CCT CGG TGC CAT GTT CTG GAC TCC GCA GAA CAA GGA 1728 Lys Glu Met Leu Pro Arg Cys His Val Leu Asp Ser Ala Glu Gln Gly 565 570 575 CTT TTT GGA GAA CTC CAG CCT ATA CCC TCT ATT GCC ATG ACC AGT ACT 1776 Leu Phe Gly Glu Leu Gln Pro Ile Pro Ser Ile Ala Met Thr Ser Thr 580 585 590 TCA GCC ACT CTG GTG TCA TCT CAG GCT GAT CTC CCT GAA TTC CAC CCT 1824 Ser Ala Thr Leu Val Ser Ser Gln Ala Asp Leu Pro Glu Phe His Pro 595 600 605 TCA GAT TCA ATG CAA ATC AGG CAC TGT TGC AGA GGT TAT AAA CAT GAG 1872 Ser Asp Ser Met Gln Ile Arg His Cys Cys Arg Gly Tyr Lys His Glu 610 615 620 ATA CCA GCC ACG ACC TTG CCA GTA CCT TCC TTA GGC AAC CAC CAT ACT 1920 Ile Pro Ala Thr Thr Leu Pro Val Pro Ser Leu Gly Asn His His Thr 625 630 635 640 TAT TGT AAC CTG CCT CTG ACG CTA CTC AAC GGA CAG CTA CCC CTT AAT 1968 Tyr Cys Asn Leu Pro Leu Thr Leu Leu Asn Gly Gln Leu Pro Leu Asn 645 650 655 AAC ACC CTG AAA GAT ACC CAG GAA TTT CAC AGG AAC AGT TCT TTG CTG 2016 Asn Thr Leu Lys Asp Thr Gln Glu Phe His Arg Asn Ser Ser Leu Leu 660 665 670 CCT TTA TCC TCC AAA GAG CTT AGC TTT ACC AGT GAT ATT TGG 2058 Pro Leu Ser Ser Lys Glu Leu Ser Phe Thr Ser Asp Ile Trp 675 680 685 TAG 2061
[0063] 2 TABLE 2 Nucleotide and amino acid sequences (see SEQ ID NO: 5 and 6) of primate, e.g., human, IL-1 receptor like embodiment DNAX designation 9 (IL-1RD9). Nucleotides 9, 459, 462, 469, and 474 are designated C, but may be A, C, G, or T. Nucleotide 246 is designated C, but may be C or G. Nucleotides 321, 336, 360, and 423 are designated C, but may be C or T. Nucleotide 426 is designated C, but may be A or C. AAA TAT GGC TAT AGC CTG TTT TTC CTT GAA AGA AAT GTG GCT CCA GGA 48 Lys Tyr Gly Tyr Ser Leu Phe Phe Leu Glu Arg Asn Val Ala Pro Gly 1 5 10 15 GGA GTG TAT GCA GAA GAC ATT GTA AGC ATT ATT AAG AGA AGC AGA AGA 96 Gly Val Tyr Ala Glu Asp Ile Val Ser Ile Ile Lys Arg Ser Arg Arg 20 25 30 GGA ATA TTT ATC TTA ACC CCC AAC TAT GTC AAT GGA CCC AGT ATC TTT 144 Gly Ile Phe Ile Leu Thr Pro Asn Tyr Val Asn Gly Pro Ser Ile Phe 35 40 45 GAA CTA GAA GCA GCA GTG AAT CTT GCC TTG GAT GAT CAA ACA CTG AAA 192 Glu Leu Gln Ala Ala Val Asn Leu Ala Leu Asp Asp Gln Thr Leu Lys 50 55 60 CTC ATT TTA ATT AAG TTC TGT TAC TTC CAA GAG CCA GAG TCT CTA CCT 240 Leu Ile Leu Ile Lys Phe Cys Tyr Phe Gln Glu Pro Glu Ser Leu Pro 65 70 75 80 CAT CTC GTG AAA AAA GCT CTC AGG GTT TTG CCC ACA GTT ACT TGG AGA 288 His Leu Val Lys Lys Ala Leu Arg Val Leu Pro Thr Val Thr Trp Arg 85 90 95 GGC TTA AAA TCA GTT CCT CCC AAT TCT AGG TTC TGG GCC AAA ATG CGC 336 Gly Leu Lys Ser Val Pro Pro Asn Ser Arg Phe Trp Ala Lys Met Arg 100 105 110 TAC CAC ATG CCT GTG AAA AAT CTC TCA GGG ATT CAC GTG GGA ACC AGC 384 Tyr His Met Pro Val Lys Asn Leu Ser Gly Ile His Val Gly Thr Ser 115 120 125 TCC AGA ATT ACC TCT AGG GAT TTT TTC AGT GGA AAG GAC TCC GTA GAA 432 Ser Arg Ile Thr Ser Arg Asp Phe Phe Ser Gly Lys Asp Ser Val Glu 130 135 140 CAG AAA CCA TGG GGA GGA GCT CCC AGC CTC AAG GGA CGG TGC AAT GAG 480 Gln Lys Pro Trp Gly Gly Ala Pro Ser Leu Lys Gly Arg Cys Asn Glu 145 150 155 160 CC 482 KYGYSLFFLERNVAPGGVYAEDIVSIIKRSRRGIFILTPNYVNGPSIFELQAAVNLALDDQTLKLILIK FCYFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNSRFWAKMRYHMPVKNLSGIHVGTSSRITSRDFFS GKDSVEQKPWGGAP?LKG??NE Supplemental sequence of primate, e.g., human, IL-1RD9 (SEQ ID NO: 7 and 8). TTT CCT AGG AGC CCC TAT GAT GTA GCC TGT TGT GTC AAG ATG ATT TTA 48 Phe Pro Arg Ser Pro Tyr Asp Val Ala Cys Cys Val Lys Met Ile Leu 1 5 10 15 GAA GTT AAG CCC CAG ACA AAT GCA TCC TGT GAG TAT TCC GCA TCA CAT 96 Glu Val Lys Pro Gln Thr Asn Ala Ser Cys Glu Tyr Ser Ala Ser His 20 25 30 AAG CAA GAC CTA CTT CTT GGG AGC ACT GGC TCT ATT TCT TGC CCC AGT 144 Lys Gln Asp Leu Leu Leu Gly Ser Thr Gly Ser Ile Ser Cys Pro Ser 35 40 45 CTC AGC TGC CAA AGT GAT GCA CAA AGT CCA GCG GTA ACC TGG TAC AAG 192 Leu Ser Cys Gln Ser Asp Ala Gln Ser Pro Ala Val Thr Trp Tyr Lys 50 55 60 AAT GGA AAA CTC CTC TCT GTG GAA AGG AGC AAC CGA ATC GTA GTG GAT 240 Asn Gly Lys Leu Leu Ser Val Glu Arg Ser Asn Arg Ile Val Val Asp 65 70 75 80 GAA GTT TAT GAC TAT CAC CAG GGC ACA TAT GTA TGT GAT TAC ACT CAG 288 Glu Val Tyr Asp Tyr His Gln Gly Thr Tyr Val Cys Asp Tyr Thr Gln 85 90 95 TCG GAT ACT GTG AGT TCG TGG ACA GTC AGA GCT GTT GTT CAA GTG AGA 336 Ser Asp Thr Val Ser Ser Trp Thr Val Arg Ala Val Val Gln Val Arg 100 105 110 ACC ATT GTG GGA GAC ACT AAA CTC AAA CCA GAT ATT CTG GAT CCT GTC 384 Thr Ile Val Gly Asp Thr Lys Leu Lys Pro Asp Ile Leu Asp Pro Val 115 120 125 GAG GAC ACA CTG GAA GTA GAA CTT GGA AAG CCT TTA ACT ATT AGC TGC 432 Glu Asp Thr Leu Glu Val Glu Leu Gly Lys Pro Leu Thr Ile Ser Cys 130 135 140 AAA GCA CGA TTT GGC TTT GAA AGG GTC TTT AAC CCT GTC ATA AAA TGG 480 Lys Ala Arg Phe Gly Phe Glu Arg Val Phe Asn Pro Val Ile Lys Trp 145 150 155 160 TAC ATC AAA GAT TCT GAC CTA GAG TGG GAA GTC TCA GTA CCT GAG GCG 528 Tyr Ile Lys Asp Ser Asp Leu Glu Trp Glu Val Ser Val Pro Glu Ala 165 170 175 AAA AGT ATT AAA TCC ACT TTA AAG GAT GAA ATC ATT GAG CGT AAT ATC 576 Lys Ser Ile Lys Ser Thr Leu Lys Asp Glu Ile Ile Glu Arg Asn Ile 180 185 190 ATC TTG GAA AAA GTC ACT CAG CGT GAT CTT CGC AGG AAG TTT GTT TGC 624 Ile Leu Glu Lys Val Thr Gln Arg Asp Leu Arg Arg Lys Phe Val Cys 195 200 205 TTT GTC CAG AAC TCC ATT GGA AAC ACA ACC CAG TCC GTC CAA CTG AAA 672 Phe Val Gln Asn Ser Ile Gly Asn Thr Thr Gln Ser Val Gln Leu Lys 210 215 220 GAA AAG AGA GGA GTG GTG CTC CTG TAC ATC CTG CTT GGC ACC ATC GGG 720 Glu Lys Arg Gly Val Val Leu Leu Tyr Ile Leu Leu Gly Thr Ile Gly 225 230 235 240 ACC CTG GTG GCC GTG CTG GCG GCG AGT GCC CTC CTC TAC AGG CAC TGG 768 Thr Leu Val Ala Val Leu Ala Ala Ser Ala Leu Leu Tyr Arg His Trp 245 250 255 ATT GAA ATA GTG CTG CTG TAC CGG ACC TAC CAG AGC AAG GAT CAG ACG 816 Ile Glu Ile Val Leu Leu Tyr Arg Thr Tyr Gln Ser Lys Asp Gln Thr 260 265 270 CTT GGG GAT AAA AAG GAT TTT GAT GCT TTC GTA TCC TAT GCA AAA TGG 864 Leu Gly Asp Lys Lys Asp Phe Asp Ala Phe Val Ser Tyr Ala Lys Trp 275 280 285 AGC TCT TTT CCA AGT GAG GCC ACT TCA TCT CTG AGT GAA GAA CAC TTG 912 Ser Ser Phe Pro Ser Glu Ala Thr Ser Ser Leu Ser Glu Glu His Leu 290 295 300 GCC CTG AGC CTA TTT CCT GAT GTT TTA GAA AAC AAA TAT GGA TAT AGC 960 Ala Leu Ser Leu Phe Pro Asp Val Leu Glu Asn Lys Tyr Gly Tyr Ser 305 310 315 320 CTG TGT TTG CTT GAA AGA GAT GTG GCT CCA GGA GGA GTG TAT GCA GAA 1008 Leu Cys Leu Leu Glu Arg Asp Val Ala Pro Gly Gly Val Tyr Ala Glu 325 330 335 GAC ATT GTG AGC ATT ATT AAG AGA AGC AGA GAG GTA ATA TTT ATC TTG 1056 Asp Ile Val Ser Ile Ile Lys Arg Ser Arg Glu Val Ile Phe Ile Leu 340 345 350 AGC CCC AAC TAT GTC AAT GGA CCC AGT ATC TTT GAA CTA CAA GCA GCA 1104 Ser Pro Asn Tyr Val Asn Gly Pro Ser Ile Phe Glu Leu Gln Ala Ala 355 360 365 GTG AAT CTT GCC TTG GAT GAT CAA ACA CTG AAA CTC ATT TTA ATT AAG 1152 Val Asn Leu Ala Leu Asp Asp Gln Thr Leu Lys Leu Ile Leu Ile Lys 370 375 380 TTC TGT TAC TTC CAA GAG CCA GAG TCT CTA CCT CAT CTC GTG AAA AAA 1200 Phe Cys Tyr Phe Gln Glu Pro Glu Ser Leu Pro His Leu Val Lys Lys 385 390 395 400 GCT CTC AGG GTT TTG CCC ACA GTT ACT TGG AGA GGC TTA AAA TCA GTT 1248 Ala Leu Arg Val Leu Pro Thr Val Thr Trp Arg Gly Leu Lys Ser Val 405 410 415 CCT CCC AAT TCT AGG TTC TGG GCC AAA ATG CGC TAC CAC ATG CCT GTG 1296 Pro Pro Asn Ser Arg Phe Trp Ala Lys Met Arg Tyr His Met Pro Val 420 425 430 AAA AAC TCT CAG GGA TTC ACG TGG AAC CAG CTC AGA ATT ACC TCT AGG 1344 Lys Asn Ser Gln Gly Phe Thr Trp Asn Gln Leu Arg Ile Thr Ser Arg 435 440 445 ATT TTT CAG TGG AAA GGA CTC AGT AGA ACA GAA ACC ACT GGG GAG GAG 1392 Ile Phe Gln Trp Lys Gly Leu Ser Arg Thr Glu Thr Thr Gly Glu Glu 450 455 460 CTC CCA GCC TAA 1404 Leu Pro Ala 465 Supplemental sequence of primate, e.g., human, IL-1RD9 (SEQ ID NO: 9 and 10). CCAGCGTGGT GGAATTCGGA TACTCAGGGC AGAGTTCTGA ATCTCAAAAC ACTTTAATCT 60 GGCAAAGGAA TGAAGTTATT GGAGTGATGA CAGGAACACG GGAGAACA ATG CTC TGT 117 Met Leu Cys 1 TTG GGC TGG ATA TTT CTT TGG CTT GTT GCA GGA GAG CGA ATT AAA GGA 165 Leu Gly Trp Ile Phe Leu Trp Leu Val Ala Gly Glu Arg Ile Lys Gly 5 10 15 TTT AAT ATT TCA GGT TGT TCC ACA AAA AAA CTC CTT TGG ACA TAT TCT 213 Phe Asn Ile Ser Gly Cys Ser Thr Lys Lys Leu Leu Trp Thr Tyr Ser 20 25 30 35 ACA AGG AGT GAA GAG GAA TTT GTC TTA TTT TGT GAT TTA CCA GAG CCA 261 Thr Arg Ser Glu Glu Glu Phe Val Leu Phe Cys Asp Leu Pro Glu Pro 40 45 50 CAG AAA TCA CAT TTC TGC CAC AGA AAT CGA CTC TCA CCA AAA CAA GTC 309 Gln Lys Ser His Phe Cys His Arg Asn Arg Leu Ser Pro Lys Gln Val 55 60 65 CCT GAG CAC CTG CCC TTC ATG GGT AGT AAC GAC CTA TCT GAT GTC CAA 357 Pro Glu His Leu Pro Phe Met Gly Ser Asn Asp Leu Ser Asp Val Gln 70 75 80 TGG TAC CAA CAA CCT TCG AAT GGA GAT CCA TTA GAG GAC ATT AGG AAA 405 Trp Tyr Gln Gln Pro Ser Asn Gly Asp Pro Leu Glu Asp Ile Arg Lys 85 90 95 AGC TAT CCT CAC ATC ATT CAG GAC AAA TGT ACC CTT CAC TTT TTG ACC 453 Ser Tyr Pro His Ile Ile Gln Asp Lys Cys Thr Leu His Phe Leu Thr 100 105 110 115 CCA GGG GTG AAT AAT TCT GGG TCA TAT ATT TGT AGA CCC AAG ATG ATT 501 Pro Gly Val Asn Asn Ser Gly Ser Tyr Ile Cys Arg Pro Lys Met Ile 120 125 130 AAG AGC CCC TAT GAT GTA GCC TGT TGT GTC AAG ATG ATT TTA GAA GTT 549 Lys Ser Pro Tyr Asp Val Ala Cys Cys Val Lys Met Ile Leu Glu Val 135 140 145 AAG CCC CAG ACA AAT GCA TCC TGT GAG TAT TCC GCA TCA CAT AAG CAA 597 Lys Pro Gln Thr Asn Ala Ser Cys Glu Tyr Ser Ala Ser His Lys Gln 150 155 160 GAC CTA CTT CTT GGG AGC ACT GGC TCT ATT TCT TGC CCC AGT CTC AGC 645 Asp Leu Leu Leu Gly Ser Thr Gly Ser Ile Ser Cys Pro Ser Leu Ser 165 170 175 TGC CAA AGT GAT GCA CAA AGT CCA GCG GTA ACC TGG TAC AAG AAT GGA 693 Cys Gln Ser Asp Ala Gln Ser Pro Ala Val Thr Trp Tyr Lys Asn Gly 180 185 190 195 AAA CTC CTC TCT GTG GAA AGG AGC AAC CGA ATC GTA GTG GAT GAA GTT 741 Lys Leu Leu Ser Val Glu Arg Ser Asn Arg Ile Val Val Asp Glu Val 200 205 210 TAT GAC TAT CAC CAG GGC ACA TAT GTA TGT GAT TAC ACT CAG TCG GAT 789 Tyr Asp Tyr His Gln Gly Thr Tyr Val Cys Asp Tyr Thr Gln Ser Asp 215 220 225 ACT GTG AGT TCG TGG ACA GTC AGA GCT GTT GTT CAA GTG AGA ACC ATT 837 Thr Val Ser Ser Trp Thr Val Arg Ala Val Val Gln Val Arg Thr Ile 230 235 240 GTG GGA GAC ACT AAA CTC AAA CCA GAT ATT CTG GAT CCT GTC GAG GAC 885 Val Gly Asp Thr Lys Leu Lys Pro Asp Ile Leu Asp Pro Val Glu Asp 245 250 255 ACA CTG GAA GTA GAA CTT GGA AAG CCT TTA ACT ATT AGC TGC AAA GCA 933 Thr Leu Glu Val Glu Leu Gly Lys Pro Leu Thr Ile Ser Cys Lys Ala 260 265 270 275 CGA TTT GGC TTT GAA AGG GTC TTT AAC CCT GTC ATA AAA TGG TAC ATC 981 Arg Phe Gly Phe Glu Arg Val Phe Asn Pro Val Ile Lys Trp Tyr Ile 280 285 290 AAA GAT TCT GAC CTA GAG TGG GAA GTC TCA GTA CCT GAG GCG AAA AGT 1029 Lys Asp Ser Asp Leu Glu Trp Glu Val Ser Val Pro Glu Ala Lys Ser 295 300 305 ATT AAA TCC ACT TTA AAG GAT GAA ATC ATT GAG CGT AAT ATC ATC TTG 1077 Ile Lys Ser Thr Leu Lys Asp Glu Ile Ile Glu Arg Asn Ile Ile Leu 310 315 320 GAA AAA GTC ACT CAG CGT GAT CTT CGC AGG AAG TTT GTT TGC TTT GTC 1125 Glu Lys Val Thr Gln Arg Asp Leu Arg Arg Lys Phe Val Cys Phe Val 325 330 335 CAG AAC TCC ATT GGA AAC ACA ACC CAG TCC GTC CAA CTG AAA GAA AAG 1173 Gln Asn Ser Ile Gly Asn Thr Thr Gln Ser Val Gln Leu Lys Glu Lys 340 345 350 355 AGA GGA GTG GTG CTC CTG TAC ATC CTG CTT GGC ACC ATC GGG ACC CTG 1221 Arg Gly Val Val Leu Leu Tyr Ile Leu Leu Gly Thr Ile Gly Thr Leu 360 365 370 GTG GCC GTG CTG GCG GCG AGT GCC CTC CTC TAC AGG CAC TGG ATT GAA 1269 Val Ala Val Leu Ala Ala Ser Ala Leu Leu Tyr Arg His Trp Ile Glu 375 380 385 ATA GTG CTG CTG TAC CGG ACC TAC CAG AGC AAG GAT CAG ACG CTT GGG 1317 Ile Val Leu Leu Tyr Arg Thr Tyr Gln Ser Lys Asp Gln Thr Leu Gly 390 395 400 GAT AAA AAG GAT TTT GAT GCT TTC GTA TCC TAT GCA AAA TGG AGC TCT 1365 Asp Lys Lys Asp Phe Asp Ala Phe Val Ser Tyr Ala Lys Trp Ser Ser 405 410 415 TTT CCA AGT GAG GCC ACT TCA TCT CTG AGT GAA GAA CAC TTG GCC CTG 1413 Phe Pro Ser Glu Ala Thr Ser Ser Leu Ser Glu Glu His Leu Ala Leu 420 425 430 435 AGC CTA TTT CCT GAT GTT TTA GAA AAC AAA TAT GGA TAT AGC CTG TGT 1461 Ser Leu Phe Pro Asp Val Leu Glu Asn Lys Tyr Gly Tyr Ser Leu Cys 440 445 450 TTG CTT GAA AGA GAT GTG GCT CCA GGA GGA GTG TAT GCA GAA GAC ATT 1509 Leu Leu Glu Arg Asp Val Ala Pro Gly Gly Val Tyr Ala Glu Asp Ile 455 460 465 GTG AGC ATT ATT AAG AGA AGC AGA AGA GGA ATA TTT ATC TTG AGC CCC 1557 Val Ser Ile Ile Lys Arg Ser Arg Arg Gly Ile Phe Ile Leu Ser Pro 470 475 480 AAC TAT GTC AAT GGA CCC AGT ATC TTT GAA CTA CAA GCA GCA GTG AAT 1605 Asn Tyr Val Asn Gly Pro Ser Ile Phe Glu Leu Gln Ala Ala Val Asn 485 490 495 CTT GCC TTG GAT GAT CAA ACA CTG AAA CTC ATT TTA ATT AAG TTC TGT 1653 Leu Ala Leu Asp Asp Gln Thr Leu Lys Leu Ile Leu Ile Lys Phe Cys 500 505 510 515 TAC TTC CAA GAG CCA GAG TCT CTA CCT CAT CTC GTG AAA AAA GCT CTC 1701 Tyr Phe Gln Glu Pro Glu Ser Leu Pro His Leu Val Lys Lys Ala Leu 520 525 530 AGG GTT TTG CCC ACA GTT ACT TGG AGA GGC TTA AAA TCA GTT CCT CCC 1749 Arg Val Leu Pro Thr Val Thr Trp Arg Gly Leu Lys Ser Val Pro Pro 535 540 545 AAT TCT AGG TTC TGG GCC AAA ATG CGC TAC CAC ATG CCT GTG AAA AAC 1797 Asn Ser Arg Phe Trp Ala Lys Met Arg Tyr His Met Pro Val Lys Asn 550 555 560 TCT CAG GGA TTC ACG TGG AAC CAG CTC AGA ATT ACC TCT AGG ATT TTT 1845 Ser Gln Gly Phe Thr Trp Asn Gln Leu Arg Ile Thr Ser Arg Ile Phe 565 570 575 CAG TGG AAA GGA CTC AGT AGA ACA GAA ACC ACT GGG AGG AGC TCC CAG 1893 Gln Trp Lys Gly Leu Ser Arg Thr Glu Thr Thr Gly Arg Ser Ser Gln 580 585 590 595 CCT AAG GAA TGG TGAAATGAGC CCTGGAGCCC CCTCCAGTCC AGTCCCTGGG 1945 Pro Lys Glu Trp ATAGAGATGT TGCTGGACAG AACTCACAGC TCTGTGTGTG TGTGTTCAGG CTGATAGGAA 2005 ATTCAAAGAG TCTCCTGCCA GCACCAAGCA AGCTTGATGG ACAATGGAAT GGGATTGAGA 2065 CTGTGGTTTA GAGCCTTTGA TTTCCTGGAC TGGACAGACG GCGAGTGAAT TCTCTAGACC 2125 TTGGGTACTT TCAGTACACA ACACCCCTAA GATTTCCCAG TGGTCCGAGC AGAATCAGAA 2185 AATACAGCTA CTTCTGCCTT ATGGCTAGGG AACTGTCATG TCTACCATGT ATTGTACATA 2245 TGACTTTATG TATACTTGCA ATCAAATAAA TATTATTTTA TTAGAAAAAA AAAAAAAAAG 2305 GGCGGCCGC 2314 MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPE HLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVA CCVKMILEVKPQTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLSVERSNRIV VDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKLKPDILDPVEDTLEVELGKPLTISCKAR FGFERVFNPVIKWYIKDSDLEWEVSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGN TTQSVQLKEKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKDQTLGDKKDFDAFVSY AKWSSFPSEATSSLSEEHLALSLFPDVLENKYGYSLCLLERDVAPGGVYAEDIVSIIKRSRRGIFILSP NYVNGPSIFELQAAVNLALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNSRFW AKMRYHMPVKNSQGFTWNQLRITSRIFQWKGLSRTETTGRSSQPKEW Nucleotide and amino acid sequences (see SEQ ID NO: 11 and 12) of a rodent, e.g., mouse, embodiment of IL-1RD9. Single clone sequence from thymus from 4 week old male C57BL/6J. GCA GCA GTG AAT CTT GCC TTG GTT GAT CAG ACA CTG AAG TTG ATT TTA 48 Ala Ala Val Asn Leu Ala Leu Val Asp Gln Thr Leu Lys Leu Ile Leu 1 5 10 15 ATT AAG TTC TGT TCC TTC CAA GAG CCA GAA TCT CTT CCT TAC CTT GTC 96 Ile Lys Phe Cys Ser Phe Gln Glu Pro Glu Ser Leu Pro Tyr Leu Val 20 25 30 AAA AAG GCT CTG CGG GTT CTC CCC ACA GTC ACA TGG AAA GGC TTG AAG 144 Lys Lys Ala Leu Arg Val Leu Pro Thr Val Thr Trp Lys Gly Leu Lys 35 40 45 TCG GTC CAC GCC AGT TCC AGG TTC TGG ACC CAA ATT CGT TAC CAC ATG 192 Ser Val His Ala Ser Ser Arg Phe Trp Thr Gln Ile Arg Tyr His Met 50 55 60 CCT GTG AAG AAC TCC AAC AGG TTT ATG TTC AAC GGG CTC AGA ATT TTC 240 Pro Val Lys Asn Ser Asn Arg Phe Met Phe Asn Gly Leu Arg Ile Phe 65 70 75 80 CTG AAG GGG TTT TCC CCT GAA AAG GAC CTA GTG ACA CAG AAA CCC CTG 288 Leu Lys Gly Phe Ser Pro Glu Lys Asp Leu Val Thr Gln Lys Pro Leu 85 90 95 GAA GGA ATG CCC AAG TCT GGG AAT GAC CAC GGA GCT CAG AAC CTC CTT 336 Glu Gly Met Pro Lys Ser Gly Asn Asp His Gly Ala Gln Asn Leu Leu 100 105 110 CTC TAC AGT GAC CAG AAG AGG TGC TGATGGGTAG AACTTGCTGT GTGGATCAGG 390 Leu Tyr Ser Asp Gln Lys Arg Cys 115 120 CTGATAGAAA TTGAGCCTTT CTGCTCTCAG TGCCAAGCAA GCTTGACAGG CAGTGGAATG 450 AAGCGGCATC TGTGGTTTTA GGGTCTGGGT TCCTGGAACA GACACAGAGC AATACTCCAG 510 ACCTCTGCCG TGTGCTTAGC ACACATTTCC CTGAGAGTTC CCAAGTAGCC TGAACAGAAT 570 CAAGAGAAAT AGCTCCATGG GCTGTCCAAC ATTCATGCAC GCATGCCTGT TTTGCACTAT 630 ATATATGAAT TTATCATACG TTTGTGTGTG TATATGCATT CAGATAAATA GGATTTTATT 690 TTGTTCGATA CGAGTGATTG AAACTCCATT TAAAGCCCTT CTGTAAAGAA ATTTTGCTGC 750 AAAAAAAAAA AAAAAAAA 768 AAVNLALVDQTLKLILTKFCSFQEPESLPYLVKKALRVLPTVTWKGLKSVHASSRFWTQIRYHMPVKNS NRFMFNGLRIFLKGFSPEKDLVTQKPLDRMPKSGNDHGAQNLLLYSD Supplemental sequence of rodent, e.g., mouse, IL-1RD9 (SEQ ID NO: 13 and 14). Putative signal processing site is indicated, but actual may depend upon cell type, and may be at a different nearby site. ATG TCT GTT TGG CTG GTG TTC TTG GTT TGT GCA GGA GAG AAG ACC ACA 48 Met Ser Val Trp Leu Val Phe Leu Val Cys Ala Gly Glu Lys Thr Thr −17 −15 −10 −5 GGA TTT AAT CAT TCA GCT TGT GCC ACC AAA AAT TCT GTG GAC ATA TTC 96 Gly Phe Asn His Ser Ala Cys Ala Thr Lys Asn Ser Val Asp Ile Phe 1 5 10 15 GCA AGG GGT GCA GAG AAT TTT GTC TAT TTT GTG ACT TAC AAG AGC TTC 144 Ala Arg Gly Ala Glu Asn Phe Val Tyr Phe Val Thr Tyr Lys Ser Phe 20 25 30 AGG AGC AAA AAT TCT CCC ATG CAA GTC AAC TGT CAC CAA CAC AAA GTC 192 Arg Ser Lys Asn Ser Pro Met Gln Val Asn Cys His Gln His Lys Val 35 40 45 TGC TCA CAA ACT TGC AGT GGC AGT CAG AAG GAC TTA TCT GAT GTC CAG 240 Cys Ser Gln Thr Cys Ser Gly Ser Gln Lys Asp Leu Ser Asp Val Gln 50 55 60 TGG TAC ATG CAA CCT CGG AGT GGA AGT CCA CTA GAG GAG ATC AGT AGA 288 Trp Tyr Met Gln Pro Arg Ser Gly Ser Pro Leu Glu Glu Ile Ser Arg 65 70 75 AAC TCT CCC CAT ATG CAG AGT GAA GGC ATG CTG CAT ATA TTG GCC CCA 336 Asn Ser Pro His Met Gln Ser Glu Gly Met Leu His Ile Leu Ala Pro 80 85 90 95 CAG ACG AAC AGC ATT TGG TCA TAT ATT TGT AGA CCC AGA ATT AGG AGC 384 Gln Thr Asn Ser Ile Trp Ser Tyr Ile Cys Arg Pro Arg Ile Arg Ser 100 105 110 CCC CAG GAT ATG GCC TGT TGT ATC AAG ACA GTC TTA GAA GTT AAG CCT 432 Pro Gln Asp Met Ala Cys Cys Ile Lys Thr Val Leu Glu Val Lys Pro 115 120 125 CAG AGA AAC GTG TCC TGT GGG AAC ACA GCA CAA GAT GAA CAA GTC CTA 480 Gln Arg Asn Val Ser Cys Gly Asn Thr Ala Gln Asp Glu Gln Val Leu 130 135 140 CTT CTT GGC AGT ACT GGC TCC ATT CAT TGT CCC AGT CTC AGC TGC CAA 528 Leu Leu Gly Ser Thr Gly Ser Ile His Cys Pro Ser Leu Ser Cys Gln 145 150 155 AGT GAT GTA CAG AGT CCA GAG ATG ACC TGG TAC AAG GAT GGA AGA CTA 576 Ser Asp Val Gln Ser Pro Glu Met Thr Trp Tyr Lys Asp Gly Arg Leu 160 165 170 175 CTT CCT GAG CAC AAG AAA AAT CCA ATT GAG ATG GCA GAT ATT TAT GTT 624 Leu Pro Glu His Lys Lys Asn Pro Ile Glu Met Ala Asp Ile Tyr Val 180 185 190 TTT AAT CAA GGC TTG TAT GTA TGT GAT TAC ACA CAG TCA GAT AAT GTG 672 Phe Asn Gln Gly Leu Tyr Val Cys Asp Tyr Thr Gln Ser Asp Asn Val 195 200 205 AGT TCC TGG ACA GTC CGA GCT GTG GTT AAA GTG AGA ACC ATT GGT AAG 720 Ser Ser Trp Thr Val Arg Ala Val Val Lys Val Arg Thr Ile Gly Lys 210 215 220 GAC ATC AAT GTG AAG CCG GAA ATT CTG GAT CCC ATT ACA GAT ACA CTG 768 Asp Ile Asn Val Lys Pro Glu Ile Leu Asp Pro Ile Thr Asp Thr Leu 225 230 235 GAC GTA GAG CTT GGA AAG CCT TTA ACT CTC CCC TGC AGA GTA CAG TTT 816 Asp Val Glu Leu Gly Lys Pro Leu Thr Leu Pro Cys Arg Val Gln Phe 240 245 250 255 GGC TTC CAA AGA CTT TCA AAG CCT GTG ATA AAG TGG TAT GTC AAA GAA 864 Gly Phe Gln Arg Leu Ser Lys Pro Val Ile Lys Trp Tyr Val Lys Glu 260 265 270 TCT ACA CAG GAG TGG GAA ATG TCA GTA TTT GAG GAG AAA AGA ATT CAA 912 Ser Thr Gln Glu Trp Glu Met Ser Val Phe Glu Glu Lys Arg Ile Gln 275 280 285 TCC ACT TTC AAG AAT GAA GTC ATT GAA CGT ACC ATC TTC TTG AGA GAA 960 Ser Thr Phe Lys Asn Glu Val Ile Glu Arg Thr Ile Phe Leu Arg Glu 290 295 300 GTT ACC CAG AGA GAT CTC AGC AGA AAG TTT GTT TGC TTT GCC CAG AAC 1008 Val Thr Gln Arg Asp Leu Ser Arg Lys Phe Val Cys Phe Ala Gln Asn 305 310 315 TCC ATT GGG AAC ACA ACA CGG ACC ATA CGG CTG AGG AAG AAG GAA GAG 1056 Ser Ile Gly Asn Thr Thr Arg Thr Ile Arg Leu Arg Lys Lys Glu Glu 320 325 330 335 GTG GTG TTT GTA TAC ATC CTT CTC GGC ACG GCC TTG ATG CTG GTG GGC 1104 Val Val Phe Val Tyr Ile Leu Leu Gly Thr Ala Leu Met Leu Val Gly 340 345 350 GTT CTG GTG GCA GCT GCT TTC CTC TAC TGG TAC TGG ATT GAA GTT GTC 1152 Val Leu Val Ala Ala Ala Phe Leu Tyr Trp Tyr Trp Ile Glu Val Val 355 360 365 CTG CTC TGT CGA ACC TAC AAG AAC AAA GAT GAG ACT CTG GGG GAT AAG 1200 Leu Leu Cys Arg Thr Tyr Lys Asn Lys Asp Glu Thr Leu Gly Asp Lys 370 375 380 AAG GAA TTC GAT GCA TTT GTA TCC TAC TCG AAT TGG AGC TCT CCT GAG 1248 Lys Glu Phe Asp Ala Phe Val Ser Tyr Ser Asn Trp Ser Ser Pro Glu 385 390 395 ACT GAC GCC GTG GGA TCT CTG AGT GAG GAA CAC CTG GCT CTG AAT CTT 1296 Thr Asp Ala Val Gly Ser Leu Ser Glu Glu His Leu Ala Leu Asn Leu 400 405 410 415 TTC CCG GAA GTG CTA GAA GAC ACC TAT GGG TAC AGA TTG TGT TTG CTT 1344 Phe Pro Glu Val Leu Glu Asp Thr Tyr Gly Tyr Arg Leu Cys Leu Leu 420 425 430 GAC CGA GAT GTG ACC CCA GGA GGA GTG TAT GCA GAT GAC ATT GTG AGC 1392 Asp Arg Asp Val Thr Pro Gly Gly Val Tyr Ala Asp Asp Ile Val Ser 435 440 445 ATC ATT AAG AAA AGC CGA AGA GGA ATA TTT ATC CTG AGT CCC AGC TAC 1440 Ile Ile Lys Lys Ser Arg Arg Gly Ile Phe Ile Leu Ser Pro Ser Tyr 450 455 460 CTC AAT GGA CCC CGT GTC TTT GAG CTA CAA GCA GCA GTG AAT CTT GCC 1488 Leu Asn Gly Pro Arg Val Phe Glu Leu Gln Ala Ala Val Asn Leu Ala 465 470 475 TTG GTT GAT CAG ACA CTG AAG TTG ATT TTA ATT AAG TTC TGT TCC TTC 1536 Leu Val Asp Gln Thr Leu Lys Leu Ile Leu Ile Lys Phe Cys Ser Phe 480 485 490 495 CAA GAG CCA GAA TCT CTT CCT TAC CTT GTC AAA AAG GCT CTG CGG GTT 1584 Gln Glu Pro Glu Ser Leu Pro Tyr Leu Val Lys Lys Ala Leu Arg Val 500 505 510 CTC CCC ACA GTC ACA TGG AAA GGC TTG AAG TCG GTC CAC GCC AGT TCC 1632 Leu Pro Thr Val Thr Trp Lys Gly Leu Lys Ser Val His Ala Ser Ser 515 520 525 AGG TTC TGG ACC CAA ATT CGT TAC CAC ATG CCT GTG AAG AAC TCC AAC 1680 Arg Phe Trp Thr Gln Ile Arg Tyr His Met Pro Val Lys Asn Ser Asn 530 535 540 AGG TTT ATG TTC AAC GGG CTC AGA ATT TTC CTG AAG GGC TTT TCC CCT 1728 Arg Phe Met Phe Asn Gly Leu Arg Ile Phe Leu Lys Gly Phe Ser Pro 545 550 555 GAA AAG GAC CTA GTG ACA CAG AAA CCC CTG GAA GGA ATG CCC AAG TCT 1776 Glu Lys Asp Leu Val Thr Gln Lys Pro Leu Glu Gly Met Pro Lys Ser 560 565 570 575 GGG AAT GAC CAC GGA GCT CAG AAC CTC CTT CTC TAC AGT GAC CAG AAG 1824 Gly Asn Asp His Gly Ala Gln Asn Leu Leu Leu Tyr Ser Asp Gln Lys 580 585 590 AGG TGC TGA 1833 Arg Cys Supplemental sequence of rodent, e.g., mouse, IL-1RD9 (SEQ ID NO: 15 and 16). TGACAGGAGC AAAGGGGAAC C ATG CTC TGT TTG GGC TGG GTG TTT CTT TGG 51 Met Leu Cys Leu Gly Trp Val Phe Leu Trp 1 5 10 TTT GTT GCA GGA GAG AAG ACC ACA GGA TTT AAT CAT TCA GCT TGT GCC 99 Phe Val Ala Gly Glu Lys Thr Thr Gly Phe Asn His Ser Ala Cys Ala 15 20 25 ACC AAA AAA CTT CTG TGG ACA TAT TCT GCA AGG GGT GCA GAG AAT TTT 147 Thr Lys Lys Leu Leu Trp Thr Tyr Ser Ala Arg Gly Ala Glu Asn Phe 30 35 40 GTC CTA TTT TGT GAC TTA CAA GAG CTT CAG GAG CAA AAA TTC TCC CAT 195 Val Leu Phe Cys Asp Leu Gln Glu Leu Gln Glu Gln Lys Phe Ser His 45 50 55 GCA AGT CAA CTG TCA CCA ACA CAA AGT CCT GCT CAC AAA CCT TGC AGT 243 Ala Ser Gln Leu Ser Pro Thr Gln Ser Pro Ala His Lys Pro Cys Ser 60 65 70 GGC AGT CAG AAG GAC CTA TCT GAT GTC CAG TGG TAC ATG CAA CCT CGG 291 Gly Ser Gln Lys Asp Leu Ser Asp Val Gln Trp Tyr Met Gln Pro Arg 75 80 85 90 AGT GGA AGT CCA CTA GAG GAG ATC AGT AGA AAC TCT CCC CAT ATG CAG 339 Ser Gly Ser Pro Leu Glu Glu Ile Ser Arg Asn Ser Pro His Met Gln 95 100 105 AGT GAA GGC ATG CTG CAT ATA TTG GCC CCA CAG ACG AAC AGC ATT TGG 387 Ser Glu Gly Met Leu His Ile Leu Ala Pro Gln Thr Asn Ser Ile Trp 110 115 120 TCA TAT ATT TGT AGA CCC AGA ATT AGG AGC CCC CAG GAT ATG GCC TGT 435 Ser Tyr Ile Cys Arg Pro Arg Ile Arg Ser Pro Gln Asp Met Ala Cys 125 130 135 TGT ATC AAG ACA GTC TTA GAA GTT AAG CCT CAG AGA AAC GTG TCC TGT 483 Cys Ile Lys Thr Val Leu Glu Val Lys Pro Gln Arg Asn Val Ser Cys 140 145 150 GGG AAC ACA GCA CAA GAT GAA CAA GTC CTA CTT CTT GGC AGT ACT GGC 531 Gly Asn Thr Ala Gln Asp Glu Gln Val Leu Leu Leu Gly Ser Thr Gly 155 160 165 170 TCC ATT CAT TGT CCC AGT CTC AGC TGC CAA AGT GAT GTA CAG AGT CCA 579 Ser Ile His Cys Pro Ser Leu Ser Cys Gln Ser Asp Val Gln Ser Pro 175 180 185 GAG ATG ACC TGG TAC AAG GAT GGA AGA CTA CTT CCT GAG CAC AAG AAA 627 Glu Met Thr Trp Tyr Lys Asp Gly Arg Leu Leu Pro Glu His Lys Lys 190 195 200 AAT CCA ATT GAG ATG GCA GAT ATT TAT GTT TTT AAT CAA GGC TTG TAT 675 Asn Pro Ile Glu Met Ala Asp Ile Tyr Val Phe Asn Gln Gly Leu Tyr 205 210 215 GTA TGT GAT TAC ACA CAG TCA GAT AAT GTG AGT TCC TGG ACA GTC CGA 723 Val Cys Asp Tyr Thr Gln Ser Asp Asn Val Ser Ser Trp Thr Val Arg 220 225 230 GCT GTG GTT AAA GTG AGA ACC ATT GGT AAG GAC ATC AAT GTG AAG CCG 771 Ala Val Val Lys Val Arg Thr Ile Gly Lys Asp Ile Asn Val Lys Pro 235 240 245 250 GAA ATT CTG GAT CCC ATT ACA GAT ACA CTG GAC GTA GAG CTT GGA AAG 819 Glu Ile Leu Asp Pro Ile Thr Asp Thr Leu Asp Val Glu Leu Gly Lys 255 260 265 CCT TTA ACT CTC CCC TGC AGA GTA CAG TTT GGC TTC CAA AGA CTT TCA 867 Pro Leu Thr Leu Pro Cys Arg Val Gln Phe Gly Phe Gln Arg Leu Ser 270 275 280 AAG CCT GTG ATA AAG TGG TAT GTC AAA GAA TCT ACA CAG GAG TGG GAA 915 Lys Pro Val Ile Lys Trp Tyr Val Lys Glu Ser Thr Gln Glu Trp Glu 285 290 295 ATG TCA GTA TTT GAG GAG AAA AGA ATT CAA TCC ACT TTC AAG AAT GAA 963 Met Ser Val Phe Glu Glu Lys Arg Ile Gln Ser Thr Phe Lys Asn Glu 300 305 310 GTC ATT GAA CGT ACC ATC TTC TTG AGA GAA GTT ACC CAG AGA GAT CTC 1011 Val Ile Glu Arg Thr Ile Phe Leu Arg Glu Val Thr Gln Arg Asp Leu 315 320 325 330 AGC AGA AAG TTT GTT TGC TTT GCC CAG AAC TCC ATT GGG AAC ACA ACA 1059 Ser Arg Lys Phe Val Cys Phe Ala Gln Asn Ser Ile Gly Asn Thr Thr 335 340 345 CGG ACC ATA CGG CTG AGG AAG AAG GAA GAG GTG GTG TTT GTA TAC ATC 1107 Arg Thr Ile Arg Leu Arg Lys Lys Glu Glu Val Val Phe Val Tyr Ile 350 355 360 CTT CTC GGC ACG GCC TTG ATG CTG GTG GGC GTT CTG GTG GCA GCT GCT 1155 Leu Leu Gly Thr Ala Leu Met Leu Val Gly Val Leu Val Ala Ala Ala 365 370 375 TTC CTC TAC TGG TAC TGG ATT GAA GTT GTC CTG CTC TGT CGA ACC TAC 1203 Phe Leu Tyr Trp Tyr Trp Ile Glu Val Val Leu Leu Cys Arg Thr Tyr 380 385 390 AAG AAC AAA GAT GAG ACT CTG GGG GAT AAG AAG GAA TTC GAT GCA TTT 1251 Lys Asn Lys Asp Glu Thr Leu Gly Asp Lys Lys Glu Phe Asp Ala Phe 395 400 405 410 GTA TCC TAC TCG AAT TGG AGC TCT CCT GAG ACT GAC GCC GTG GGA TCT 1299 Val Ser Tyr Ser Asn Trp Ser Ser Pro Glu Thr Asp Ala Val Gly Ser 415 420 425 CTG AGT GAG GAA CAC CTG GCT CTG AAT CTT TTC CCG GAA GTG CTA GAA 1347 Leu Ser Glu Glu His Leu Ala Leu Asn Leu Phe Pro Glu Val Leu Glu 430 435 440 GAC ACC TAT GGG TAC AGA TTG TGT TTG CTT GAC CGA GAT GTG ACC CCA 1395 Asp Thr Tyr Gly Tyr Arg Leu Cys Leu Leu Asp Arg Asp Val Thr Pro 445 450 455 GGA GGA GTG TAT GCA GAT GAC ATT GTG AGC ATC ATT AAG AAA AGC CGA 1443 Gly Gly Val Tyr Ala Asp Asp Ile Val Ser Ile Ile Lys Lys Ser Arg 460 465 470 AGA GGA ATA TTT ATC CTG AGT CCC AGC TAC CTC AAT GGA CCC CGT GTC 1491 Arg Gly Ile Phe Ile Leu Ser Pro Ser Tyr Leu Asn Gly Pro Arg Val 475 480 485 490 TTT GAG CTA CAA GCA GCA GTG AAT CTT GCC TTG GTT GAT CAG ACA CTG 1539 Phe Glu Leu Gln Ala Ala Val Asn Leu Ala Leu Val Asp Gln Thr Leu 495 500 505 AAG TTG ATT TTA ATT AAG TTC TGT TCC TTC CAA GAG CCA GAA TCT CTT 1587 Lys Leu Ile Leu Ile Lys Phe Cys Ser Phe Gln Glu Pro Glu Ser Leu 510 515 520 CCT TAC CTT GTC AAA AAG GCT CTG CGG GTT CTC CCC ACA GTC ACA TGG 1635 Pro Tyr Leu Val Lys Lys Ala Leu Arg Val Leu Pro Thr Val Thr Trp 525 530 535 AAA GGC TTG AAG TGG GTC CAC GCC AGT TCC AGG TTC TGG ACC CAA ATT 1683 Lys Gly Leu Lys Ser Val His Ala Ser Ser Arg Phe Trp Thr Gln Ile 540 545 550 CGT TAC CAC ATG CCT GTG AAG AAC TCC AAC AGG TTT ATG TTC AAC GGG 1731 Arg Tyr His Met Pro Val Lys Asn Ser Asn Arg Phe Met Phe Asn Gly 555 560 565 570 CTC AGA ATT TTC CTG AAG GGC TTT TCC CCT GAA AAG GAC CTA GTG ACA 1779 Leu Arg Ile Phe Leu Lys Gly Phe Ser Pro Glu Lys Asp Leu Val Thr 575 580 585 CAG AAA CCC CTG GAA GGA ATG CCC AAG TCT GGG AAT GAC CAC GGA GCT 1827 Gln Lys Pro Leu Glu Gly Met Pro Lys Ser Gly Asn Asp His Gly Ala 590 595 600 CAG AAC CTC CTT CTC TAC AGT GAC CAG AAG AGG TGC TGATGGGTAG 1873 Gln Asn Leu Leu Leu Tyr Ser Asp Gln Lys Arg Cys 605 610 AACTTGCTGT GTGGATCAGG CTGATAGAAA TTGAGCCTTT CTGCTCTCAG TGCCAAGCAA 1933 GCTTGACAGG CAGTGGAATG AAGCGGCATC TGTGGTTTTA GGGTCTGGGT TCCTGGAACA 1993 GACACAGAGC AATACTCCAG ACCTCTGCCG TGTGCTTAGC ACACATTTCC CTGAGAGTTC 2053 CCAAGTAGCC TGAACAGAAT CAACAGAAAT AGCTCCATGG GCTGTCCAAC ATTCATGCAC 2113 GCATGCCTGT TTTGCACTAT ATATATGAAT TTATCATACG TTTGTGTGTG TATATGCATT 2173 CAGATAAATA GGATTTTATT TTGTTCGATA CGAGTGATTG AAACTCCATC TAAAGCCCTT 2233 CTGTAAAGAA AAAAAAAAAA AAAAAA 2259 MLCLGWVFLWFVAGEKTTGFNHSACATKKLLWTYSARGAENFVLFCDLQELQEQKFSHASQLSPTQSPA HKPCSGSQKDLSDVQWYMQPRSGSPLEEISRNSPHMQSEGMLHILAPQTNSIWSYICRPRIRSPQDMAC CIKTVLEVKPQRNVSCGNTAQDEQVLLLGSTGSIHCPSLSCQSDVQSPEMTWYKDGRLLPEHKKNPIEM ADIYVFNQGLYVCDYTQSDNVSSWTVRAVVKVRTIGKDINVKPEILDPITDTLDVELGKPLTLPCRVQF GFQRLSKPVIKWYVKESTQEWEMSVFEEKRIQSTFKNEVIERTIFLREVTQRDLSRKFVCFAQNSIGNT TRTIRLRKKEEVVFVYILLGTALMLVGVLVAAAFLYWYWIEVVLLCRTYKNKDETLGDKKEFDAFVSYS NWSSPETDAVGSLSEEHLALNLFPEVLEDTYGYRLCLLDRDVTPGGVYADDIVSIIKKSRRGIFILSPS YLNGPRVFELQAAVNLALVDQTLKLILIKFCSFQEPESLPYLVKKALRVLPTVTWKGLKSVHASSRFWT QIRYHMPVKNSNRFMFNGLRIFLKGFSPEKDLVTQKPLEGMPKSGNDHGAQNLLLYSDQKRC
[0064] 3 TABLE 3 Nucleotide and amino acid sequences (see SEQ ID NO: 17 and 18) of primate, e.g., human, embodiment of IL-1RD10. Single sequence derived from human brain frontal cortex, epileptic; re-excision. Nucleotides 374, 383, 396, 403, 433, 458, 459, 483, and 515 are indicated as C, each may be A, C, G, or T. C TGT GAA TTA AAA TAT GGA GGC TTT GTT GTG AGA AGA ACT ACT GAA 46 Cys Glu Leu Lys Tyr Gly Gly Phe Val Val Arg Arg Thr Thr Glu 1 5 10 15 15 TTA ACT GTT ACA GCC CCT CTG ACT GAT AAG CCA CCC AAG CTT TTG TAT 94 Leu Thr Val Thr Ala Pro Leu Thr Asp Lys Pro Pro Lys Leu Leu Tyr 20 25 30 CCT ATG GAA AGT AAA CTG ACA ATT CAG GAG ACC CAG CTG GGT GAC TCT 142 Pro Met Glu Ser Lys Leu Thr Ile Gln Glu Thr Gln Leu Gly Asp Ser 35 40 45 GCT AAT CTA ACC TGC AGA GCT TTC TTT GGG TAC AGC GGA GAT GTC AGT 190 Ala Asn Leu Thr Cys Arg Ala Phe Phe Gly Tyr Ser Gly Asp Val Ser 50 55 60 CCT TTA ATT TAC TGG ATG AAA GGA GAA AAA TTT ATT GAA GAT CTG GAT 238 Pro Leu Ile Tyr Trp Met Lys Gly Glu Lys Phe Ile Glu Asp Leu Asp 65 70 75 GAA AAT CGA GTT TGG GAA AGT GAC ATT AGA ATT CTT AAG GAG CAT CTT 286 Glu Asn Arg Val Trp Glu Ser Asp Ile Arg Ile Leu Lys Glu His Leu 80 85 90 95 GGG GAA CAG GAA GTT TCC ATC TCA TTA ATT GTG GAC TCT GTG GAA GAA 334 Gly Glu Gln Glu Val Ser Ile Ser Leu Ile Val Asp Ser Val Glu Glu 100 105 110 GGT GAC TTG GGA AAT TAC TCC TGT TAT GTT GAA AAA TGG CAA TGG ACG 382 Gly Asp Leu Gly Asn Tyr Ser Cys Tyr Val Glu Lys Trp Gln Trp Thr 115 120 125 CCG ACA CGC CAG CCG TCC CCC TTC ATA AAC GAG AGC CTA ATG TAC ACA 430 Pro Thr Arg Gln Pro Ser Pro Phe Ile Asn Glu Ser Leu Met Tyr Thr 130 135 140 GTC GGA ACT TGC CTG GAG GCC CTT GGG CCA AAA CCT TGG TGG TTG AAT 478 Val Gly Thr Cys Leu Glu Ala Leu Gly Pro Lys Pro Trp Trp Leu Asn 145 150 155 GTT TCG GGA CCA CCT TCA AAG TGT ACC AAG GTT GGA CC 516 Val Ser Gly Pro Pro Ser Lys Cys Thr Lys Val Gly 160 165 170 CELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTIQETQLGDSANLTCRAFFGYSGDVSPLIYWM KGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVEKWXWTXTRQXSXFINE SLMYTXGTCLEALGXKPWWLNVXGPPSKCTKVG Supplemental sequence of primate, e.g., human, IL-1RD10 (SEQ ID NO: 19 and 20). Note nucleotides 1501, 1775, 1777, 1820, 1832, 1841, and 1844 are designated C; each may be A, C, G, or T. GAA TTC GGC ACG AGC TGT GAA TTA AAA TAT GGA GGC TTT GTT GTG AGA 48 Glu Phe Gly Thr Ser Cys Glu Leu Lys Tyr Gly Gly Phe Val Val Arg 1 5 10 15 AGA ACT ACT GAA TTA ACT GTT ACA GCC CCT CTG ACT GAT AAG CCA CCC 96 Arg Thr Thr Glu Leu Thr Val Thr Ala Pro Leu Thr Asp Lys Pro Pro 20 25 30 AAG CTT TTG TAT CCT ATG GAA AGT AAA CTG ACA ATT CAG GAG ACC CAG 144 Lys Leu Leu Tyr Pro Met Glu Ser Lys Leu Thr Ile Gln Glu Thr Gln 35 40 45 CTG GGT GAC TCT GCT AAT CTA ACC TGC AGA GCT TTC TTT GGG TAC AGC 192 Leu Gly Asp Ser Ala Asn Leu Thr Cys Arg Ala Phe Phe Gly Tyr Ser 50 55 60 GGA GAT GTC AGT CCT TTA ATT TAC TGG ATG AAA GGA GAA AAA TTT ATT 240 Gly Asp Val Ser Pro Leu Ile Tyr Trp Met Lys Gly Glu Lys Phe Ile 65 70 75 80 GAA GAT CTG GAT GAA AAT CGA GTT TGG GAA AGT GAC ATT AGA ATT CTT 288 Glu Asp Leu Asp Glu Asn Arg Val Trp Glu Ser Asp Ile Arg Ile Leu 85 90 95 AAG GAG CAT CTT GGG GAA CAG GAA GTT TCC ATC TCA TTA ATT GTG GAC 336 Lys Glu His Leu Gly Glu Gln Glu Val Ser Ile Ser Leu Ile Val Asp 100 105 110 TCT GTG GAA GAA GGT GAC TTG GGA AAT TAC TCC TGT TAT GTT GAA AAT 384 Ser Val Glu Glu Gly Asp Leu Gly Asn Tyr Ser Cys Tyr Val Glu Asn 115 120 125 GGA AAT GGA CGT CGA CAC GCC AGC GTT CTC CTT CAT AAA CGA GAG CTA 432 Gly Asn Gly Arg Arg His Ala Ser Val Leu Leu His Lys Arg Glu Leu 130 135 140 ATG TAC ACA GTG GAA CTT GCT GGA GGC CTT GGT GCT ATA CTC TTG CTG 480 Met Tyr Thr Val Glu Leu Ala Gly Gly Leu Gly Ala Ile Leu Leu Leu 145 150 155 160 CTT GTA TGT TTG GTG ACC ATC TAC AAG TGT TAC AAG ATA GAA ATC ATG 528 Leu Val Cys Leu Val Thr Ile Tyr Lys Cys Tyr Lys Ile Glu Ile Met 165 170 175 CTC TTC TAC AGG AAT CAT TTT GGA GCT GAA GAA CTC GAT GGA GAC AAT 576 Leu Phe Tyr Arg Asn His Phe Gly Ala Glu Glu Leu Asp Gly Asp Asn 180 185 190 AAA GAT TAT GAT GCA TAC TTA TCA TAC ACC AAA GTG GAT CCT GAC CAG 624 Lys Asp Tyr Asp Ala Tyr Leu Ser Tyr Thr Lys Val Asp Pro Asp Gln 195 200 205 TGG AAT CAA GAG ACT GGG GAA GAA GAA CGT TTT GCC CTT GAA ATC CTA 672 Trp Asn Gln Glu Thr Gly Glu Glu Glu Arg Phe Ala Leu Glu Ile Leu 210 215 220 CCT GAT ATG CTT GAA AAG CAT TAT GGA TAT AAG TTG TTT ATA CCA GAT 720 Pro Asp Met Leu Glu Lys His Tyr Gly Tyr Lys Leu Phe Ile Pro Asp 225 230 235 240 AGA GAT TTA ATC CCA ACT GGA ACA TAC ATT GAA GAT GTG GCA AGA TGT 768 Arg Asp Leu Ile Pro Thr Gly Thr Tyr Ile Glu Asp Val Ala Arg Cys 245 250 255 GTA GAT CAA AGC AAG CGG CTG ATT ATT GTC ATG ACC CCA AAT TAC GTA 816 Val Asp Gln Ser Lys Arg Leu Ile Ile Val Met Thr Pro Asn Tyr Val 260 265 270 GTT AGA AGG GGC TGG AGC ATC TTT GAG CTG GAA ACC ACA CTT CTA AAT 864 Val Arg Arg Gly Trp Ser Ile Phe Glu Leu Glu Thr Thr Leu Leu Asn 275 280 285 ATG CTT GTG ACT GGA GAA ATT AAA GTG ATT CTA ATT GAA TGC AGT GAA 912 Met Leu Val Thr Gly Glu Ile Lys Val Ile Leu Ile Glu Cys Ser Glu 290 295 300 CTG AGA GGA ATT ATG AAC TAC CAC GAG GTG GAC GCC CTG AAG CAC ACC 960 Leu Arg Gly Ile Met Asn Tyr His Glu Val Asp Ala Leu Lys His Thr 305 310 315 320 ATC AAG CTC CTG ACG GTC ATT AAA TGG CAT GGA CCA AAA TGC AAC AAG 1008 Ile Lys Leu Leu Thr Val Ile Lys Trp His Gly Pro Lys Cys Asn Lys 325 330 335 TTG AAC TCC AAG TTC TGG AAA CGT TTA CAG TAT GAA ATG CCT TTT AAG 1056 Leu Asn Ser Lys Phe Trp Lys Arg Leu Gln Tyr Glu Met Pro Phe Lys 340 345 350 AGG ATA GAA CCC ATT ACA CAT GAG CAG GCT TTA GAT GTC AGT GAG CAA 1104 Arg Ile Glu Pro Ile Thr His Glu Gln Ala Leu Asp Val Ser Glu Gln 355 360 365 GGG CCT TTT GGG GAG CTG CAG ACT GTC TCG GCC ATT TCC ATG GCC GCG 1152 Gly Pro Phe Gly Glu Leu Gln Thr Val Ser Ala Ile Ser Met Ala Ala 370 375 380 GCC ACC TCC ACA GCT CTA GCC ACT GCC CAT CCA GAT CTC CGT TGT ACC 1200 Ala Thr Ser Thr Ala Leu Ala Thr Ala His Pro Asp Leu Arg Cys Thr 385 390 395 400 TTT CAC AAC ACG TAC CAT TCA CAA ATG CGT CAG AAA CAC TAC TAC CGA 1248 Phe His Asn Thr Tyr His Ser Gln Met Arg Gln Lys His Tyr Tyr Arg 405 410 415 AGC TAT GAG TAC GAC GTA CCT CCT ACC GGC ACC CTG CCT CTT ACC TCC 1296 Ser Tyr Glu Tyr Asp Val Pro Pro Thr Gly Thr Leu Pro Leu Thr Ser 420 425 430 ATA GGC AAT CAG CAT ACC TAC TGT AAC ATC CCT ATG ACA CTC ATC AAC 1344 Ile Gly Asn Gln His Thr Tyr Cys Asn Ile Pro Met Thr Leu Ile Asn 435 440 445 GGG CAG CGG CCA CAG ACA AAA TCG AGC AGG GAG CAG AAT CCA GAT GAG 1392 Gly Gln Arg Pro Gln Thr Lys Ser Ser Arg Glu Gln Asn Pro Asp Glu 450 455 460 GCC CAC ACA AAC AGT GCC ATC CTG CCG CTG TTG CCA AGG GAG ACC AGT 1440 Ala His Thr Asn Ser Ala Ile Leu Pro Leu Leu Pro Arg Glu Thr Ser 465 470 475 480 ATA TCC AGT GTG ATA TGG TGACAGAAAA GCAAGGGACA TCCCGTCCCT 1488 Ile Ser Ser Val Ile Trp 485 GGGAGGTTGA GTCGGAATCT GCAGTCCAGT GCCTGGAACT AAATCCTCGA CTGCTGCTGT 1548 TAAAAAACAT GCATTAGAAT CTTTAGAACA CGAGGAAAAA CAGGGTCTTG TACATATGTT 1608 TTTTGGAATT TCTTTGTAGC ATCAGTGTCC TCCTGTTTTA CCATGTCTTT TACCATTACA 1668 TTTTTTGACT TTGTTTTATA TGTCGTTGGA ATTTGTAAAT TTACATTTTT TTTAAAGAAG 1728 AGACTGATGT GTAGATAGAA AACCCTTTTT TTGCTTCATT AGTTTACGCT TTTAGAATGG 1788 GTTTTTATTT TATTTCCTTT TTTAAAATTT TCACTTTGCT TTTCAACATT TCCCTCTGGG 1848 GTGCTTGAAC AAATCTATCC GATGGGACAA GGAGCACCGG ATTCTTTCTC GGGTTCTGCC 1908 TAGCATCAAC TGGGCCACGT CGGCCTTCAG AGAACAGTGC AACAAATGCC AGCATTGCCA 1968 TTCGGGGGGA AAAAAAAAAA AAAAAAAAAA CTCGAG 2004 Supplemented sequence of primate IL-1RD10 (SEQ ID NO: 34 and 35): GAT GGA TGC ACT GAC TGG TCT ATC GAT ATC AAG AAA TAT CAA GTT TTG 48 Asp Gly Cys Thr Asp Trp Ser Ile Asp Ile Lys Lys Tyr Gln Val Leu 1 5 10 15 GTG GGA GAG CCT GTT CGA ATC AAA TGT GCA CTC TTT TAT GGT TAT ATC 96 Val Gly Glu Pro Val Arg Ile Lys Cys Ala Leu Phe Tyr Gly Tyr Ile 20 25 30 AGA ACA AAT TAC TCC CTT GCC CAA AGT GCT GGA CTC AGT TTG ATG TGG 144 Arg Thr Asn Tyr Ser Leu Ala Gln Ser Ala Gly Leu Ser Leu Met Trp 35 40 45 TAC AAA AGT TCT GGT CCT GGA GAC TTT GAA GAG CCA ATA GCC TTT GAC 192 Tyr Lys Ser Ser Gly Pro Gly Asp Phe Glu Glu Pro Ile Ala Phe Asp 50 55 60 GGA AGT AGA ATG AGC AAA GAA GAA GAC TCC ATT TGG TTC CGG CCA ACA 240 Gly Ser Arg Met Ser Lys Glu Glu Asp Ser Ile Trp Phe Arg Pro Thr 65 70 75 80 TTG CTA CAG GAC AGT GGT CTC TAC GCC TGT GTC ATC AGG AAC TCC ACT 288 Leu Leu Gln Asp Ser Gly Leu Tyr Ala Cys Val Ile Arg Asn Ser Thr 85 90 95 TAC TGT ATG AAA GTA TCC ATC TCA CTG ACA GTG GGT GAA AAT GAC ACT 336 Tyr Cys Met Lys Val Ser Ile Ser Leu Thr Val Gly Glu Asn Asp Thr 100 105 110 GGA CTC TGC TAT AAT TCC AAG ATG AAG TAT TTT GAA AAA GCT GAA CTT 384 Gly Leu Cys Tyr Asn Ser Lys Met Lys Tyr Phe Glu Lys Ala Glu Leu 115 120 125 AGC AAA AGC AAG GAA ATT TCA TGC CGT GAC ATA GAG GAT TTT CTA CTG 432 Ser Lys Ser Lys Glu Ile Ser Cys Arg Asp Ile Glu Asp Phe Leu Leu 130 135 140 CCA ACC AGA GAA CCT GAA ATC CTT TGG TAC AAG GAA TGC AGG ACA AAA 480 Pro Thr Arg Glu Pro Glu Ile Leu Trp Tyr Lys Glu Cys Arg Thr Lys 145 150 155 160 ACA TGG AGG CCA AGT ATT GTA TTC AAA AGA GAT ACT CTG CTT ATA AGA 528 Thr Trp Arg Pro Ser Ile Val Phe Lys Arg Asp Thr Leu Leu Ile Arg 165 170 175 GAA GTC AGA GAA GAT GAC ATT GGA AAT TAT ACC TGT GAA TTA AAA TAT 576 Glu Val Arg Glu Asp Asp Ile Gly Asn Tyr Thr Cys Glu Leu Lys Tyr 180 185 190 GGA GGC TTT GTT GTG AGA AGA ACT ACT GAA TTA ACT GTT ACA GCC CCT 624 Gly Gly Phe Val Val Arg Arg Thr Thr Glu Leu Thr Val Thr Ala Pro 195 200 205 CTG ACT GAT AAG CCA CCC AAG CTT TTG TAT CCT ATG GAA AGT AAA CTG 672 Leu Thr Asp Lys Pro Pro Lys Leu Leu Tyr Pro Met Glu Ser Lys Leu 210 215 220 ACA ATT CAG GAG ACC CAG CTG GGT GAC TCT GCT AAT CTA ACC TGC AGA 720 Thr Ile Gln Glu Thr Gln Leu Gly Asp Ser Ala Asn Leu Thr Cys Arg 225 230 235 240 GCT TTC TTT GGG TAC AGC GGA GAT GTC AGT CCT TTA ATT TAC TGG ATG 768 Ala Phe Phe Gly Tyr Ser Gly Asp Val Ser Pro Leu Ile Tyr Trp Met 245 250 255 AAA GGA GAA AAA TTT ATT GAA GAT CTG GAT GAA AAT CGA GTT TGG GAA 816 Lys Gly Glu Lys Phe Ile Glu Asp Leu Asp Glu Asn Arg Val Trp Glu 260 265 270 AGT GAC ATT AGA ATT CTT AAG GAG CAT CTT GGG GAA CAG GAA GTT TCC 864 Ser Asp Ile Arg Ile Leu Lys Glu His Leu Gly Glu Gln Glu Val Ser 275 280 285 ATC TCA TTA ATT GTG GAC TCT GTG GAA GAA GGT GAC TTG GGA AAT TAC 912 Ile Ser Leu Ile Val Asp Ser Val Glu Glu Gly Asp Leu Gly Asn Tyr 290 295 300 TCC TGT TAT GTT GAA AAT GGA AAT GGA CGT CGA CAC GCC AGC GTT CTC 960 Ser Cys Tyr Val Glu Asn Gly Asn Gly Arg Arg His Ala Ser Val Leu 305 310 315 320 CTT CAT AAA CGA GAG CTA ATG TAC ACA GTG GAA CTT GCT GGA GGC CTT 1008 Leu His Lys Arg Glu Leu Met Tyr Thr Val Glu Leu Ala Gly Gly Leu 325 330 335 GGT GCT ATA CTC TTG CTG CTT GTA TGT TTG GTG ACC ATC TAC AAG TGT 1056 Gly Ala Ile Leu Leu Leu Leu Val Cys Leu Val Thr Ile Tyr Lys Cys 340 345 350 TAC AAG ATA GAA ATC ATG CTC TTC TAC AGG AAT CAT TTT GGA GCT GAA 1104 Tyr Lys Ile Glu Ile Met Leu Phe Tyr Arg Asn His Phe Gly Ala Glu 355 360 365 GAG CTC GAT GGA GAC AAT AAA GAT TAT GAT GCA TAC TTA TCA TAC ACC 1152 Glu Leu Asp Gly Asp Asn Lys Asp Tyr Asp Ala Tyr Leu Ser Tyr Thr 370 375 380 AAA GTG GAT CCT GAC CAG TGG AAT CAA GAG ACT GGG GAA GAA GAA CGT 1200 Lys Val Asp Pro Asp Gln Trp Asn Gln Glu Thr Gly Glu Glu Glu Arg 385 390 395 400 TTT GCC CTT GAA ATC CTA CCT GAT ATG CTT GAA AAG CAT TAT GGA TAT 1248 Phe Ala Leu Glu Ile Leu Pro Asp Met Leu Glu Lys His Tyr Gly Tyr 405 410 415 AAG TTG TTT ATA CCA GAT AGA GAT TTA ATC CCA ACT GGA ACA TAC ATT 1296 Lys Leu Phe Ile Pro Asp Arg Asp Leu Ile Pro Thr Gly Thr Tyr Ile 420 425 430 GAA GAT GTG GCA AGA TGT GTA GAT CAA AGC AAG CGG CTG ATT ATT GTC 1344 Glu Asp Val Ala Arg Cys Val Asp Gln Ser Lys Arg Leu Ile Ile Val 435 440 445 ATG ACC CCA AAT TAC GTA GTT AGA AGG GGC TGG AGC ATC TTT GAG CTG 1392 Met Thr Pro Asn Tyr Val Val Arg Arg Gly Trp Ser Ile Phe Glu Leu 450 455 460 GAA ACC AGA CTT CGA AAT ATG CTT GTG ACT GGA GAA ATT AAA GTG ATT 1440 Glu Thr Arg Leu Arg Asn Met Leu Val Thr Gly Glu Ile Lys Val Ile 465 470 475 480 CTA ATT GAA TGC AGT GAA CTG AGA GGA ATT ATG AAC TAC CAG GAG GTG 1488 Leu Ile Glu Cys Ser Glu Leu Arg Gly Ile Met Asn Tyr Gln Glu Val 485 490 495 GAG GCC CTG AAG CAC ACC ATC AAG CTC CTG ACG GTC ATT AAA TGG CAT 1536 Glu Ala Leu Lys His Thr Ile Lys Leu Leu Thr Val Ile Lys Trp His 500 505 510 GGA CCA AAA TGC AAC AAG TTG AAC TCC AAG TTC TGG AAA CGT TTA CAG 1584 Gly Pro Lys Cys Asn Lys Leu Asn Ser Lys Phe Trp Lys Arg Leu Gln 515 520 525 TAT GAA ATG CCT TTT AAG AGG ATA GAA CCC ATT ACA CAT GAG CAG GCT 1632 Tyr Glu Met Pro Phe Lys Arg Ile Glu Pro Ile Thr His Glu Gln Ala 530 535 540 TTA GAT GTC AGT GAG CAA GGG CCT TTT GGG GAG CTG CAG ACT GTC TCG 1680 Leu Asp Val Ser Glu Gln Gly Pro Phe Gly Glu Leu Gln Thr Val Ser 545 550 555 560 GCC ATT TCC ATG GCC GCG GCC ACC TCC ACA GCT CTA GCC ACT GCC CAT 1728 Ala Ile Ser Met Ala Ala Ala Thr Ser Thr Ala Leu Ala Thr Ala His 565 570 575 CCA GAT CTC CGT TCT ACC TTT CAC AAC ACG TAC CAT TCA CAA ATG CGT 1776 Pro Asp Leu Arg Ser Thr Phe His Asn Thr Tyr His Ser Gln Met Arg 580 585 590 CAG AAA CAC TAC TAC CGA AGC TAT GAG TAC GAC GTA CCT CCT ACC GGC 1824 Gln Lys His Tyr Tyr Arg Ser Tyr Glu Tyr Asp Val Pro Pro Thr Gly 595 600 605 ACC CTG CCT CTT ACC TCC ATA GGC AAT CAG CAT ACC TAC TGT AAC ATC 1872 Thr Leu Pro Leu Thr Ser Ile Gly Asn Gln His Thr Tyr Cys Asn Ile 610 615 620 CCT ATG ACA CTC ATC AAC GGG CAG CGG CCA CAG ACA AAA TCG AGC AGG 1920 Pro Met Thr Leu Ile Asn Gly Gln Arg Pro Gln Thr Lys Ser Ser Arg 625 630 635 640 GAG CAG AAT CCA GAT GAG GCC CAC ACA AAC AGT GCC ATC CTG CCG CTG 1968 Glu Gln Asn Pro Asp Glu Ala His Thr Asn Ser Ala Ile Leu Pro Leu 645 650 655 TTG CCA AGG GAG ACC AGT ATA TCC AGT GTG ATA TGG TGACAGAAAA 2014 Leu Pro Arg Glu Thr Ser Ile Ser Ser Val Ile Trp 660 665 GCAAGGGACA TCCCGTCCCT GGGAGGTTGA GTGGAATCTG CAGTCCAGTG CCTGGAACTA 2074 AATCCTCGAC TGCTGCTGTT AAAAAACATG CATTAGAATC TTTAGAACAC GAGGAAAAAC 2134 AGGGTCTTGT ACATATGTTT TTTGGAATTT CTTTGTAGCA TCAGTGTCCT CCTGTTTTAC 2194 CATGTCTTTT ACCATTACAT TTTTTGACTT TGTTTTATAT GTCGTTGGAA TTTGTAAATT 2254 TACATTTTTT TTAAAGAAGA GACTGATGTG TAGATAGAAA ACCCTTTTTT TGCTTCATTA 2314 GTTTAGTTTT AGAATGGGTT TTTATTTTAT TTCCTTTTTT AAAATTTTAC TTTGCTTTTA 2374 ACATTTCCTT GGGGTGCTTG AACAAATCTA TCCGATGGGA CAAGGAGCAC CGGATTCTTT 2434 CTCGGGTTCT GCCTAGCATC AACTGGGCCA CGTCGGCCTT CAGAGAACAG TGCAACAAAT 2494 GCCAGCATTG CCATTCGGGG GGAAAAAAAA AAAAAAAAAA AAA 2537
[0065] 4 TABLE 4 Alignment of the extracellular domains of various IL-1Rs. hIL-1RD10 is SEQ ID NO: 20; hIL-1RD8 is SEQ ID NO: 3; mIL-1RD3 is GenBank X85999; hIL-1RD6 is GenBank U49065; rIL-1RD6 is GenBank U49066; mIL-1RD4 is GenBank Y07519 and GenBank D13695; hTL-1RD4 is GenBank D12763; hIL-1RD2 is GenBank X59770; mIL-1RD2 is GenBank X59769; hIL-1RD5 is GenBank U43672; mIL-1RD5 is GenBank U43673; mIL- 1RD1 is GenBank M20658, M29752; hIL-1RD1 is GenBank X16896; cIL-1RD1 is GenBank 86325; and hFGR4 is GenBank P22455. Other species counterparts may be obtained from public sequence databases. mIL-1RD3 .......... ......MGLL WYLMSLSFYG ILQSHASERC DDWLDTMR.. hIL-1RDG .......... .........M WSLLLCGLSI ALPLSVTADG CKDIFMKN.. rIL-1RDG .......... .......MGM PPLLFCWVSF VLPLFVAAGN CTDVYMHH.. mIL-1RD4 .......... ........MI DRQRMGLWAL AILTLPMYLT VTEGSKSS.. hIL-1RD4 .......... ........MG FWILAILTIL MYSTAAKFSK QS........ hIL-1RD2 .......... ....MLRLYV LVMGVSAFTL QPAAHTGAAR SCRFRGRHYK mIL-1RD2 MFILLVLVTG VSAFTTPTVV HTGKVSESPI TSEKPTVHGD NCQFRGREFK hIL-1RD10 .......... .......... .......... .......... .......... hIL-1RD5 .......... .....MNCRE LPLTLWVLIS VSTAESCTSR PHITVVE... mIL-1RD5 .......... .....MHHEE LILTLCILIV KSASKSCIHR SQIHVVE... mIL-1RD1 .......... .....MENMK VLLGLICLMV PLLSLEIDVC TEYPNQIVLF hIL-1RD1 .......... ........MK VLLRLICFIA LLISSLEADK CKEREEKIIL cIL-1RD1 .......... .... MHKMT STFLLIGHLI LLIPLFSAEE CVICNYFVLV hIL-1RD8 .........M KPPFLLALVV CSVVSTNLKM VSKRNSVDGC IDWSVDLKTY hFGR4 ...MRLLLAL LGVLLSVPGP PVLSLEASEE VELEPCLAPS LEQQEQELTV mIL-1RD3 QIQVFEDEPA RIKCPLFEHF LKYNYSTAHS SGLTLLWYWT RQDRDLEEPI hIL-1RD6 .EILSASQPF AFNCTFPPI. ........TS GEVSVTWYKN ....SSKIPV rIL-1RD6 .EMISEGQPF PFNCTYPPV. ........TN GAVNLTWHRT ....PSKSPI mIL-1RD4 ..WGLENEAL IVRCPQRG.. .........R STYPVEWYYS ....DTNESI hIL-1RD4 ..WGLENEAL IVRCPRQG.. .........K PSYTVDWYYS ....QTNKSI hIL-1RD2 REFRLEGEPV ALRCPQVPYW LWA....SVS PRINLTWHKN ....DSARTV mIL-1RD2 SELRLEGEPV VLRCPLAPHS DIS.....SS SHSFLTWSKL ....DSSQLI hIL-1RD10 .......... .......... .......... .......... .......... hIL-1RD5 .....GEPFY LKHCSCSLAH ........EI ETTTKSWYKS ...SGSQEHV mIL-1RD5 .....GEPFY LKPCGISAPV .......HRN ETATMRWFKG ...SASHEYR mIL-1RD1 LSV...NEID IRKCPLTPN. ........KM HGDTIIWYKN ....DSKTPI hIL-1RD1 VSS..ANEID VRPCPLNPN. .........E HKGTITWYKD ....DSKTPV cIL-1RD1 ......GEPT AISCPVITL. ......PMLH SDYNLTWYRN ....GSNMPI hIL-1RD8 ..MALAGEPV RVKCALFYSY IRTNYSTAQS TGLRLMWYKN ..KGDLEEPI hFGR4 ....ALGQPV RLCCGRAERG G......... .....HWYKE ....GSRLAP mIL-1RD3 NFRLP.ENRI SKEKDVLWFR PTLLNDTGNY TCMLRNTTYC SKVAFPLEVV hIL-1RD6 SKII..QSRI HQDETWILFL PMEWGDSGVY QCVIKGRDSC HRIHVNLTVF rIL-1RD6 SINR..HVRI HQDQSWILFL PLALEDSGIY QCVIKDAHSC YRIAINLTVF mIL-1RD4 PTQK..RNRI FVSRDRLKFL PARVEDSGIY ACVIRSPNLN KTGYLNVTIH hIL-1RD4 PTQE..RNRV FASGQLLKFL PAEVADSGIY TCIVRSPTFN RTGYANVTIY hIL-1RD2 PGEE..ETRM WAQDGALWLL PALQEDSGTY VCTTRNASYC DKMSIELRVF mIL-1RD2 PRDEP...RM WVKGNILWIL PAVQQDSGTY ICTFRNASHC EQMSVELKVF hIL-1RD10 .......... .......... .......... .......... .......... hIL-1RD5 ELNPRSSSRI ALHDCVLEFW PVELNDTGSY FFQMKN..YT QKWKLNVIRR mIL-1RD5 ELNNRSSPRV TFHDHTLEFW PVEMEDEGTY ISQVGN..DR RNWTLNVTKR mIL-1RD1 SADR..DSRI HQQNEHLWFV PAKVEDSGYY YCIVRNSTYC LKTKVTVTVL hIL-1RD1 STEQ..ASRI HQHKEKLWFV PAKVEDSGHY YCVVRNSSYC LRIKISAKFV cIL-1RD1 TTER..RARI HQRKGLLWFI PAALEDSGLY ECEVRSLNRS KQKIINLKVF hIL-1RD8 IFS...EVRN SKEEDSIWFH SAEAQDSGFY TCVLRNSTYC MKVSMSLTVA hFGR4 AG......RV RGWRGRLEIA SFLPEDAGRY LCLARGSMIV LQNLTLITGD mIL-1RD3 QK........ .......... .......DSC FNSANRFPVH KMYIEHGIHK hIL-1RD6 EK........ .......... .HWCDTSIGG LP.NLSDEYK QILHLGKDDS rIL-1RD6 RK........ .......... .HWCDSSNEE SSINSSDEYQ QWLPIGKSGS mIL-1RD4 KK........ .......... .....PPSCN .IPDY.LNYS TVRGSDKNFK hIL-1RD4 KK........ .......... .....QSDCN .VPDY.LMYS TVSGSEKNSK hIL-1RD2 EN........ .......... .......TDA FLPFI..SYP QILTLSTSGV mIL-1RD2 KN........ .......... .......TEA SLPHV..SYL QISALSTTGL hIL-1RD10 .......... .......... .......... .......... .......... hIL-1RD5 NK........ .......... .......HSC FTERQ..VTS KIVEVKKFFQ mIL-1RD5 NK........ .......... .......HSC FSDKL..VTS RDVEVNKSLH mIL-1RD1 EN........ .......... .....DPGIC .YSTQ.ATFP QRLHIAGDGS hIL-1RD1 EN........ .......... .....EPNLC .YNAQ.AIFK QKLPVAGDGG cIL-1RD1 KN........ .......... .....DNGLC .FNGE.MKYD QIVKSANAGK hIL-1RD8 EN........ .......... .....ESGLC .YNSR.IRYL EKSEVTKRKE hFGR4 SLTSSNDDED PKSHRDPSNR HSYPQQAPYW THPQRMEKKL HAVPAGNTVK mIL-1RD3 ITCPNVDGYF P.SSVKPSVT WYKGCTEIVD FHN...VLPE GMNLSFFIPL hIL-1RD6 LTCHLHFPKS ...CVLGPIK WYKDCNEIKG E......RFT VLETRLLVSN rIL-1RD6 LTCHLYFPES ...CVLDSIK WYKGCEEIKV S.....KKFC PTGTKLLVNN mIL-1RD4 ITCPTIDLY ...NWTAPVQ WFKNCKALQE P......RFR AHRSYLFIDN hIL-1RD4 IYCPTIDLY ...NWTAPLE WFKNCQALQG S......RYR AHKSFLVIDN hIL-1RD2 LVCPDLSEFT R.DKTDVKIQ WYKDSLLLDK DNEK..FLSV RGTTHLLVHD mIL-1RD2 LVCPDLKEFI S.SNADGKIQ WYKGAILLDK GNKE..FLSA GDPTRLLISN hIL-1RD10 .......... .......... .......... .......... .......... hIL-1RD5 ITCENEYYQ ...TLVNSTS LYKNCKKLLL ENN....KNP TIKKNAEF.. mIL-1RD5 ITCKNPNYE ...ELIQDTW LYKNCKEISK TPRI...LKD AEFGDAEF.. mIL-1RD1 LVCPYVSYFK DENNELPEVQ WYKNCKPLLL DN....VSFF GVKDKLLVRN hIL-1RD1 LVCPYMEFFK NENNELPKLQ WYKDCKPLLL DN....IHFS GVKDRLTVMN cIL-1RD1 IICPDLENFK DEDNINPEIH WYKECKSGFL EDKR..LVLA EGENAILILN hIL-1RD8 ISCPDMDDFK KED.QEPDVV WYKECKPKMW R.....SIII QKGNALLIQE hFGR4 FRCPAAG... ...NPTPTIR WLKDGQAFHG ENRIGGIRLR HQHWSLVMES mIL-1RD3 VSNN..GNYT CVVTYPENGR LFHLTRTVTV KVVGS.PKDA LPPQIYSPND hIL-1RD6 VSAEDRGNYA CQAILTHSGK QYEVLNGITV SITERAGYGG SVP.KIIYPK rIL-1RD6 IDVEDSGSYA CSARLTHLGR IFTVRNYIAV NTKE.VGSGG RIP.NITYPK mIL-1RD4 VTHDDEGDYT CQFTHAENGT NYIVTATRSF TVE.EKGFS MFPVITNPPY hIL-1RD4 VMTEDAGDYT CKFIHNENGA NYSVTATRSF TVKDEQGFS LFPVIGAPAQ hIL-1RD2 VALEDAGYYR CVLTFAHEGQ QYNITRSIEL RIKKK..KEE TIPVIISP.. mIL-1RD2 TSMDDAGYYR CVMTFTYNGQ EYNITRNIEL RVKGT..TTE PIPVIISP.. hIL-1RD10 ...EFG..TS CEL..KYGGF V..VRRTTEL TVTAPLTDKP PKLLYPMESK hIL-1RD5 ...EDQGYYS CVHFLNHNGK LFNITKTFNI TIVED..RSN IVPVLLGP.K mIL-1RD5 ...GDEGYYS CVFSVHHNGT RYNITKTVNI TVIEG..RSK VTPAILGP.K mIL-1RD1 VAEEHRGDYI CRMSYTFRGK QYPVIRVTQF ITIDE..NKR DRPVILSP.R hIL-1RD1 VAEKHRGNYT CHASYTYLGK QYPITRVIEF ITLEE..NKP TRPVIVSP.A cIL-1RD1 VTIQDKGNYT CRMVYTYMGK QYNVSRTMNL EVKES..PLK MRPEFIYP.N hIL-1RD8 VQEEDGGNYT CEL..KYEGK L..VRRTTEL KVTALLTDKP PKPLFPMENQ hFGR4 VVPSDRGTYT CLVENAVGSI RYNYLLDVLE RSPH..RPIL QAGLPANTT. mIL-1RD3 RVVYEKEPGE ELVIPCKVYF SFIMD.SHNE VWWTIDGKKP .DDVTVDITI hTL-1RD6 NHSTEVQLGT TLIVDCNVTD TK..D.NTNL RCWRVNNTLV DDYYDESKRI rIL-1RD6 NNSIEVQLGS TLIVDCNITD TK..E.NTNL RCWRVNNTLV DDYYNDFKRI mIL-1RD4 NHTMEVEIGK PASIACSACF GKGSH.FLAD VLWQINKTVV GNFGEARIQE hIL-1RD4 NEIKEVEIGK NANLTCSACF GKGTQ.FLAA VLWQLNGTKI TDFGEPRIQQ hIL-1RD2 LKTTSASLGS RLTTPCKVFL GTGTP.LTTM LWWTANDTHI .ESAYPGGRV mIL-1RD2 LETIPASLGS RLIVPCKVFL GTGTS.SNTI VWWLANSTFI .SAAYPRGRV hIL-1RD10 LTIQETQLGD SANLTCRAFF GYSGD.VSPL IYWMKGEKFI EDLDENRVWE hTL-1RD5 LNHVAVELGK NVRLNCSALL N.....EEDV IYWNFGEENG ...SDPNIHE mIL-1RD5 CEKVGVELGK DVELNCSASL N.....KDDL FYWSIRKEDS ...SDPNVQE mIL-1RD1 NETIEADPGS MIQLICNVTG Q.....FSDL VYWKWNGSEI .EWNDPFLAE hIL-1RD1 NETMEVDLGS QIQLICNVTG Q.....LSDI AYWKWNGSVI .DEDDPVLGE cIL-1RD1 NNTIEVELGS HVVMECNVSS GV....YGLL PYWQVNDEDV .DSFDSTYRE hIL-1RD8 PSVIDVQLGK PLNIPCKAFF GFSGE.SGPM IYWMKGEKFI .EELAGHIRE hFGR4 .....AVVGS DVELLCKVYS DA...QPHIQ ..WLKHIVIN GSSFGA..DG mIL-1RD3 NESVSYSSTE D..ETRTQIL SIKKVTPEDL RRNYVCHARN TKGEAEQAAK hIL-1RD6 REGVETHVSF REHNLYTVNI TFLEVKMEDY GLPFMCHAG ...VSTAYII rIL-1RD6 QEGTETNLSL RNHILYTVNI TFLEVKMEDY GHPFTCHAA ...VSAAYII mIL-1RD4 EEGRNESSSN D.MDCLTSVL RITGVTEKDL SLEYDCLALN LHGMIRHTIR hIL-1RD4 EEGQNQSFSN G.LACLDMVL RIADVKEEDL LLQYDCLALN LHGLRRHTVR hIL-1RD2 TEGPRQEYSE NNENYIEVPL IFDPVTREDL HMDFKCVVHN TLSFQTLRTT mIL-1RD2 TEGLHHQYSE NDENYVEVSL IFDPVTREDL HTDFKCVASN PRSSQSLHTT hIL-1RD10 SDIRILKEHL G.EQEVSISL IVDSVEEGDL .GNYSCYVEN GNGRRHASVL hIL-1RD5 EKEMRIMTPE G.KWHASKVL RIENIGESNL NVLYNCTVAS TGGTDTKSFI mIL-1RD5 DRKETTTWIS EGKLHASKIL RFQKITENYL NVLYNCTVAN EEAIDTKSFV mIL-1RD1 DYQFVEHPST KRKYTLITTL NISEVKSQFY RYPFICVVKN TNIFESAHVQ hIL-1RD1 DYYSVENPAN KRRSTLITVL NISEIESRFY KHPFTCFAKN THGIDAAYIQ cIL-1RD1 QFYEEGMPHG ..IAVSGTKF NISEVKLKDY AYKFFCHFIY DSQEFTSYIK hIL-1RD8 GEIRLLKEHL G.EKEVELAL IFDSVVEADL AN.YTCHVEN RNGRKHASVL hFGR4 FPYVQVLKTA DINSSEVEVL YLRNVSAED AGEYTCLAGN SIGLSYQSAW mIL-1RD3 VKQKV....I PPRYTVELAC GFGATVFLVV VLIVVY hIL-1RD6 LQLP.....A PDFRAYLIGG LIALVAVAVS VVYIYNIFKI DIVLWY rIL-1RD6 LKRP.....A PDFRAYLIGG LMAFLLLAVS ILYIYNTFKV DIVLWY mIL-1RD4 LRRK.....Q PSKECPSHIA IYYIVAGCSL LLMFINVLVI VL hIL-1RD4 LSRK.....N PSKEC hIL-1RD2 VKEASS .TFSWGIVLA PLSLAFLVLG GIWM mIL-1RD2 VKEVSS .TFSWSIALA PLSLIILVVG AIW. hIL-1RD10 LHKREL .MYTVELAGG LGATLLLLVC LVTIYKCY hIL-1RD5 LVRKADMADI P..GHVFTRG MIIAVLILVA VVCLVTVCVI Y mIL-1RD5 LVRKEIPDIP ...GHVFTGG VTVLVLASVA AVCIVILCVI Y mIL-1RD1 LTYP.....V PDFKNYLIGG FIILTATIVC CVCIY hIL-1RD1 LIYP.....V TNFQKHMIGI CVTLTVIIVC SVFIY cIL-1RD1 LEHP.....V QNIRGYLIGG GISLIFLLFL ILIVY hIL-1RD8 LRKKDL .TYKIELAGG LGAIFLLLVL LVVIYKCY hFGR4 LTVLP....E EDPTWTAAAP EARYTDIILY ASGSLALAVL LLLAGLY Alignment of the intracellular domains of various IL-1Rs. hIL-1RD9 is SEQ ID NO: 8; mIL-1RD9 is SEQ ID NO: 14; hIL-1RD1 is GenBank X16896; hIL-1RD6 is GenBank U49065; mIL-1RD3 is GenBank X85999; huIL-1RD8 is SEQ ID NO: 3; and mIL-1RD4 is GenBank Y07519. HuIL-1RD1 SDGKTYDAYI LYPKTVGEG. ..STSDCDIF VFKVLPEVLE KQCGYKLFIY HuIL-1RD6 VDGKLYDAYV LYPKPHKES. ..QRHAVDAL VLNILPEVLE RQCGYKLFIF MoIL-1RD3 LDGKEYDIYV SYAR...... ...NVEEEEF VLLTLRGVLE NEFGYKLCIF HuIL-1RD8 DDNKEYDAYL SYTKVDQDTL DCDNPEEEQF ALEVLPDVLE KHYGYKLFIP HuIL-1RD5 TDGKTYDAFV SYLKECRP.. ..ENGEEHTF AVEILPRVLE KHFGYKLCIF MoIL-1RD9 .......... .......... .......... .......... .......... HuIL-1RD9 .......... .......... .......... .......... .KYGYSLCLL MoIL-1RD4 NDGKLYDAYI IYPRVFRGS AAGTHSVEYF VHETLPDVLE NKCGYKLCIY HuIL-1RD1 GRDDYV.GED IVEVINENVK KSRRLIIILV RETSGFSWLG GSSEEQIAMY HuIL-1RD6 GRDEFP.GQA VANVIDENVK LCRRLIVIVV PESLGFGLLK NLSEEQIAVY MoIL-1RD3 DRDSLPGGIV TDETLS.FIQ KSRRLLVVLS PNYVLQG.TQ ALLELKAGLE HuIL-1RD8 ERDLIPSG.T YMEDLTRYVE QSRRLIIVLT PDYILRR.GW SIFELESRLH HuIL-1RD5 ERDVVPGGAV VDEIHS.LIE KSRRLIIVLS KSYMSN...E VRYELESGLH MoIL-1RD9 DRDVTP.GGV YADDIVSIIK KSRRGIFILS PSYLNG...P RVFELQAAVN HuIL-1RD9 ERDVAP.GGV YAEDIVSIIK RSRRGIFILS PNYVNG...P SIFELQAAVN MoIL-1RD4 GRDLLP.GQD AATVVESSIQ NSRRQVFVLA PHNMHSK..E FAYEQEIALH HuIL-1RD1 NALVQDGIKV VLLELEKIQ. .....DYEKM PESIKFIKQK HGAIRWSGDF HuIL-1RD6 SALIQDGMKV ILIELEKIE. .....DYTVM PESIQYIKQK HGAIRWHGDF MoIL-1RD3 NMASRGNINV ILVQYKAVK. ...DMKVKEL KRAKTVLT.. ..VIKWKGEK HuIL-1RD8 NMLVSGEIKV ILIECTELKG KVNCQEVESL KRSIKLLS.. ..LIKWKGSK HuIL-1RD5 EALVERKIKI ILIEFTPVT. .....DFTFL PQSLKLLKSH R.VLKWKADK MoIL-1RD9 LALVDQTLKL ILIKFCSFQ. .....EPESL PYLVKKALRV LPTVTWKGLK HuIL-1RD9 LALDDQTLKL ILIKFCYFQ. .....EPESL PHLVKKALRV LPTVTWRGLK MoIL-1RD4 SALIQNNSKV ILIEMEPLG. EASRLQVGDL QDSLQHLVKI QGTIKWREDH HuIL-1RD1 TQGPQSAKTR FWKNVRYHMP VQRRSPSSKH HuIL-1RD6 TEQSQCMKTK FWKTVRYHMP PRRCRPFLRS MoIL-1RD3 SKYPQ...GR FWKQLQVAMP VKKSPRWSSN HuIL-1RD8 SSKLN...SK FWKHLVYEMP IKKKEMLPRC HuIL-1RD5 SLSYN...SR FWKNLLYLMP AKTVKPGRDE MoIL-1RD9 SVHAS...SR FWTQIRYHMP VKNSNRFMFN HuIL-1RD9 SVPPN...SR FWAKMRYHMP VKNSQGFTWN MoIL-1RD4 VADKQSLSSK FWKHVRYQMP VPERASKTAS hRD8 MKPPFLLALVVCSVVSTNLKMVSKRNSVDGCIDWSVD-LKTYMALAGEPV hRD10 ----------------------------DGCTDWSTD-IKKYQVLVGEPV hRD3 ------MTLLWC-VVSLYFYGILQSDASERCDDWGLDTMRQIQVFEDEPA mRD3 ------MGLLWY-LMSLSFYGILQSHASERCDDWGLDTMRQIQVFEDEPA : * **.:* :: .:.**. hRD8 RVKCALFYSYIRTNYSTAQSTGLRLMWYKNKG--DLEEPIIFS--EVRMS hRD10 RIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFD--GSRMS hRD3 RIKCPLFEHFLKFNYSTAHSAGLTLIWYWTRQDRDLEEPINFRLPENRIS mRD3 RIKCPLFEHFLKYNYSTAHSSGLTLIWYWTRQDRDLEEPINFRLPENRIS *:**.** :::****:*:***:**. *:**** * *:* hRD8 KEEDSIWFHSAEAQDSGFYTCVLRNSTYCMKVSMSLTVAENESGLCYNSR hRD10 KEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSK hRD3 KEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDS--CFNSP mRD3 KEKDVLWFRPTLLNDTGNYTCMLRNTTYCSKVAFPLEVVQKDS--CFNSA **:*.:**:.: :*:* *:*::**:*** **::.*.*.:::: *:** hRD8 IRY-LEKSEVTK-RKEISCPDMDDFKKSDQEPDVVWYKECKPKMWRSIII hRD10 MKY-FEKAELSK-SKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIV hRD3 MKLPVHKLYIEYGIQRITCPNVDGYFPSSVKPTITWYMGCYKIQNFNNVI mRD3 MRFPVHKMYIEHGIHKITCPNVDGYFPSSVKPSVTWYKGCTEIVDFHNVL :: * : :.*:*.:::.: . :*:** * :: hRD8 QKGN--ALLIQEVQEEDGGNYTCELKY--EGKLVRRTTELKVTALLTDK hRD10 FKRD--TLLIREVREDDIGNYTCELKY--GGFVVRRTTELTVTAPLTDK hRD3 PEGMNLSFLIALISNN--GNYTCVVTYPENGRTFHLTRTLTVKVVGSPKN mRD3 PEGMNLSFFIPLVSNN--GNYTCVVTYPENGRLFHLTRTVTVKVVGSPKD : :::* ::: *****:.* * .:.* :.*.. :* hRD8 --PPKPLFPMENQPSVIDVQLGKPLNIPCKAFFGFSGESGPMIYWMKGEK hRD10 --PPKLLYPMESKLTTQETQLGDSANLTCRAFFGYSGDVSPLIYWMKGEK hRD3 AVPPVIHSPNDH--VVYEKEPGEELLIPCTVYFSFLMDSRNEVWWTIDGK mRD3 ALPPQIYSPNDR--VVYEKEPGEELVIPCKVYFSFIMDSHNEVWWTIDGK ** *.: :.:.:.*. :.* :*.: : ::* . * hRD8 FIEEL-AGHIREGEIRLLKEHLGEKEVELALIFDSVVEADLA-NYTCHVE hRD10 FIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLG-NYSCYVE hRD3 KPDDI-TIDVTINESISHSRTEDETRTQI-LSIKKVTSEDLKRSYVCHAR mRD3 KPDDV-TVDITINESVSYSSTEDETRTQI-LSIKKVTPEDLRRNYVCHAR ::: : : . . * ...: * .* ** .* *:.. hRD8 NRNGR--KHASVLLRKKDLIYKIELAGGLGAIFLLLVLLVVIYKCYNIEL hRD10 NGNGR--RHASVLLHKRELMYTVELAGGLGAILLLLVCLVTIYKCYKIEI hRD3 SAKGEVAKAAKVKQKVPAPRYTVELACGFGATVLLVVILIVVYHVYWLEM mRD3 NTKGEAEQAAKVKQKVIPPRYTVELACGFGATVFLVVVLIVVYHVYWLEM . :*. : *.* : *.:*** *:** .:*:* *: :*: * :*: hRD8 MLFYRQHFGADETNDDNKEYDAYLSYTKVDQDTLDCDNPEEEQFALEVLP hRD10 MLFYRNHFGAEELDGDNKDYDAYLSYTKVDPDQWNQETGEEERFALEILP hRD3 VLFYRAHFGTDETILDGKEYDIYVSYAR---------NAEEEEFVLLTLR mRD3 VLFYRAHFGTDETILDGKEYDIYVSYAR---------NVEEEEFVLLTLR :**** ***::* *.*:** *:**:: . ***.*.* * hRD8 DVLEKHYGYKLFIPERDLIPSGTYMEDLTRYVEQSRRLIIVLTPDYILRR hRD10 DMLEKHYGYKLFIPDRDLIPTGTYIEDVARCVDQSKRLIIVMTPNYVVRR hRD3 GVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQG mRD3 GVLENEFGYKLCIFDRDSLPGGIVTDETLSFIQKSRRLLVVLSPNYVLQG .:**:.:**** * :** :* * :: :::*:**::*::*:*::: hRD8 GWSIFELESRLHNMLVSGEIKVILIECTELKGKVNCQEVESLKRSIKLLS hRD10 GWSIFELETRLRNMLVTGEIKVILIECSELRGIMNYQEVEALKHTIKLLT hRD3 TQALLELKAGLENMASRGNINVILVQYKAVK----ETKVKELKRAKTVLT mRD3 TQALLELKAGLENMASRGNINVILVQYKAVK----DMKVKELKRAKTVLT :::**:: *.** *:*:***:: . :: :*: **:: .:*: hRD8 LIKWKGSKSSKLNSKFWKHLVYEMPIKKKEMLPRCHVLDSAEQGL-FGEL hRD10 VIKWHGPKCNKLNSKFWKRLQYEMPFKRIEPITHEQALDVSEQGP-FGEL hRD3 VIKWKGEKSKYPQGRFWKQLQVAMPVKKS---PRRSSSD--EQGLSYSSL mRD3 VIKWKGEKSKYPQGRFWKQLQVAMPVKKS---PRWSSND--KQGLSYSSL :***:* *.. :.:***:* **.*: .: * :** :..* hRD8 QPIPSIAMTS-TSATLVSSQADLP-EFHPS--DSMQIRHCCRGYKHEIPA hRD10 QTVSAISMAAATSTALATAHPDLRSTFHNTYHSQMRQKHYYRSYEYDVPP hRD3 KNV----------------------------------------------- mRD3 KNV----------------------------------------------- : : hRD8 T-TLPVPSLGNHHTYCNLPLTLLNGQLPLNNTLKDT--QEFHRNSSLLPL hRD10 TGTLPLTSIGNQHTYCNIPMTLINGQRPQTKSSREQNPDEAHTNSAILPL hRD3 -------------------------------------------------- mRD3 -------------------------------------------------- hRD8 SSKELSFTSDTW hRD10 LPRETSISSVIW hRD3 ------------ mRD3 ------------ Alignment and comparison of primate and rodent IL-1RD9. hIL-1RD9 MLCLGWIFLWLVAGERIKGFNISGCSTKKLLWTYSTRSEEEFVLFCDLPE mIL-1RD9 MLCLGWVFLWFVAGEKTTGFNHSACATKKLLWTYSARGAENFVLFCDLQE ******.*** ****. *** * *.*********.* * ******* * hIL-1RD9 PQKSHFCHRNRLSPKQVPEHLPFMGSN-DLSDVQWYQQPSNGDPLEDIRK mIL-1RD9 LQEQKFSHASQLSPTQSPAHKPCSGSQKDLSDVQWYMQPRSGSPLEEISR * .*.* .*** * * * * **. ******** ** * ***.* . hIL-1RD9 SYPHIIQDKCTLHFLTPGVNNSGSYICRPKMIKSPYDVACCVKMILEVKP mIL-1RD9 NSPHMQSE-GMLHILAPQTNSIWSYICRPR-IRSPQDMACCIKTVLEVKP **. . ** *.* * ******. *.** *.***.* .***** hIL-1RD9 QTNASCEYSASHKQDLLLGSTGSISCPSLSCQSDAQSPAVTWYKNGKLLS mIL-1RD9 QRNVSCGNTAQDEQVLLLGSTGSIHCPSLSCQSDVQSPEMTWYKDGRLLP * * ** .* * ********* ********* *** .**** *.** hIL-1RD9 VERSNRIVVDEVYDYHQGTYVCDYTQSDTVSSWTVRAVVQVRTIVGDTKL mIL-1RD9 EHKKNPIEMADIYVFNQGLYVCDYTQSDNVSSWTVRAVVKVRTIGKDINV . * * . ..* ..** *********.**********.**** * . hIL-1RD9 KPDILDPVEDTLEVELGKPLTISCKARFGFERVFNPVIKWYIKDSDLEWE mIL-1RD9 KPEILDPITDTLDVELGKPLTLPCRVQFGFQRLSKPVIKWYVKESTQEWE **.****. ***.********. *. .***.*. ******.*.* *** hIL-1RD9 VSVPEAKSIKSTLKDEIIERNIILEKVTQRDLRRKFVCFVQNSIGNTTQS mIL-1RD9 MSVFEEKRIQSTFKNEVIERTIFLREVTQRDLSRKFVCFAQNSIGNTTRT .** * * *.** * *.***.* * ****** ****** ********.. hIL-1RD9 VQLKEKRGVVLLYILLGTIGTLVAVLAASALLYRHWIEIVLLYRTYQSKD mIL-1RD9 IRLRKKEEVVFVYILLGTALMLVGVLVAAAFLYWYWIEVVLLCRTYKNKD ..*. * ** .****** ** ** *.* ** ***.*** ***. ** hIL-1RD9 QTLGDKKDFDAFVSYAKWSSFPSEATSSLSEEHLALSLFPDVLENKYGYS mIL-1RD9 ETLGDKKEFDAFVSYSNWSSPETDAVGSLSEEHLALNLFPEVLEDTYGYR .******.*******. ***. * ********* ***.*** *** hIL-1RD9 LCLLERDVAPGGVYAEDIVSIIKRSRRGIFILSPNYVNGPSIFELQAAVN mIL-1RD9 LCLLDRDVTPGGVYADDIVSIIKKSRRGIFILSPSYLNGPRVFELQAAVN ****.***.******.*******.********** *.*** .******** hIL-1RD9 LALDDQTLKLILIKFCYFQEPESLPHLVKKALRVLPTVTWRGLKSVPPNS mIL-1RD9 LALVDQTLKLILIKFCSFQEPESLPYLVKKALRVLPTVTWKGLKSVHASS *** ************ ******** **************.***** * hIL-1RD9 RFWAKMRYHMPVKNSQGFTWNQLRITSRIFQ-------WKGLSRTETTGR mIL-1RD9 RFWTQIRYHMPVKNSNRFMFNGLRIFLKGFSPEKDLVTQKPLEGMPKSGN ***...*********. * * *** . * * * . * hIL-1RD9 ----------SSQPKEW mlL-1RD9 DHGAQNLLLYSDQKRC * * .
[0066] Structural analysis of the primate IL-1RD10 sequence (SEQ ID NO: 18, 20, and 35), in comparison with other IL-1Rs, shows characteristic features exist, which are conserved with the IL-1RD10 embodiment described herein. For example, there are characteristic Ig domains, and subdomains therein. The corresponding regions of the IL-1RD10 (SEQ ID NO: 18 and 20) are about: f2 to gly7; g2 from val10 to thr23; a3 from leu30 to met33; a3′ from thr38 to gln40; b3 from ala48 to ala54; c3 from pro64 to lys70; c3′ from glu72 to phe74; d3 from val83 to lys92; e3 from gln98 to val106; and f3 from tyr117 to trp126.
[0067] Structural analysis of the rodent IL-1RD9 sequence (SEQ ID NO: 12, 14, and 16), in comparison with other IL-1Rs, shows characteristic features exist (see Table 4). For example, there are characteristic Ig domains, and subdomains therein. The corresponding regions of the IL-1RD9 (SEQ ID NO: 12, 14, and 16) are about: Ig1 domain from gly18 to pro127, with cys105 probably linked to cys52 (or possibly cys48); Ig2 domain from gly128 to pro229, with cys153 probably linked to cys199; and the Ig3 domain from glu230 to lys333, with cys251 probably linked to cys315; transmembrane segment from val336 to tyr360; THD domain from gly381 to val539; conserved trp residues probably correspond to residues 64, 169, and 267. Alignment of the IL-1RD9 embodiments is shown in Table 4. There are characteristic beta strand sections, and alpha helical structures, as described above for IL-1RD10. The corresponding segments of the human IL-1RD9 sequence (SEQ ID NO: 6, 8, and 10) are roughly: &bgr;B from gly3 to val13; &agr;2 from pro15 to lys28; &bgr;c from ser30 to ser46; &agr;3 from ile47 to gln61; &bgr;D from lys64 to glu75; &agr;4 from glu77 to leu87; &bgr;E from val93 to leu98; and &agr;5 from arg106 to val117. The corresponding segments of the mouse IL-1RD9 sequence (SEQ ID NO: 12, 14, and 16) are roughly: &agr;3 to gln10; &bgr;D from lys13 to glu24; &agr;4 from glu26 to leu36; &bgr;E from va42 to leu47; and &agr;5 from arg55 to val66.
[0068] As used herein, the terms IL-1 like receptor D8 (IL-1RD8), IL-1 like receptor D9 (IL-1RD9), or IL-1 like receptor D10 (IL-1RD10) shall be used to describe a polypeptide comprising a segment having or sharing the amino acid sequence shown in Tables 1, 2, or 3, or a substantial fragment thereof. The invention also includes a polypeptide variation of the respective IL-1RD8, IL-1RD9, IL-1RD10 alleles whose sequences are provided, e,g., a mutein or soluble extracellular or intracellular construct. Typically, such agonists or antagonists will exhibit less than about 10% sequence differences, and thus will often have between 1- and 11-fold substitutions, e.g., 2-, 3-, 5-, 7-fold, and others. It also encompasses allelic and other variants, e.g., natural polymorphic, of the polypeptide described. Typically, it will bind to its corresponding biological ligand, perhaps in a dimerized state with an alpha receptor subunit, with high affinity, e.g., at least about 100 nM, usually better than about 30 nM, preferably better than about 10 nM, and more preferably at better than about 3 nM. The term shall also be used herein to refer to related naturally occurring forms, e.g., alleles, polymorphic variants, and metabolic variants of the mammalian protein.
[0069] This invention also encompasses polypeptides having substantial amino acid sequence identity with the amino acid sequences in Tables 1-3, preferably having segments of contiguous amino acid residues identical to segments of SEQ ID NO: 4, 10, or 35. It will include sequence variants with relatively few substitutions, e.g., typically less than about 25, ordinarily less than about 15, preferably less than about 3-5. Other embodiments include forms in association with an alpha subunit, e.g., an IL-1RD4, IL-1RD5, or IL-1RD6.
[0070] A substantial polypeptide “fragment”, or “segment”, is a stretch of amino acid residues of at least about 8 contiguous amino acids, generally at least 10 contiguous amino acids, more generally at least 12 contiguous amino acids, often at least 14 contiguous amino acids, more often at least 16 contiguous amino acids, typically at least 18 contiguous amino acids, more typically at least 20 contiguous amino acids, usually at least 22 contiguous amino acids, more usually at least 24 contiguous amino acids, preferably at least 26 contiguous amino acids, more preferably at least 28 contiguous amino acids, and, in particularly preferred embodiments, at least about 30 or more contiguous amino acids, usually 40, 50, 70, 90, 110, etc. Sequences of segments of different polypeptides can be compared to one another over appropriate length stretches. In many cases, the matching will involve a plurality of distinct, e.g., nonoverlapping, segments of the specified length. Typically, the plurality will be at least two, more usually at least three, and preferably 5, 7, or even more. While the length minima are provided, longer lengths, of various sizes, may be appropriate, e.g., one of length 7, and two of length 12. Similar features apply to segments of nucleic acid.
[0071] Amino acid sequence homology, or sequence identity, is determined by optimizing residue matches, if necessary, by introducing gaps as required. See, e.g., Needleham, et al. (1970) J. Mol. Biol. 48:443-453; Sankoff, et al. (1983) chapter one in Time Warps, String Edits, and Macromolecules: The Theory and Practice of Sequence Comparison, Addison-Wesley, Reading, Mass.; and software packages from IntelliGenetics, Mountain View, Ca.; and the University of Wisconsin Genetics Computer Group (GCG), Madison, Wis.; each of which is incorporated herein by reference. This changes when considering conservative substitutions as matches. Conservative substitutions typically include substitutions within the following groups: glycine, alanine; valine, isoleucine, leucine; aspartic acid, glutamic acid; asparagine, glutamine; serine, threonine; lysine, arginine; and phenylalanine, tyrosine. Homologous amino acid sequences are intended to include natural allelic and interspecies variations in the cytokine sequence. Typical homologous polypeptides will have from 50-100% homology (if gaps can be introduced), to 60-100% homology (if conservative substitutions are included) with an amino acid sequence segment of Table 1, 2, or 3. Homology measures will be at least about 70%, generally at least 76%, more generally at least 81%, often at least 85%, more often at least 88%, typically at least 90%, more typically at least 92%, usually at least 94%, more usually at least 95%, preferably at least 96%, and more preferably at least 97%, and in particularly preferred embodiments, at least 98% or more. The degree of homology will vary with the length of the compared segments. Homologous polypeptides, such as the allelic variants, will share most biological activities with the embodiments described in Table 1, 2, or 3.
[0072] As used herein, the term “biological activity” is used to describe, without limitation, effects on inflammatory responses, innate immunity, and/or morphogenic development by respective ligands. For example, these receptors should, like IL-1 receptors, mediate phosphatase or phosphorylase activities, which activities are easily measured by standard procedures. See, e.g., Hardie, et al. (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, Calif.; Hanks, et al. (1991) Meth. Enzymol. 200:38-62; Hunter, et al. (1992) Cell 70:375-388; Lewin (1990) Cell 61:743-752; Pines, et al. (1991) Cold Spring Harbor Symp. Quant. Biol. 56:449-463; and Parker, et al. (1993) Nature 363:736-738. Other activities include antigenic or immunogenic functions. The receptors exhibit biological activities much like regulatable enzymes, regulated by ligand binding. However, the enzyme turnover number is more close to an enzyme than a receptor complex. Moreover, the numbers of occupied receptors necessary to induce such enzymatic activity is less than most receptor systems, and may number closer to dozens per cell, in contrast to most receptors which will trigger at numbers in the thousands per cell. The receptors, or portions thereof, may be useful as phosphate labeling enzymes to label general or specific substrates.
[0073] The terms ligand, agonist, antagonist, and analog of, e.g., an IL-1RD8, IL-1RD9, or IL-1RD10, include molecules that modulate the characteristic cellular responses to IL-1 ligand proteins, as well as molecules possessing the more standard structural binding competition features of ligand-receptor interactions, e.g., where the receptor is a natural receptor or an antibody. The cellular responses likely are mediated through binding of various IL-1 ligands to cellular receptors related to, but possibly distinct from, the type I or type II IL-1 receptors. See, e.g., Belvin and Anderson (1996) Ann. Rev. Cell Dev. Biol. 12:393-416; Morisato and Anderson (1995) Ann. Rev. Genetics 29:371-3991 and Hultmark (1994) Nature 367:116-117.
[0074] Also, a ligand is a molecule which serves either as a natural ligand to which said receptor, or an analog thereof, binds, or a molecule which is a functional analog of the natural ligand. The functional analog may be a ligand with structural modifications, or may be a wholly unrelated molecule which has a molecular shape which interacts with the appropriate ligand binding determinants. The ligands may serve as agonists or antagonists, see, e.g., Goodman, et al. (eds. 1990) Goodman & Gilman's: The Pharmacological Bases of Therapeutics, Pergamon Press, New York.
[0075] Rational drug design may also be based upon structural studies of the molecular shapes of a receptor or antibody and other effectors or ligands. Effectors may be other proteins which mediate other functions in response to ligand binding, or other proteins which normally interact with the receptor. One means for determining which sites interact with specific other proteins is a physical structure determination, e.g., x-ray crystallography or 2 dimensional NMR techniques. These will provide guidance as to which amino acid residues form molecular contact regions. For a detailed description of protein structural determination, see, e.g., Blundell and Johnson (1976) Protein Crystallography, Academic Press, New York, which is hereby incorporated herein by reference.
[0076] II. Activities
[0077] The IL-1 receptor-like polypeptides will have a number of different biological activities, e.g., in phosphate metabolism, being added to or removed from specific substrates, typically proteins. Such will generally result in modulation of an inflammatory function, other innate immunity response, or a morphological effect. For example, a human IL-1RD9 gene coding sequence probably has about 60-80% identity with the nucleotide coding sequence of mouse IL-1RD9. At the amino acid level, there is also likely to be reasonable identity.
[0078] The receptors will also exhibit immunogenic activity, e.g., in being capable of eliciting a selective immune response. Antiserum or antibodies resulting therefrom will exhibit both selectivity and affinity of binding. The polypeptides will also be antigenic, in binding antibodies raised thereto, in the native state, or in denatured.
[0079] The biological activities of the IL-1RDs will generally be related to addition or removal of phosphate moieties to substrates, typically in a specific manner, but occasionally in a non specific manner. Substrates may be identified, or conditions for enzymatic activity may be assayed by standard methods, e.g., as described in Hardie, et al. (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, Calif.; Hanks, et al. (1991) Meth. Enzymol. 200:38-62; Hunter, et al. (1992) Cell 70:375-388; Lewin (1990) Cell 61:743-752; Pines, et al. (1991) Cold Spring Harbor Symp. Quant. Biol. 56:449-463; and Parker, et al. (1993) Nature 363:736-738.
[0080] III. Nucleic Acids
[0081] This invention contemplates use of isolated nucleic acid or fragments, e.g., which encode these or closely related proteins, or fragments thereof, e.g., to encode a corresponding polypeptide, preferably one which is biologically active. In addition, this invention covers isolated or recombinant DNA which encodes such polypeptides or polypeptides having characteristic sequences of the respective IL-1RDs, individually or as a group. Typically, the nucleic acid is capable of hybridizing, under appropriate conditions, with a nucleic acid coding sequence segment shown in Table 1, 2, or 3 but preferably not with a corresponding segment of other receptors. Said biologically active polypeptide can be a full length polypeptide, or fragment, and will typically have a segment of amino acid sequence highly homologous to one shown in Table 1, 2, or 3. Further, this invention covers the use of isolated or recombinant nucleic acid, or fragments thereof, which encode polypeptides having fragments which are equivalent to the IL-1RD9 proteins. The isolated nucleic acids can have the respective regulatory sequences in the 5′ and 3′ flanks, e.g., promoters, enhancers, poly-A addition signals, and others from the natural gene.
[0082] An “isolated” nucleic acid is a nucleic acid, e.g., an RNA, DNA, or a mixed polymer, which is substantially pure, e.g., separated from other components which naturally accompany a native sequence, e.g., ribosomes, polymerases, and flanking genomic sequences from the originating species. The term embraces a nucleic acid sequence which has been removed from its naturally occurring environment, and includes recombinant or cloned DNA isolates, which are thereby distinguishable from naturally occurring compositions, and chemically synthesized analogs or analogs biologically synthesized by heterologous systems. A substantially pure molecule includes isolated forms of the molecule, either completely or substantially pure.
[0083] An isolated nucleic acid will generally be a homogeneous composition of molecules, but will, in some embodiments, contain heterogeneity, preferably minor. This heterogeneity is typically found at the polymer ends or portions not critical to a desired biological function or activity.
[0084] A “recombinant” nucleic acid is typically defined either by its method of production or its structure. In reference to its method of production, e.g., a product made by a process, the process is use of recombinant nucleic acid techniques, e.g., involving human intervention in the nucleotide sequence. Typically this intervention involves in vitro manipulation, although under certain circumstances it may involve more classical animal breeding techniques. Alternatively, it can be a nucleic acid made by generating a sequence comprising fusion of two fragments which are not naturally contiguous to each other, but is meant to exclude products of nature, e.g., naturally occurring mutants as found in their natural state. Thus, for example, products made by transforming cells with an unnaturally occurring vector is encompassed, as are nucleic acids comprising sequence derived using any synthetic oligonucleotide process. Such a process is often done to replace a codon with a redundant codon encoding the same or a conservative amino acid, while typically introducing or removing a restriction enzyme sequence recognition site. Alternatively, the process is performed to join together nucleic acid segments of desired functions to generate a single genetic entity comprising a desired combination of functions not found in the commonly available natural forms, e.g., encoding a fusion protein. Restriction enzyme recognition sites are often the target of such artificial manipulations, but other site specific targets, e.g., promoters, DNA replication sites, regulation sequences, control sequences, or other useful features may be incorporated by design. A similar concept is intended for a recombinant, e.g., fusion, polypeptide. This will include a dimeric repeat. Specifically included are synthetic nucleic acids which, by genetic code redundancy, encode equivalent polypeptides to fragments of, e.g, IL-1RD9, and fusions of sequences from various different related molecules, e.g., other IL-1 receptor family members.
[0085] A “fragment” in a nucleic acid context is a contiguous segment of at least about 17 contiguous nucleotides, generally at least 21 contiguous nucleotides, more generally at least 25 contiguous nucleotides, ordinarily at least 30 contiguous nucleotides, more ordinarily at least 35 contiguous nucleotides, often at least 39 contiguous nucleotides, more often at least 45 contiguous nucleotides, typically at least 50 contiguous nucleotides, more typically at least 55 contiguous nucleotides, usually at least 60 contiguous nucleotides, more usually at least 66 contiguous nucleotides, preferably at least 72 contiguous nucleotides, more preferably at least 79 contiguous nucleotides, and in particularly preferred embodiments will be at least 85 or more contiguous nucleotides, e.g., 100, 120, 140, etc. Typically, fragments of different genetic sequences can be compared to one another over appropriate length stretches, particularly defined segments such as the domains described below.
[0086] A nucleic acid which codes for an IL-1RD8, IL-1RD9, or IL-1RD10 will be particularly useful to identify genes, mRNA, and cDNA species which code for itself or closely related proteins, as well as DNAs which code for polymorphic, allelic, or other genetic variants, e.g., from different individuals or related species. Preferred probes for such screens are those regions of the interleukin which are conserved between different polymorphic variants or which contain nucleotides which lack specificity, and will preferably be full length or nearly so. In other situations, polymorphic variant specific sequences will be more useful.
[0087] This invention further covers recombinant nucleic acid molecules and fragments having a nucleic acid sequence identical to or highly homologous to the isolated DNA set forth herein. In particular, the sequences will often be operably linked to DNA segments which control transcription, translation, and DNA replication. These additional segments typically assist in expression of the desired nucleic acid segment.
[0088] Homologous, or highly identical, nucleic acid sequences, when compared to one another, e.g., IL-1RD9 sequences, exhibit significant similarity. The standards for homology in nucleic acids are either measures for homology generally used in the art by sequence comparison or based upon hybridization conditions. Comparative hybridization conditions are described in greater detail below.
[0089] Substantial identity in the nucleic acid sequence comparison context means either that the segments, or their complementary strands, when compared, are identical when optimally aligned, with appropriate nucleotide insertions or deletions, in at least about 60% of the nucleotides, generally at least 66%, ordinarily at least 71%, often at least 76%, more often at least 80%, usually at least 84%, more usually at least 88%, typically at least 91%, more typically at least about 93%, preferably at least about 95%, more preferably at least about 96 to 98% or more, and in particular embodiments, as high at about 99% or more of the nucleotides, including, e.g., segments encoding structural domains such as the segments described below. Alternatively, substantial identity will exist when the segments will hybridize under selective hybridization conditions, to a strand or its complement, typically using a sequence derived from Table 1, 2, or 3. Typically, selective hybridization will occur when there is at least about 55% homology over a stretch of at least about 14 nucleotides, more typically at least about 65%, preferably at least about 75%, and more preferably at least about 90%. See, Kanehisa (1984) Nuc. Acids Res. 12:203-213, which is incorporated herein by reference. The length of homology comparison, as described, may be over longer stretches, and in certain embodiments will be over a stretch of at least about 17 nucleotides, generally at least about 20 nucleotides, ordinarily at least about 24 nucleotides, usually at least about 28 nucleotides, typically at least about 32 nucleotides, more typically at least about 40 nucleotides, preferably at least about 50 nucleotides, and more preferably at least about 75 to 100 or more nucleotides.
[0090] Stringent conditions, in referring to homology in the hybridization context, will be stringent combined conditions of salt, temperature, organic solvents, and other parameters typically controlled in hybridization reactions. Stringent temperature conditions will usually include temperatures in excess of about 30° C., more usually in excess of about 37° C., typically in excess of about 45° C., more typically in excess of about 55° C., preferably in excess of about 65° C., and more preferably in excess of about 70° C. Stringent salt conditions will ordinarily be less than about 500 mM, usually less than about 400 mM, more usually less than about 300 mM, typically less than about 200 mM, preferably less than about 100 mM, and more preferably less than about 80 mM, even down to less than about 20 mM. However, the combination of parameters is much more important than the measure of any single parameter. See, e.g., Wetmur and Davidson (1968) J. Mol. Biol. 31:349-370, which is hereby incorporated herein by reference. The signal should be at least 2× over background, generally at least 5-10× over background, and preferably even more.
[0091] For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test and reference sequences are input into a computer, subsequent coordinates are designated, if necessary, and sequence algorithm program parameters are designated. The sequence comparison algorithm then calculates the percent sequence identity for the test sequence(s) relative to the reference sequence, based on the designated program parameters.
[0092] Optical alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith and Waterman (1981) Adv. Appl. Math. 2:482, by the homology alignment algorithm of Needleman and Wunsch (1970) J. Mol. Biol. 48:443, by the search for similarity method of Pearson and Lipman (1988) Proc. Nat'l Acad. Sci. USA 85:2444, by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, Wis.), or by visual inspection (see generally Ausubel et al., supra).
[0093] One example of a useful algorithm is PILEUP. PILEUP creates a multiple sequence alignment from a group of related sequences using progressive, pairwise alignments to show relationship and percent sequence identity. It also plots a tree or dendrogram showing the clustering relationships used to create the alignment. PILEUP uses a simplification of the progressive alignment method of Feng and Doolittle (1987) J. Mol. Evol. 35:351-360. The method used is similar to the method described by Higgins and Sharp (1989) CABIOS 5:151-153. The program can align up to 300 sequences, each of a maximum length of 5,000 nucleotides or amino acids. The multiple alignment procedure begins with the pairwise alignment of the two most similar sequences, producing a cluster of two aligned sequences. This cluster is then aligned to the next most related sequence or cluster of aligned sequences. Two clusters of sequences are aligned by a simple extension of the pairwise alignment of two individual sequences. The final alignment is achieved by a series of progressive, pairwise alignments. The program is run by designating specific sequences and their amino acid or nucleotide coordinates for regions of sequence comparison and by designating the program parameters. For example, a reference sequence can be compared to other test sequences to determine the percent sequence identity relationship using the following parameters: default gap weight (3.00), default gap length weight (0.10), and weighted end gaps.
[0094] Another example of algorithm that is suitable for determining percent sequence identity and sequence similarity is the BLAST algorithm, which is described Altschul, et al. (1990) J. Mol. Biol. 215:403-410. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http:www.ncbi.nlm.nih.gov/). This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul, et al., supra). These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLAST program uses as defaults a wordlength (W) of 11, the BLOSUM62 scoring matrix (see Henikoff and Henikoff (1989) Proc. Nat'l Acad. Sci. USA 89:10915) alignments (B) of 50, expectation (E) of 10, M=5, N=4, and a comparison of both strands.
[0095] In addition to calculating percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin and Altschul (1993) Proc. Nat'l Acad. Sci. USA 90:5873-5787). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(N)), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.
[0096] A further indication that two nucleic acid sequences of polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, e.g., where the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions, as described below.
[0097] The isolated DNA can be readily modified by nucleotide substitutions, nucleotide deletions, nucleotide insertions, and inversions of nucleotide stretches. These modifications result in novel DNA sequences which encode this polypeptide or its derivatives. These modified sequences can be used to produce mutant proteins (muteins) or to enhance the expression of variant species. Enhanced expression may involve gene amplification, increased transcription, increased translation, and other mechanisms. Such mutant IL-1RD9-like derivatives include predetermined or site-specific mutations of the polypeptide or its fragments, including silent mutations using genetic code degeneracy. “Mutant IL-1RD9” as used herein encompasses a polypeptide otherwise falling within the homology definition of the IL-1R9 as set forth above, but having an amino acid sequence which differs from that of other IL-1RD-like polypeptides as found in nature, whether by way of deletion, substitution, or insertion. In particular, “site specific mutant IL-1RD9” encompasses a polypeptide having substantial homology with a polypeptide of Table 2, and typically shares most of the biological activities or effects of the forms disclosed herein.
[0098] Although site specific mutation sites are predetermined, mutants need not be site specific. Mammalian IL-1RD9 mutagenesis can be achieved by making amino acid insertions or deletions in the gene, coupled with expression. Substitutions, deletions, insertions, or many combinations may be generated to arrive at a final construct. Insertions include amino- or carboxy-terminal fusions. Random mutagenesis can be conducted at a target codon and the expressed mammalian IL-1RD9 mutants can then be screened for the desired activity, providing some aspect of a structure-activity relationship. Methods for making substitution mutations at predetermined sites in DNA having a known sequence are well known in the art, e.g., by M13 primer mutagenesis. See also Sambrook, et al. (1989) and Ausubel, et al. (1987 and periodic Supplements).
[0099] The mutations in the DNA normally should not place coding sequences out of reading frames and preferably will not create complementary regions that could hybridize to produce secondary mRNA structure such as loops or hairpins.
[0100] The phosphoramidite method described by Beaucage and Carruthers (1981) Tetra. Letts. 22:1859-1862, will produce suitable synthetic DNA fragments. A double stranded fragment will often be obtained either by synthesizing the complementary strand and annealing the strand together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
[0101] Polymerase chain reaction (PCR) techniques can often be applied in mutagenesis. Alternatively, mutagenesis primers are commonly used methods for generating defined mutations at predetermined sites. See, e.g., Innis, et al. (eds. 1990) PCR Protocols: A Guide to Methods and Applications Academic Press, San Diego, Calif.; and Dieffenbach and Dveksler (1995; eds.) PCR Primer: A Laboratory Manual Cold Spring Harbor Press, CSH, NY. Appropriate primers of length, e.g., 15, 20, 25, or longer can be made using sequence provided.
[0102] IV. Proteins, Peptides
[0103] As described above, the present invention encompasses primate IL-1RD8, primate or rodent IL-1RD9, and primate IL-1RD10, e.g., whose sequences are disclosed, e.g., in Tables 1-3, and described herein. Descriptions of features of IL-1RD9 are applicable in most cases, with appropriate modifications, also to IL-1RD8 and/or to IL-1RD10. Allelic and other variants are also contemplated, including, e.g., fusion proteins combining portions of such sequences with others, including epitope tags and functional domains. Particularly interesting constructs will be intact extracellular or intracellular domains.
[0104] The present invention also provides recombinant polypeptides, e.g., heterologous fusion proteins using segments from these rodent proteins. A heterologous fusion protein is a fusion of proteins or segments which are naturally not normally fused in the same manner. Thus, the fusion product of, e.g., an IL-1RD9 with another IL-1 receptor is a continuous protein molecule having sequences fused in a typical polypeptide linkage, typically made as a single translation product and exhibiting properties, e.g., sequence or antigenicity, derived from each source peptide. A similar concept applies to heterologous nucleic acid sequences.
[0105] In addition, new constructs may be made from combining similar functional or structural domains from other related proteins, e.g., IL-1 receptors or Toll-like receptors, including species variants. For example, ligand-binding or other segments may be “swapped” between different new fusion polypeptides or fragments. See, e.g., Cunningham, et al. (1989) Science 243:1330-1336; and O'Dowd, et al. (1988) J. Biol. Chem. 263:15985-15992, each of which is incorporated herein by reference. Thus, new chimeric polypeptides exhibiting new combinations of specificities will result from the functional linkage of receptor-binding specificities. For example, the ligand binding domains from other related receptor molecules may be added or substituted for other domains of this or related proteins. The resulting protein will often have hybrid function and properties. For example, a fusion protein may include a targeting domain which may serve to provide sequestering of the fusion protein to a particular subcellular organelle.
[0106] Candidate fusion partners and sequences can be selected from various sequence data bases, e.g., GenBank, c/o NCBI, and BCG, University of Wisconsin Biotechnology Computing Group, Madison, Wis., which are each incorporated herein by reference.
[0107] The present invention particularly provides muteins which bind IL-1-like ligands, and/or which are affected in signal transduction. Structural alignment of human IL-1RD9 with other members of the IL-1R family show conserved features/residues. See Table 4. Alignment of the human IL-1RD9 sequence with other members of the IL-1R family indicates various structural and functionally shared features. See also, Bazan, et al. (1996) Nature 379:591; Lodi, et al. (1994) Science 263:1762-1766; Sayle and Milner-White (1995) TIBS 20:374-376; and Gronenberg, et al. (1991) Protein Engineering 4:263-269.
[0108] The IL-1&agr; and IL-1&bgr; ligands bind an IL-1 receptor type I (IL-1RD1) as the primary receptor and this complex then forms a high affinity receptor complex with the IL-1 receptor type III (IL-1RD3). Such receptor subunits are probably shared with the receptors for the new IL-1 ligand family members. See, e.g., U.S. Ser. No. 60/044,165 and U.S. Ser. No. 60/055,111. It is likely that the IL-1&ggr; ligand signals through a receptor comprising the association of IL-1RD9 (alpha component) with IL-1RD5 (beta component). The IL-1&dgr; and IL-1&egr; ligands each probably signal through a receptor comprising the association of one of IL-1RD4, IL-1RD6, or IL-1RD9 (alpha components) with one of IL-1RD3, IL-1RD5, IL-1RD7, IL-1RD8, or IL-1RD10 (beta components).
[0109] Similar variations in other species counterparts of IL-1R sequences, e.g., receptors D1-D6, D8, D9, or D10, in the corresponding regions, should provide similar interactions with ligand or substrate. Substitutions with either rodent or primate, e.g., mouse sequences or human sequences, are particularly preferred. Conversely, conservative substitutions away from the ligand binding interaction regions will probably preserve most signaling activities; and conservative substitutions away from the intracellular domains will probably preserve most ligand binding properties.
[0110] “Derivatives” of the primate or mouse IL-1RD9 include amino acid sequence mutants, glycosylation variants, metabolic derivatives and covalent or aggregative conjugates with other chemical moieties. Covalent derivatives can be prepared by linkage of functionalities to groups which are found in the IL-1RD9 amino acid side chains or at the N- or C-termini, e.g., by means which are well known in the art. These derivatives can include, without limitation, aliphatic esters or amides of the carboxyl terminus, or of residues containing carboxyl side chains, O-acyl derivatives of hydroxyl group-containing residues, and N-acyl derivatives of the amino terminal amino acid or amino-group containing residues, e.g., lysine or arginine. Acyl groups are selected from the group of alkyl-moieties including C3 to C18 normal alkyl, thereby forming alkanoyl aroyl species.
[0111] In particular, glycosylation alterations are included, e.g., made by modifying the glycosylation patterns of a polypeptide during its synthesis and processing, or in further processing steps. Particularly preferred means for accomplishing this are by exposing the polypeptide to glycosylating enzymes derived from cells which normally provide such processing, e.g., mammalian glycosylation enzymes. Deglycosylation enzymes are also contemplated. Also embraced are versions of the same primary amino acid sequence which have other minor modifications, including phosphorylated amino acid residues, e.g., phosphotyrosine, phosphoserine, or phosphothreonine.
[0112] A major group of derivatives are covalent conjugates of the receptors or fragments thereof with other polypeptides. These derivatives can be synthesized in recombinant culture such as N- or C-terminal fusions or by the use of agents known in the art for their usefulness in cross-linking proteins through reactive side groups. Preferred derivatization sites with cross-linking agents are at free amino groups, carbohydrate moieties, and cysteine residues.
[0113] Fusion polypeptides between the receptors and other homologous or heterologous proteins are also provided. Homologous polypeptides may be fusions between different receptors, resulting in, for instance, a hybrid protein exhibiting binding specificity for multiple different IL-1 ligands, or a receptor which may have broadened or weakened specificity of substrate effect. Likewise, heterologous fusions may be constructed which would exhibit a combination of properties or activities of the derivative proteins. Typical examples are fusions of a reporter polypeptide, e.g., luciferase, with a segment or domain of a receptor, e.g., a ligand-binding segment, so that the presence or location of a desired ligand may be easily determined. See, e.g., Dull, et al., U.S. Pat. No. 4,859,609, which is hereby incorporated herein by reference. Other gene fusion partners include glutathione-S-transferase (GST), bacterial &bgr;-galactosidase, trpE, Protein A, &bgr;-lactamase, alpha amylase, alcohol dehydrogenase, and yeast alpha mating factor. See, e.g., Godowski, et al. (1988) Science 241:812-816.
[0114] The phosphoramidite method described by Beaucage and Carruthers (1981) Tetra. Letts. 22:1859-1862, will produce suitable synthetic DNA fragments. A double stranded fragment will often be obtained either by synthesizing the complementary strand and annealing the strand together under appropriate conditions or by adding the complementary strand using DNA polymerase with an appropriate primer sequence.
[0115] Such polypeptides may also have amino acid residues which have been chemically modified by phosphorylation, sulfonation, biotinylation, or the addition or removal of other moieties, particularly those which have molecular shapes similar to phosphate groups. In some embodiments, the modifications will be useful labeling reagents, or serve as purification targets, e.g., affinity ligands.
[0116] Fusion proteins will typically be made by either recombinant nucleic acid methods or by synthetic polypeptide methods. Techniques for nucleic acid manipulation and expression are described generally, e.g., in Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual (2d ed.), Vols. 1-3, Cold Spring Harbor Laboratory, and Ausubel, et al. (eds. 1987 and periodic supplements) Current Protocols in Molecular Biology, Greene/Wiley, New York, which are each incorporated herein by reference. Techniques for synthesis of polypeptides are described, e.g., in Merrifield (1963) J. Amer. Chem. Soc. 85:2149-2156; Merrifield (1986) Science 232: 341-347; and Atherton, et al. (1989) Solid Phase Peptide Synthesis: A Practical Approach, IRL Press, Oxford; each of which is incorporated herein by reference. See also Dawson, et al. (1994) Science 266:776-779 for methods to make larger polypeptides.
[0117] This invention also contemplates the use of derivatives of an IL-1RD8, IL-1RD9, or IL-1RD10 other than variations in amino acid sequence or glycosylation. Such derivatives may involve covalent or aggregative association with chemical moieties. These derivatives generally fall into three classes: (1) salts, (2) side chain and terminal residue covalent modifications, and (3) adsorption complexes, for example with cell membranes. Such covalent or aggregative derivatives are useful as immunogens, as reagents in immunoassays, or in purification methods such as for affinity purification of a receptor or other binding molecule, e.g., an antibody. For example, an IL-1 ligand can be immobilized by covalent bonding to a solid support such as cyanogen bromide-activated Sepharose, by methods which are well known in the art, or adsorbed onto polyolefin surfaces, with or without glutaraldehyde cross-linking, for use in the assay or purification of an IL-1 receptor, antibodies, or other similar molecules. The ligand can also be labeled with a detectable group, e.g., radioiodinated by the chloramine T procedure, covalently bound to rare earth chelates, or conjugated to another fluorescent moiety for use in diagnostic assays.
[0118] An IL-1RD8, IL-1RD9, or IL-1RD10 of this invention can be used as an immunogen for the production of antisera or antibodies specific, e.g., capable of distinguishing between other IL-1 receptor family members, for the IL-1RD8, IL-1RD9, or IL-1RD10 or various fragments thereof. The purified IL-1RD8, IL-1RD9, or IL-1RD10 can be used to screen monoclonal antibodies or antigen-binding fragments prepared by immunization with various forms of impure preparations containing the protein. In particular, the term “antibodies” also encompasses antigen binding fragments of natural antibodies, e.g., Fab, Fab2, Fv, etc. The purified IL-1RD9 can also be used as a reagent to detect antibodies generated in response to the presence of elevated levels of expression, or immunological disorders which lead to antibody production to the endogenous receptor. Additionally, IL-1RD8, IL-1RD9, or IL-1RD10 fragments may also serve as immunogens to produce the antibodies of the present invention, as described immediately below. For example, this invention contemplates antibodies having binding affinity to or being raised against the amino acid sequences shown, e.g., in Tables 1, 2, or 3, fragments thereof, or various homologous peptides. In particular, this invention contemplates antibodies having binding affinity to, or having been raised against, specific fragments which are predicted to be, or actually are, exposed at the exterior polypeptide surface of the native IL-1RD8, IL-1RD9, or IL-1RD10. Various preparations of desired selectivity in binding can be prepared by appropriate cross absorptions, etc.
[0119] The blocking of physiological response to the receptor ligands may result from the inhibition of binding of the ligand to the receptor, likely through competitive inhibition. Thus, in vitro assays of the present invention will often use antibodies or antigen binding segments of these antibodies, or fragments attached to solid phase substrates. These assays will also allow for the diagnostic determination of the effects of either ligand binding region mutations and modifications, or other mutations and modifications, e.g., which affect signaling or enzymatic function.
[0120] This invention also contemplates the use of competitive drug screening assays, e.g., where neutralizing antibodies to the receptor or fragments compete with a test compound for binding to a ligand or other antibody. In this manner, the neutralizing antibodies or fragments can be used to detect the presence of a polypeptide which shares one or more binding sites to a receptor and can also be used to occupy binding sites on a receptor that might otherwise bind a ligand.
[0121] V. Making Nucleic Acids and Protein
[0122] DNA which encodes the polypeptides or fragments thereof can be obtained by chemical synthesis, screening cDNA libraries, or by screening genomic libraries prepared from a wide variety of cell lines or tissue samples. Natural sequences can be isolated using standard methods and the sequences provided herein, e.g., in Tables 1-3. Other species counterparts can be identified by hybridization techniques, or by various PCR techniques, combined with or by searching in sequence databases, e.g., GenBank.
[0123] This DNA can be expressed in a wide variety of host cells for the synthesis of a full-length receptor or fragments which can in turn, e.g., be used to generate polyclonal or monoclonal antibodies; for binding studies; for construction and expression of modified ligand binding or kinase/phosphatase domains; and for structure/function studies. Variants or fragments can be expressed in host cells that are transformed or transfected with appropriate expression vectors. These molecules can be substantially free of protein or cellular contaminants, other than those derived from the recombinant host, and therefore are particularly useful in pharmaceutical compositions when combined with a pharmaceutically acceptable carrier and/or diluent. The protein, or portions thereof, may be expressed as fusions with other proteins.
[0124] Expression vectors are typically self-replicating DNA or RNA constructs containing the desired receptor gene or its fragments, usually operably linked to suitable genetic control elements that are recognized in a suitable host cell. These control elements are capable of effecting expression within a suitable host. The specific type of control elements necessary to effect expression will depend upon the eventual host cell used. Generally, the genetic control elements can include a prokaryotic promoter system or a eukaryotic promoter expression control system, and typically include a transcriptional promoter, an optional operator to control the onset of transcription, transcription enhancers to elevate the level of mRNA expression, a sequence that encodes a suitable ribosome binding site, and sequences that terminate transcription and translation. Expression vectors also usually contain an origin of replication that allows the vector to replicate independently of the host cell.
[0125] The vectors of this invention include those which contain DNA which encodes a protein, as described, or a fragment thereof encoding a biologically active equivalent polypeptide. The DNA can be under the control of a viral promoter and can encode a selection marker. This invention further contemplates use of such expression vectors which are capable of expressing eukaryotic cDNA coding for such a polypeptide in a prokaryotic or eukaryotic host, where the vector is compatible with the host and where the eukaryotic cDNA coding for the receptor is inserted into the vector such that growth of the host containing the vector expresses the cDNA in question. Usually, expression vectors are designed for stable replication in their host cells or for amplification to greatly increase the total number of copies of the desirable gene per cell. It is not always necessary to require that an expression vector replicate in a host cell, e.g., it is possible to effect transient expression of the polypeptide or its fragments in various hosts using vectors that do not contain a replication origin that is recognized by the host cell. It is also possible to use vectors that cause integration of the polypeptide encoding portion or its fragments into the host DNA by recombination.
[0126] Vectors, as used herein, comprise plasmids, viruses, bacteriophage, integratable DNA fragments, and other vehicles which enable the integration of DNA fragments into the genome of the host. Expression vectors are specialized vectors which contain genetic control elements that effect expression of operably linked genes. Plasmids are the most commonly used form of vector but all other forms of vectors which serve an equivalent function and which are, or become, known in the art are suitable for use herein. See, e.g., Pouwels, et al. (1985 and Supplements) Cloning Vectors: A Laboratory Manual, Elsevier, N.Y., and Rodriquez, et al. (eds. 1988) Vectors: A Survey of Molecular Cloning Vectors and Their Uses, Buttersworth, Boston, which are incorporated herein by reference.
[0127] Transformed cells are cells, preferably mammalian, that have been transformed or transfected with receptor vectors constructed using recombinant DNA techniques. Transformed host cells usually express the desired polypeptide or its fragments, but for purposes of cloning, amplifying, and manipulating its DNA, do not need to express the subject protein. This invention further contemplates culturing transformed cells in a nutrient medium, thus permitting the receptor to accumulate in the cell membrane. The polypeptide can be recovered, either from the culture or, in certain instances, from the culture medium.
[0128] For purposes of this invention, nucleic sequences are operably linked when they are functionally related to each other. For example, DNA for a presequence or secretory leader is operably linked to a polypeptide if it is expressed as a preprotein or participates in directing the polypeptide to the cell membrane or in secretion of the polypeptide. A promoter is operably linked to a coding sequence if it controls the transcription of the polypeptide; a ribosome binding site is operably linked to a coding sequence if it is positioned to permit translation. Usually, operably linked means contiguous and in reading frame, however, certain genetic elements such as repressor genes are not contiguously linked but still bind to operator sequences that in turn control expression.
[0129] Suitable host cells include prokaryotes, lower eukaryotes, and higher eukaryotes. Prokaryotes include both gram negative and gram positive organisms, e.g., E. coli and B. subtilis. Lower eukaryotes include yeasts, e.g., S. cerevisiae and Pichia, and species of the genus Dictyostelium. Higher eukaryotes include established tissue culture cell lines from animal cells, both of non-mammalian origin, e.g., insect cells, and birds, and of mammalian origin, e.g., human, primates, and rodents.
[0130] Prokaryotic host-vector systems include a wide variety of vectors for many different species. As used herein, E. coli and its vectors will be used generically to include equivalent vectors used in other prokaryotes. A representative vector for amplifying DNA is pBR322 or many of its derivatives. Vectors that can be used to express the receptor or its fragments include, but are not limited to, such vectors as those containing the lac promoter (pUC-series); trp promoter (pBR322-trp); Ipp promoter (the pIN-series); lambda-pP or pR promoters (pOTS); or hybrid promoters such as ptac (pDR540). See Brosius, et al. (1988) “Expression Vectors Employing Lambda-, trp-, lac-, and Ipp-derived Promoters”, in Vectors: A Survey of Molecular Cloning Vectors and Their Uses, (eds. Rodriguez and Denhardt), Buttersworth, Boston, Chapter 10, pp. 205-236, which is incorporated herein by reference.
[0131] Lower eukaryotes, e.g., yeasts and Dictyostelium, may be transformed with IL-1RD9 sequence containing vectors. For purposes of this invention, the most common lower eukaryotic host is the baker's yeast, Saccharomyces cerevisiae. It will be used to generically represent lower eukaryotes although a number of other strains and species are also available. Yeast vectors typically consist of a replication origin (unless of the integrating type), a selection gene, a promoter, DNA encoding the receptor or its fragments, and sequences for translation termination, polyadenylation, and transcription termination. Suitable expression vectors for yeast include such constitutive promoters as 3-phosphoglycerate kinase and various other glycolytic enzyme gene promoters or such inducible promoters as the alcohol dehydrogenase 2 promoter or metallothionine promoter. Suitable vectors include derivatives of the following types: self-replicating low copy number (such as the YRp-series), self-replicating high copy number (such as the YEp-series); integrating types (such as the YIp-series), or mini-chromosomes (such as the YCp-series).
[0132] Higher eukaryotic tissue culture cells are normally the preferred host cells for expression of the functionally active interleukin protein. In principle, many higher eukaryotic tissue culture cell lines are workable, e.g., insect baculovirus expression systems, whether from an invertebrate or vertebrate source. However, mammalian cells are preferred. Transformation or transfection and propagation of such cells has become a routine procedure. Examples of useful cell lines include HeLa cells, Chinese hamster ovary (CHO) cell lines, baby rat kidney (BRK) cell lines, insect cell lines, bird cell lines, and monkey (COS) cell lines. Expression vectors for such cell lines usually include an origin of replication, a promoter, a translation initiation site, RNA splice sites (if genomic DNA is used), a polyadenylation site, and a transcription termination site. These vectors also usually contain a selection gene or amplification gene. Suitable expression vectors may be plasmids, viruses, or retroviruses carrying promoters derived, e.g., from such sources as from adenovirus, SV40, parvoviruses, vaccinia virus, or cytomegalovirus. Representative examples of suitable expression vectors include pCDNA1; pCD, see Okayama, et al. (1985) Mol. Cell Biol. 5:1136-1142; pMC1neo PolyA, see Thomas, et al. (1987) Cell 51:503-512; and a baculovirus vector such as pAC 373 or pAC 610.
[0133] For secreted proteins, an open reading frame usually encodes a polypeptide that consists of a mature or secreted product covalently linked at its N-terminus to a signal peptide. The signal peptide is cleaved prior to secretion of the mature, or active, polypeptide. The cleavage site can be predicted with a high degree of accuracy from empirical rules, e.g., von-Heijne (1986) Nucleic Acids Research 14:4683-4690 and Nielsen, et al. (1997) Protein Eng. 10:1-12, and the precise amino acid composition of the signal peptide often does not appear to be critical to its function, e.g., Randall, et al. (1989) Science 243:1156-1159; Kaiser, et al. (1987) Science 235:312-317.
[0134] It will often be desired to express these polypeptides in a system which provides a specific or defined glycosylation pattern. In this case, the usual pattern will be that provided naturally by the expression system. However, the pattern will be modifiable by exposing the polypeptide, e.g., an unglycosylated form, to appropriate glycosylating proteins introduced into a heterologous expression system. For example, the receptor gene may be co-transformed with one or more genes encoding mammalian or other glycosylating enzymes. Using this approach, certain mammalian glycosylation patterns will be achievable in prokaryote or other cells.
[0135] The source of IL-1RD8, IL-1RD9, or IL-1RD10 can be a eukaryotic or prokaryotic host expressing recombinant IL-1RD8, IL-1RD9, or IL-1RD10 such as is described above. The source can also be a cell line such as mouse Swiss 3T3 fibroblasts, but other mammalian cell lines are also contemplated by this invention, with the preferred cell line being from the human species.
[0136] Now that the sequences are known, the primate IL-1Rs, fragments, or derivatives thereof can be prepared by conventional processes for synthesizing peptides. These include processes such as are described in Stewart and Young (1984) Solid Phase Peptide Synthesis, Pierce Chemical Co., Rockford, Ill.; Bodanszky and Bodanszky (1984) The Practice of Peptide Synthesis, Springer-Verlag, New York; and Bodanszky (1984) The Principles of Peptide Synthesis, Springer-Verlag, New York; all of each which are incorporated herein by reference. For example, an azide process, an acid chloride process, an acid anhydride process, a mixed anhydride process, an active ester process (e.g., p-nitrophenyl ester, N-hydroxysuccinimide ester, or cyanomethyl ester), a carbodiimidazole process, an oxidative-reductive process, or a dicyclohexylcarbodiimide (DCCD)/additive process can be used. Solid phase and solution phase syntheses are both applicable to the foregoing processes. Similar techniques can be used with partial IL-1RD9 sequences.
[0137] The IL-1RD8, IL-1RD9, or IL-1RD10 proteins, polypeptides, fragments, or derivatives are suitably prepared in accordance with the above processes as typically employed in peptide synthesis, generally either by a so-called stepwise process which comprises condensing an amino acid to the terminal amino acid, one by one in sequence, or by coupling peptide fragments to the terminal amino acid. Amino groups that are not being used in the coupling reaction typically must be protected to prevent coupling at an incorrect location.
[0138] If a solid phase synthesis is adopted, the C-terminal amino acid is bound to an insoluble carrier or support through its carboxyl group. The insoluble carrier is not particularly limited as long as it has a binding capability to a reactive carboxyl group. Examples of such insoluble carriers include halomethyl resins, such as chloromethyl resin or bromomethyl resin, hydroxymethyl resins, phenol resins, tert-alkyloxycarbonylhydrazidated resins, and the like.
[0139] An amino group-protected amino acid is bound in sequence through condensation of its activated carboxyl group and the reactive amino group of the previously formed peptide or chain, to synthesize the peptide step by step. After synthesizing the complete sequence, the peptide is split off from the insoluble carrier to produce the peptide. This solid-phase approach is generally described by Merrifield, et al. (1963) in J. Am. Chem. Soc. 85:2149-2156, which is incorporated herein by reference.
[0140] The prepared protein and fragments thereof can be isolated and purified from the reaction mixture by means of peptide separation, e.g., by extraction, precipitation, electrophoresis, various forms of chromatography, and the like. The receptors of this invention can be obtained in varying degrees of purity depending upon desired uses. Purification can be accomplished by use of the protein purification techniques disclosed herein, see below, or by the use of the antibodies herein described in methods of immunoabsorbant affinity chromatography. This immunoabsorbant affinity chromatography is carried out by first linking the antibodies to a solid support and then contacting the linked antibodies with solubilized lysates of appropriate cells, lysates of other cells expressing the receptor, or lysates or supernatants of cells producing the polypeptide as a result of DNA techniques, see below.
[0141] Generally, the purified protein will be at least about 40% pure, ordinarily at least about 50% pure, usually at least about 60% pure, typically at least about 70% pure, more typically at least about 80% pure, preferable at least about 90% pure and more preferably at least about 95% pure, and in particular embodiments, 97%-99% or more. Purity will usually be on a weight basis, but can also be on a molar basis. Different assays will be applied as appropriate. Similar concepts apply to polynucleotides and antibodies.
[0142] VI. Antibodies
[0143] Antibodies can be raised to the various mammalian IL-1RD8, IL-1RD9, or IL-1RD10 described herein, e.g., primate IL-1RD9 polypeptides and fragments thereof, both in naturally occurring native forms and in their recombinant forms, the difference being that antibodies to the active receptor are more likely to recognize epitopes which are only present in the native conformations. Denatured antigen detection can also be useful in, e.g., Western analysis. Anti-idiotypic antibodies are also contemplated, which would be useful as agonists or antagonists of a natural receptor or an antibody.
[0144] Antibodies, including binding fragments and single chain versions, against predetermined fragments of the polypeptide can be raised by immunization of animals with conjugates of the fragments with immunogenic proteins. Monoclonal antibodies are prepared from cells secreting the desired antibody. These antibodies can be screened for binding to normal or defective protein, or screened for agonistic or antagonistic activity. These monoclonal antibodies will usually bind with at least a KD of about 1 mM, more usually at least about 300 &mgr;M, typically at least about 100 &mgr;M, more typically at least about 30 &mgr;M, preferably at least about 10 &mgr;M, and more preferably at least about 3 &mgr;M or better.
[0145] The antibodies, including antigen binding fragments, of this invention can have significant diagnostic or therapeutic value. They can be potent antagonists that bind to the receptor and inhibit binding to ligand or inhibit the ability of the receptor to elicit a biological response, e.g., act on its substrate. They also can be useful as non-neutralizing antibodies and can be coupled to toxins or radionuclides to bind producing cells, or cells localized to the source of the interleukin. Further, these antibodies can be conjugated to drugs or other therapeutic agents, either directly or indirectly by means of a linker.
[0146] The antibodies of this invention can also be useful in diagnostic applications. As capture or non-neutralizing antibodies, they might bind to the receptor without inhibiting ligand or substrate binding. As neutralizing antibodies, they can be useful in competitive binding assays. They will also be useful in detecting or quantifying ligand. They may be used as reagents for Western blot analysis, or for immunoprecipitation or immunopurification of the respective protein.
[0147] Protein fragments may be joined to other materials, particularly polypeptides, as fused or covalently joined polypeptides to be used as immunogens. Mammalian IL-1Rs and fragments may be fused or covalently linked to a variety of immunogens, such as keyhole limpet hemocyanin, bovine serum albumin, tetanus toxoid, etc. See Microbiology, Hoeber Medical Division, Harper and Row, 1969; Landsteiner (1962) Specificity of Serological Reactions, Dover Publications, New York; and Williams, et al. (1967) Methods in Immunology and Immunochemistry, Vol. 1, Academic Press, New York; each of which are incorporated herein by reference, for descriptions of methods of preparing polyclonal antisera. A typical method involves hyperimmunization of an animal with an antigen. The blood of the animal is then collected shortly after the repeated immunizations and the gamma globulin is isolated.
[0148] In some instances, it is desirable to prepare monoclonal antibodies from various mammalian hosts, such as mice, rodents, primates, humans, etc. Description of techniques for preparing such monoclonal antibodies may be found in, e.g., Stites, et al. (eds.) Basic and Clinical Immunology (4th ed.), Lange Medical Publications, Los Altos, Calif., and references cited therein; Harlow and Lane (1988) Antibodies: A Laboratory Manual, CSH Press; Goding (1986) Monoclonal Antibodies: Principles and Practice (2d ed.) Academic Press, New York; and particularly in Kohler and Milstein (1975) in Nature 256:495-497, which discusses one method of generating monoclonal antibodies. Each of these references is incorporated herein by reference. Summarized briefly, this method involves injecting an animal with an immunogen. The animal is then sacrificed and cells taken from its spleen, which are then fused with myeloma cells. The result is a hybrid cell or “hybridoma” that is capable of reproducing in vitro. The population of hybridomas is then screened to isolate individual clones, each of which secrete a single antibody species to the immunogen. In this manner, the individual antibody species obtained are the products of immortalized and cloned single B cells from the immune animal generated in response to a specific site recognized on the immunogenic substance.
[0149] Other suitable techniques involve in vitro exposure of lymphocytes to the antigenic polypeptides or alternatively to selection of libraries of antibodies in phage or similar vectors. See, Huse, et al. (1989) “Generation of a Large Combinatorial Library of the Immunoglobulin Repertoire in Phage Lambda,” Science 246:1275-1281; and Ward, et al. (1989) Nature 341:544-546, each of which is hereby incorporated herein by reference. The polypeptides and antibodies of the present invention may be used with or without modification, including chimeric or humanized antibodies. Frequently, the polypeptides and antibodies will be labeled by joining, either covalently or non-covalently, a substance which provides for a detectable signal. A wide variety of labels and conjugation techniques are known and are reported extensively in both the scientific and patent literature. Suitable labels include radionuclides, enzymes, substrates, cofactors, inhibitors, fluorescent moieties, chemiluminescent moieties, magnetic particles, and the like. Patents, teaching the use of such labels include U.S. Pat. Nos. 3,817,837; 3,850,752; 3,939,350; 3,996,345; 4,277,437; 4,275,149; and 4,366,241. Also, recombinant or chimeric immunoglobulins may be produced, see Cabilly, U.S. Pat. No. 4,816,567; or made in transgenic mice, see Mendez, et al. (1997) Nature Genetics 15:146-156. These references are incorporated herein by reference.
[0150] The antibodies of this invention can also be used for affinity chromatography in isolating the IL-1Rs. Columns can be prepared where the antibodies are linked to a solid support, e.g., particles, such as agarose, Sephadex, or the like, where a cell lysate may be passed through the column, the column washed, followed by increasing concentrations of a mild denaturant, whereby the purified protein will be released. The protein may be used to purify antibody.
[0151] The antibodies may also be used to screen expression libraries for particular expression products. Usually the antibodies used in such a procedure will be labeled with a moiety allowing easy detection of presence of antigen by antibody binding.
[0152] Antibodies raised against an IL-1R will also be used to raise anti-idiotypic antibodies. These will be useful in detecting or diagnosing various immunological conditions related to expression of the protein or cells which express the protein. They also will be useful as agonists or antagonists of the ligand, which may be competitive inhibitors or substitutes for naturally occurring ligands.
[0153] An IL-1R polypeptide that specifically binds to or that is specifically immunoreactive with an antibody generated against a defined immunogen, such as an immunogen consisting of the amino acid sequence of, e.g., SEQ ID NO: 4, 10, or 35, is typically determined in an immunoassay. The immunoassay typically uses a polyclonal antiserum which was raised, e.g., to a polypeptide of SEQ ID NO: 4, 10, or 35. This antiserum is selected to have low crossreactivity against other IL-1R family members, e.g., IL-1Rs D1 through D8, preferably from the same species, and any such crossreactivity is removed by immunoabsorption prior to use in the immunoassay.
[0154] To produce antisera for use in an immunoassay, the polypeptide of, e.g., SEQ ID NO: 4, 10, or 35, is isolated as described herein. For example, recombinant polypeptide may be produced in a mammalian cell line. An appropriate host, e.g., an inbred strain of mice such as Balb/c, is immunized with the selected protein, typically using a standard adjuvant, such as Freund's adjuvant, and a standard mouse immunization protocol (see Harlow and Lane, supra). Alternatively, a synthetic peptide derived from the sequences disclosed herein and conjugated to a carrier polypeptide can be used an immunogen. Polyclonal sera are collected and titered against the immunogen polypeptide in an immunoassay, e.g., a solid phase immunoassay with the immunogen immobilized on a solid support. Polyclonal antisera with a titer of 104 or greater are selected and tested for their cross reactivity against other IL-1R family members, e.g., IL-1RD1 through IL-1RD6, using a competitive binding immunoassay such as the one described in Harlow and Lane, supra, at pages 570-573. Preferably at least two IL-1R family members are used in this determination. These IL-1R family members can be produced as recombinant polypeptides and isolated using standard molecular biology and protein chemistry techniques as described herein.
[0155] Immunoassays in the competitive binding format can be used for the crossreactivity determinations. For example, the polypeptide of SEQ ID NO: 4, 10, or 35 can be immobilized to a solid support. Polypeptides added to the assay compete with the binding of the antisera to the immobilized antigen. The ability of the above polypeptides to compete with the binding of the antisera to the immobilized polypeptide is compared to the polypeptides of IL-1RD1 through IL-1RD6. The percent crossreactivity for the above polypeptides is calculated, using standard calculations. Those antisera with less than 10% crossreactivity with each of the polypeptides listed above are selected and pooled. The cross-reacting antibodies are then removed from the pooled antisera by immunoabsorption with the above-listed proteins.
[0156] The immunoabsorbed and pooled antisera are then used in a competitive binding immunoassay as described above to compare a second polypeptide to the immunogen polypeptide (e.g., the IL-1RD8, IL-1RD9, or IL-1RD10 like polypeptide of SEQ ID NO: 4, 10, or 35). To make this comparison, the two polypeptides are each assayed at a wide range of concentrations and the amount of each polypeptide required to inhibit 50% of the binding of the antisera to the immobilized polypeptide is determined. If the amount of the second polypeptide required is less than twice the amount of the polypeptide of the selected polypeptide or polypeptides that is required, then the second polypeptide is said to specifically bind to an antibody generated to the immunogen.
[0157] It is understood that these IL-1R polypeptides are members of a family of homologous polypeptides that comprise at least 7 genes previously identified. For a particular gene product, such as, e.g., IL-1RD9, the term refers not only to the amino acid sequences disclosed herein, but also to other polypeptides that are allelic, non-allelic, or species variants. It is also understood that the terms include nonnatural mutations introduced by deliberate mutation using conventional recombinant technology such as single site mutation, or by excising short sections of DNA encoding the respective proteins, or by substituting new amino acids, or adding new amino acids. Such minor alterations typically will substantially maintain the immunoidentity of the original molecule and/or its biological activity. Thus, these alterations include polypeptides that are specifically immunoreactive with a designated naturally occurring IL-1RD8, IL-1RD9, or IL-1RD10 protein. The biological properties of the altered polypeptides can be determined by expressing the polypeptide in an appropriate cell line and measuring the appropriate effect, e.g., upon transfected lymphocytes. Particular polypeptide modifications considered minor would include conservative substitution of amino acids with similar chemical properties, as described above for the IL-1R family as a whole. By aligning a polypeptide optimally with the polypeptide of the IL-1Rs and by using the conventional immunoassays described herein to determine immunoidentity, one can determine the polypeptide compositions of the invention.
[0158] VII. Kits and Quantitation
[0159] Both naturally occurring and recombinant forms of the IL-1R like molecules of this invention are particularly useful in kits and assay methods. For example, these methods would also be applied to screening for binding activity, e.g., ligands for these proteins. Several methods of automating assays have been developed in recent years so as to permit screening of tens of thousands of compounds per year. See, e.g., a BIOMEK automated workstation, Beckman Instruments, Palo Alto, Calif., and Fodor, et al. (1991) Science 251:767-773, which is incorporated herein by reference. The latter describes means for testing binding by a plurality of defined polymers synthesized on a solid substrate. The development of suitable assays to screen for a ligand or agonist/antagonist homologous polypeptides can be greatly facilitated by the availability of large amounts of purified, soluble IL-1Rs in an active state such as is provided by this invention.
[0160] Purified IL-1RD8, IL-1RD9, or IL-1RD10 can be coated directly onto plates for use in the aforementioned ligand screening techniques. However, non-neutralizing antibodies to these polypeptides can be used as capture antibodies to immobilize the respective receptor on the solid phase, useful, e.g., in diagnostic uses.
[0161] This invention also contemplates use of IL-1RD8, IL-1RD9, or IL-1RD10 fragments thereof, peptides, and their fusion products in a variety of diagnostic kits and methods for detecting the presence of the protein or its ligand. Alternatively, or additionally, antibodies against the molecules may be incorporated into the kits and methods. Typically the kit will have a compartment containing, e.g., either an IL-1RD9 peptide or gene segment or a reagent which recognizes one or the other. Typically, recognition reagents, in the case of peptide, would be a ligand or antibody, or in the case of a gene segment, would usually be a hybridization probe.
[0162] A preferred kit for determining the concentration of IL-1RD8, IL-1RD9, or IL-1RD10 in a sample would typically comprise a labeled compound, e.g., ligand or antibody, having known binding affinity for IL-1RD9, a source of IL-1RD9 (naturally occurring or recombinant) as a positive control, and a means for separating the bound from free labeled compound, for example a solid phase for immobilizing the IL-1RD9 in the test sample. Compartments containing reagents, and instructions, will normally be provided.
[0163] Antibodies, including antigen binding fragments, specific for mammalian IL-1RD8 or a peptide fragment, or receptor fragments are useful in diagnostic applications to detect the presence of elevated levels of ligand and/or its fragments. Diagnostic assays may be homogeneous (without a separation step between free reagent and antibody-antigen complex) or heterogeneous (with a separation step). Various commercial assays exist, such as radioimmunoassay (RIA), enzyme-linked immunosorbent assay (ELISA), enzyme immunoassay (EIA), enzyme-multiplied immunoassay technique (EMIT), substrate-labeled fluorescent immunoassay (SLFIA) and the like. For example, unlabeled antibodies can be employed by using a second antibody which is labeled and which recognizes the antibody to an IL-1R or to a particular fragment thereof. These assays have also been extensively discussed in the literature. See, e.g., Harlow and Lane (1988) Antibodies: A Laboratory Manual, CSH., and Coligan (ed. 1991) and periodic supplements, Current Protocols In Immunology Greene/Wiley, New York.
[0164] Anti-idiotypic antibodies may have similar use to serve as agonists or antagonists of IL-1Rs. These should be useful as therapeutic reagents under appropriate circumstances.
[0165] Frequently, the reagents for diagnostic assays are supplied in kits, so as to optimize the sensitivity of the assay. For the subject invention, depending upon the nature of the assay, the protocol, and the label, either labeled or unlabeled antibody, or labeled ligand is provided. This is usually in conjunction with other additives, such as buffers, stabilizers, materials necessary for signal production such as substrates for enzymes, and the like. Preferably, the kit will also contain instructions for proper use and disposal of the contents after use. Typically the kit has compartments for each useful reagent, and will contain instructions for proper use and disposal of reagents. Desirably, the reagents are provided as a dry lyophilized powder, where the reagents may be reconstituted in an aqueous medium having appropriate concentrations for performing the assay.
[0166] The aforementioned constituents of the diagnostic assays may be used without modification or may be modified in a variety of ways. For example, labeling may be achieved by covalently or non-covalently joining a moiety which directly or indirectly provides a detectable signal. In many of these assays, a test compound, IL-1R, or antibodies thereto can be labeled either directly or indirectly. Possibilities for direct labeling include label groups: radiolabels such as 125I, enzymes (U.S. Pat. No. 3,645,090) such as peroxidase and alkaline phosphatase, and fluorescent labels (U.S. Pat. No. 3,940,475) capable of monitoring the change in fluorescence intensity, wavelength shift, or fluorescence polarization. Both of the patents are incorporated herein by reference. Possibilities for indirect labeling include biotinylation of one constituent followed by binding to avidin coupled to one of the above label groups.
[0167] There are also numerous methods of separating the bound from the free ligand, or alternatively the bound from the free test compound. The IL-1R can be immobilized on various matrixes followed by washing. Suitable matrices include plastic such as an ELISA plate, filters, and beads. Methods of immobilizing the receptor to a matrix include, without limitation, direct adhesion to plastic, use of a capture antibody, chemical coupling, and biotin-avidin. The last step in this approach involves the precipitation of antibody/antigen complex by any of several methods including those utilizing, e.g., an organic solvent such as polyethylene glycol or a salt such as ammonium sulfate. Other suitable separation techniques include, without limitation, the fluorescein antibody magnetizable particle method described in Rattle, et al. (1984) Clin. Chem. 30(9):1457-1461, and the double antibody magnetic particle separation as described in U.S. Pat. No. 4,659,678, each of which is incorporated herein by reference.
[0168] The methods for linking protein or fragments to various labels have been extensively reported in the literature and do not require detailed discussion here. Many of the techniques involve the use of activated carboxyl groups either through the use of carbodiimide or active esters to form peptide bonds, the formation of thioethers by reaction of a mercapto group with an activated halogen such as chloroacetyl, or an activated olefin such as maleimide, for linkage, or the like. Fusion polypeptides will also find use in these applications.
[0169] Another diagnostic aspect of this invention involves use of oligonucleotide or polynucleotide sequences taken from the sequence of an IL-1R. These sequences can be used as probes for detecting levels of the respective IL-1R in patients suspected of having an immunological disorder. The preparation of both RNA and DNA nucleotide sequences, the labeling of the sequences, and the preferred size of the sequences has received ample description and discussion in the literature. Normally an oligonucleotide probe should have at least about 14 nucleotides, usually at least about 18 nucleotides, and the polynucleotide probes may be up to several kilobases. Various labels may be employed, most commonly radionuclides, particularly 32P. However, other techniques may also be employed, such as using biotin modified nucleotides for introduction into a polynucleotide. The biotin then serves as the site for binding to avidin or antibodies, which may be labeled with a wide variety of labels, such as radionuclides, fluorescers, enzymes, or the like. Alternatively, antibodies may be employed which can recognize specific duplexes, including DNA duplexes, RNA duplexes, DNA-RNA hybrid duplexes, or DNA-protein duplexes. The antibodies in turn may be labeled and the assay carried out where the duplex is bound to a surface, so that upon the formation of duplex on the surface, the presence of antibody bound to the duplex can be detected. The use of probes to the novel anti-sense RNA may be carried out in conventional techniques such as nucleic acid hybridization, plus and minus screening, recombinational probing, hybrid released translation (HRT), and hybrid arrested translation (HART). This also includes amplification techniques such as polymerase chain reaction (PCR).
[0170] Diagnostic kits which also test for the qualitative or quantitative presence of other markers are also contemplated. Diagnosis or prognosis may depend on the combination of multiple indications used as markers. Thus, kits may test for combinations of markers. See, e.g., Viallet, et al. (1989) Progress in Growth Factor Res. 1:89-97.
[0171] VIII. Therapeutic Utility
[0172] This invention provides reagents with significant therapeutic value. The IL-1Rs (naturally occurring or recombinant), fragments thereof, mutein receptors, and antibodies, along with compounds identified as having binding affinity to the receptors or antibodies, should be useful in the treatment of conditions exhibiting abnormal expression of the receptors of their ligands. Such abnormality will typically be manifested by immunological disorders. Additionally, this invention should provide therapeutic value in various diseases or disorders associated with abnormal expression or abnormal triggering of response to the ligand. The IL-1 ligands have been suggested to be involved in morphologic development, e.g., dorso-ventral polarity determination, and immune responses, particularly the primitive innate responses. See, e.g., Sun, et al. (1991) Eur. J. Biochem. 196:247-254; Hultmark (1994) Nature 367:116-117.
[0173] Recombinant IL-1Rs, muteins, agonist or antagonist antibodies thereto, or antibodies can be purified and then administered to a patient. These reagents can be combined for therapeutic use with additional active ingredients, e.g., in conventional pharmaceutically acceptable carriers or diluents, along with physiologically innocuous stabilizers and excipients. These combinations can be sterile, e.g., filtered, and placed into dosage forms as by lyophilization in dosage vials or storage in stabilized aqueous preparations. This invention also contemplates use of antibodies or binding fragments thereof which are not complement binding.
[0174] Ligand screening using IL-1R or fragments thereof can be performed to identify molecules having binding affinity to the receptors. Subsequent biological assays can then be utilized to determine if a putative ligand can provide competitive binding, which can block intrinsic stimulating activity. Receptor fragments can be used as a blocker or antagonist in that it blocks the activity of ligand. Likewise, a compound having intrinsic stimulating activity can activate the receptor and is thus an agonist in that it simulates the activity of ligand, e.g., inducing signaling. This invention further contemplates the therapeutic use of antibodies to IL-1Rs as antagonists.
[0175] The quantities of reagents necessary for effective therapy will depend upon many different factors, including means of administration, target site, reagent physiological life, pharmacological life, physiological state of the patient, and other medicants administered. Thus, treatment dosages should be titrated to optimize safety and efficacy. Typically, dosages used in vitro may provide useful guidance in the amounts useful for in situ administration of these reagents. Animal testing of effective doses for treatment of particular disorders will provide further predictive indication of human dosage. Various considerations are described, e.g., in Gilman, et al. (eds. 1990) Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; and Remington's Pharmaceutical Sciences, 17th ed. (1990), Mack Publishing Co., Easton, Pa.; each of which is hereby incorporated herein by reference. Methods for administration are discussed therein and below, e.g., for oral, intravenous, intraperitoneal, or intramuscular administration, transdermal diffusion, and others. Pharmaceutically acceptable carriers will include water, saline, buffers, and other compounds described, e.g., in the Merck Index, Merck & Co., Rahway, N.J. Because of the likely high affinity binding, or turnover numbers, between a putative ligand and its receptors, low dosages of these reagents would be initially expected to be effective. And the signaling pathway suggests extremely low amounts of ligand may have effect. Thus, dosage ranges would ordinarily be expected to be in amounts lower than 1 mM concentrations, typically less than about 10 &mgr;M concentrations, usually less than about 100 nM, preferably less than about 10 pM (picomolar), and most preferably less than about 1 fM (femtomolar), with an appropriate carrier. Slow release formulations, or slow release apparatus will often be utilized for continuous administration.
[0176] IL-1Rs, fragments thereof, and antibodies or its fragments, antagonists, and agonists, may be administered directly to the host to be treated or, depending on the size of the compounds, it may be desirable to conjugate them to carrier proteins such as ovalbumin or serum albumin prior to their administration. Therapeutic formulations may be administered in many conventional dosage formulations. While it is possible for the active ingredient to be administered alone, it is preferable to present it as a pharmaceutical formulation. Formulations typically comprise at least one active ingredient, as defined above, together with one or more acceptable carriers thereof. However, combinations of the compositions of the inventions with each other and with other compositions or reagents are also contemplated and encompassed by the present specification e.g., IL-1RD5 combined with IL-1RD9, Additionally, both agonists or antagonists, are contemplated in combination with compositions of the invention. Every carrier should be both pharmaceutically and physiologically acceptable in the sense of being compatible with the other ingredients and not injurious to the patient. Formulations comprise at least one active ingredient, as defined above, together with one or more acceptable carriers thereof. Formulations include those suitable for oral, rectal, nasal, or parenteral (including subcutaneous, intramuscular, intravenous and intradermal) administration. The formulations may conveniently be presented in unit dosage form and may be prepared by methods well known in the art of pharmacy. See, e.g., Gilman, et al. (eds. 1990) Goodman and Gilman's: The Pharmacological Bases of Therapeutics, 8th Ed., Pergamon Press; and Remington's Pharmaceutical Sciences, 17th ed. (1990), Mack Publishing Co., Easton, Pa.; Avis, et al. (eds. 1993) Pharmaceutical Dosage Forms: Parenteral Medications Dekker, N.Y.; Lieberman, et al. (eds. 1990) Pharmaceutical Dosage Forms: Tablets Dekker, N.Y.; and Lieberman, et al. (eds. 1990) Pharmaceutical Dosage Forms: Disperse Systems Dekker, N.Y. The therapy of this invention may be combined with or used in association with other therapeutic agents, particularly agonists or antagonists of other IL-1 family members.
[0177] IX. Ligands
[0178] The description of the IL-1 receptors herein provide means to identify ligands, as described above. Such ligand should bind specifically to the respective receptor with reasonably high affinity. Typical ligand receptor binding constants will be at least about 30 mM, e.g., generally at least about 3 mM, more generally at least about 300 &mgr;M, typically at least about 30 &mgr;M, 3 &mgr;M, 300 nM, 30 nM, etc. Various constructs are made available which allow either labeling of the receptor to detect its ligand. For example, directly labeling IL-1R, fusing onto it markers for secondary labeling, e.g., FLAG or other epitope tags, etc., will allow detection of receptor. This can be histological, as an affinity method for biochemical purification, or labeling or selection in an expression cloning approach. A two-hybrid selection system may also be applied making appropriate constructs with the available IL-1R sequences. See, e.g., Fields and Song (1989) Nature 340:245-246.
[0179] Generally, descriptions of IL-1Rs will be analogously applicable to individual specific embodiments directed to IL-1RD8, IL-1RD9, or IL-1RD10 reagents and compositions.
[0180] The broad scope of this invention is best understood with reference to the following examples, which are not intended to limit the inventions to the specific embodiments.
EXAMPLES[0181] I. General Methods
[0182] Some of the standard methods are described or referenced, e.g., in Maniatis, et al. (1982) Molecular Cloning, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor Press; Sambrook, et al. (1989) Molecular Cloning: A Laboratory Manual, (2d ed.), vols. 1-3, CSH Press, NY; Ausubel, et al. Biology Greene Publishing Associates, Brooklyn, N.Y.; or Ausubel, et al. (1987 and Supplements) Current Protocols in Molecular Biology, Greene/Wiley, New York. Methods for protein purification include such methods as ammonium sulfate precipitation, column chromatography, electrophoresis, centrifugation, crystallization, and others. See, e.g., Ausubel, et al. (1987 and periodic supplements); Coligan, et al. (ed. 1996 and periodic supplements) Current Protocols In Protein Science Greene/Wiley, New York; Deutscher (1990) “Guide to Protein Purification” in Methods in Enzymology, vol. 182, and other volumes in this series; and manufacturer's literature on use of protein purification products, e.g., Pharmacia, Piscataway, N.J., or Bio-Rad, Richmond, Calif. Combination with recombinant techniques allow fusion to appropriate segments, e.g., to a FLAG sequence or an equivalent which can be fused via a protease-removable sequence. See, e.g., Hochuli (1989) Chemische Industrie 12:69-70; Hochuli (1990) “Purification of Recombinant Proteins with Metal Chelate Absorbent” in Setlow (ed.) Genetic Engineering, Principle and Methods 12:87-98, Plenum Press, N.Y.; and Crowe, et al. (1992) OIAexpress: The High Level Expression & Protein Purification System QUIAGEN, Inc., Chatsworth, Calif.
[0183] Computer sequence analysis is performed, e.g., using available software programs, including those from the GCG (U. Wisconsin) and GenBank sources. Public sequence databases were also used, e.g., from GenBank, NCBI, SWISSPROT, and others.
[0184] Many techniques applicable to IL-10 receptors may be applied to IL-1Rs, as described, e.g., in U.S. Ser. No. 08/110,683 (IL-10 receptor), which is incorporated herein by reference for all purposes. Also, while many of the techniques described are directed to the IL-1RD9 reagents, corresponding methods will typically be applicable with the IL-1RD8, and IL-1RD10 reagents. See also, U.S. Ser. No. 60/065,776, filed Nov. 17, 1997, and U.S. Ser. No. 60/078,008, filed Mar. 12, 1998, both of which are incorporated herein by reference.
[0185] II. Computational Analysis.
[0186] Human sequences related to IL-1Rs were identified from various EST databases using, e.g., the BLAST server (Altschul, et al. (1994) Nature Genet. 6:119-129). More sensitive pattern- and profile-based methods (Bork and Gibson (1996) Meth. Enzymol. 266:162-184) were used to identify a fragment of a gene which exhibited certain homology to the IL-1Rs.
[0187] III. Cloning of Full-Length Human IL-1R cDNAs.
[0188] PCR primers derived from the IL-1RD8, IL-1RD9, or IL-1RD10 sequences are used (Nomura, et al. (1994) DNA Res. 1:27-35) to probe an appropriate human cDNA library to yield a full length IL-1RD9 or IL-1RD10 cDNA sequence or to probe a human erythroleukemic, TF-1 cell line-derived cDNA library (Kitamura, et al. (1989) Blood 73:375-380) to yield the IL-1R8 cDNA sequence. Full length cDNAs for human IL-1RD9 are cloned, e.g., by DNA hybridization screening of &lgr;gt10 phage. PCR reactions were conducted using T. aquaticus Taqplus DNA polymerase (Stratagene) under appropriate conditions.
[0189] IV. Localization of IL-1RD8, IL-1RD9, and IL-1RD10 mRNA
[0190] Human multiple tissue (Cat# 1, 2) and cancer cell line blots (Cat# 7757-1), containing approximately 2 &mgr;g of poly(A)+ RNA per lane, are purchased from Clontech (Palo Alto, Calif.). Probes are radiolabeled with [&agr;-32P] dATP, e.g., using the Amersham Rediprime random primer labeling kit (RPN1633). Prehybridization and hybridizations are performed at 65° C. in 0.5 M Na2HPO4, 7% SDS, 0.5 M EDTA (pH 8.0). High stringency washes are conducted, e.g., at 65° C. with two initial washes in 2× SSC, 0.1% SDS for 40 min followed by a subsequent wash in 0.1× SSC, 0.1% SDS for 20 min. Membranes are then exposed at −70° C. to X-Ray film (Kodak) in the presence of intensifying screens. More detailed studies by cDNA library Southerns are performed with selected human IL-1RD9 clones to examine their expression in hemopoietic or other cell subsets.
[0191] Two prediction algorithms that take advantage of the patterns of conservation and variation in multiply aligned sequences, PHD (Rost and Sander (1994) Proteins 19:55-72) and DSC (King and Sternberg (1996) Protein Sci. 5:2298-2310), are used.
[0192] Alternatively, two appropriate primers are selected from Tables 1, 2, or 3. RT-PCR is used on an appropriate mRNA sample selected for the presence of message to produce a cDNA, e.g., a sample which expresses the gene.
[0193] Full length clones may be isolated by hybridization of cDNA libraries from appropriate tissues pre-selected by PCR signal. Northern blots can be performed.
[0194] Message for genes encoding, e.g., IL-1RD9 will be assayed by appropriate technology, e.g., PCR, immunoassay, hybridization, or otherwise. Tissue and organ cDNA preparations are available, e.g., from Clontech, Mountain View, Calif. Identification of sources of natural expression are useful, as described. And the identification of functional receptor subunit pairings will allow for prediction of what cells express the combination of receptor subunits which will result in a physiological responsiveness to each of the IL-1 ligands.
[0195] The message for IL-1RD9 is quite rare, as it is not found with a degree of frequency in the available sequence databases. This suggests, e.g., a very rare message, or a highly restricted distribution. IL-1R9 is expressed predominantly on T cells, NK cells, monocytes and dendritic cells.
[0196] Southern Analysis on cDNA libraries can be performed: DNA (5 &mgr;g) from a primary amplified cDNA library is digested with appropriate restriction enzymes to release the inserts, run on a 1% agarose gel and transferred to a nylon membrane (Schleicher and Schuell, Keene, N.H.).
[0197] Samples for human mRNA isolation may include, e.g.: peripheral blood mononuclear cells (monocytes, T cells, NK cells, granulocytes, B cells), resting (T100); peripheral blood mononuclear cells, activated with anti-CD3 for 2, 6, 12 h pooled (T101); T cell, TH0 clone Mot 72, resting (T102); T cell, TH0 clone Mot 72, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T103); T cell, TH0 clone Mot 72, anergic treated with specific peptide for 2, 7, 12 h pooled (T104); T cell, TH1 clone HY06, resting (T107); T cell, TH1 clone HY06, activated with anti-CD28 and anti-CD3 for 3, 6, 12 h pooled (T108); T cell, TH1 clone HY06, anergic treated with specific peptide for 2, 6, 12 h pooled (T109); T cell, TH2 clone HY935, resting (T110); T cell, TH2 clone HY935, activated with anti-CD28 and anti-CD3 for 2, 7, 12 h pooled (T111); T cells CD4+CD45RO- T cells polarized 27 days in anti-CD28, IL-4, and anti IFN-&ggr;, TH2 polarized, activated with anti-CD3 and anti-CD28 4 h (T116); T cell tumor lines Jurkat and Hut78, resting (T117); T cell clones, pooled AD130.2, Tc783.12, Tc783.13, Tc783.58, Tc782.69, resting (T118); T cell random &ggr;&dgr; cell clones, resting (T119); Splenocytes, resting (B100); Splenocytes, activated with anti-CD40 and IL-4 (B101); B cell EBV lines pooled WT49, RSB, JY, CVIR, 721.221, RM3, HSY, resting (B102); B cell line JY, activated with PMA and ionomycin for 1, 6 h pooled (B103); NK 20 clones pooled, resting (K100); NK 20 clones pooled, activated with PMA and ionomycin for 6 h (K101); NKL clone, derived from peripheral blood of LGL leukemia patient, IL-2 treated (K106); NK cytotoxic clone 640-A30-1, resting (K107); hematopoietic precursor line TF1, activated with PMA and ionomycin for 1, 6 h pooled (C100); U937 premonocytic line, resting (M100); U937 premonocytic line, activated with PMA and ionomycin for 1, 6 h pooled (M101); elutriated monocytes, activated with LPS, IFN&ggr;, anti-IL-10 for 1, 2, 6, 12, 24 h pooled (M102); elutriated monocytes, activated with LPS, IFN&ggr;, IL-10 for 1, 2, 6, 12, 24 h pooled (M103); elutriated monocytes, activated with LPS, IFN&ggr;, anti-IL-10 for 4, 16 h pooled (M106); elutriated monocytes, activated with LPS, IFN&ggr;, IL-10 for 4, 16 h pooled (M107); elutriated monocytes, activated LPS for 1 h (M108); elutriated monocytes, activated LPS for 6 h (M109); DC 70% CD1a+, from CD34+ GM-CSF, TNF&agr; 12 days, resting (D101); DC 70% CD1a+, from CD34+ GM-CSF, TNF&agr; 12 days, activated with PMA and ionomycin for 1 h (D102); DC 70% CD1a+, from CD34+ GM-CSF, TNF&agr; 12 days, activated with PMA and ionomycin for 6 h (D103); DC 95% CD1a+, from CD34+ GM-CSF, TNF&agr; 12 days FACS sorted, activated with PMA and ionomycin for 1, 6 h pooled (D104); DC 95% CD14+, ex CD34+ GM-CSF, TNF&agr; 12 days FACS sorted, activated with PMA and ionomycin 1, 6 h pooled (D105); DC CD1a+ CD86+, from CD34+ GM-CSF, TNF&agr; 12 days FACS sorted, activated with PMA and ionomycin for 1, 6 h pooled (D106); DC from monocytes GM-CSF, IL-4 5 days, resting (D107); DC from monocytes GM-CSF, IL-4 5 days, resting (D 108); DC from monocytes GM-CSF, IL-4 5 days, activated LPS 4, 16 h pooled (D109); DC from monocytes GM-CSF, IL-4 5 days, activated TNF&agr;, monocyte supe for 4, 16 h pooled (D110); leiomyoma L11 benign tumor (X101); normal myometrium M5 (O115); malignant leiomyosarcoma GS1 (X103); lung fibroblast sarcoma line MRC5, activated with PMA and ionomycin for 1, 6 h pooled (C101); kidney epithelial carcinoma cell line CHA, activated with PMA and ionomycin for 1, 6 h pooled (C102); kidney fetal 28 wk male (O100); lung fetal 28 wk male (O101); liver fetal 28 wk male (O102); heart fetal 28 wk male (O103); brain fetal 28 wk male (O104); gallbladder fetal 28 wk male (O106); small intestine fetal 28 wk male (O107); adipose tissue fetal 28 wk male (O108); ovary fetal 25 wk female (O109); uterus fetal 25 wk female (O110); testes fetal 28 wk male (O111); spleen fetal 28 wk male (O112); adult placenta 28 wk (O113); tonsil inflamed, from 12 year old (X100); psoriasis human skin sample; normal human skin sample; pool of rheumatioid arthritis human; Hashimoto's thryroiditis thryroid; normal human throid; ulceratived colitis human colon; normal human colon; normal weight monkey colon; pheumocysitc carnii pneumonia lung; allergic lung; poll of three heavy smoker human lung; pool of two normal human lung; Ascaris-challenged monkey lung, 24 hr; Ascaris-challenged monkey lung, 4 hr; normal weight monkey lung.
[0198] IL-1RD8 message is described below in Table 5. There appears to be a correlation between developmental stage of tissues and the levels of messages: fetal and transformed tissues express high levels, whereas normal, adult tissues express low levels (with the exception of skeletal muscle). Further insights into this phenomenon will need further experiments.
[0199] Message for genes encoding IL-1RD8 will be assayed by appropriate technology, e.g., PCR, immunoassay, hybridization, or otherwise. Tissue and organ cDNA preparations are available, e.g., from Clontech, Mountain View, Calif. Identification of sources of natural expression are useful, as described. And the identification of functional receptor subunit pairings will allow for prediction of what cells express the combination of receptor subunits which will result in a physiological responsiveness to each of the IL-1 ligands.
[0200] Table 5: Multiple Tissue Northern Blots were screened with a radiolabeled probe, encompassing the cytoplasmic region of Interleukin-1 receptor R8 (IL-1RD8). The results are summarized below:
[0201] In all cases listed there is a smaller band at 3.4 Kb and in a few cases a larger band at 4.0 Kb as well. 5 Tissue 3.4 kb 4.0 kb Spleen weak Thymus weak Prostate weak Testis weak Ovary weak Small Intestine weak Colon (mucosal lining) weak Peripheral Blood Leukocyte weak Heart moderate Brain weak Placenta moderate Lung weak Liver weak Skeletal Muscle strong Kidney weak Pancreas weak Fetal brain strong weak Fetal lung strong weak Fetal Liver strong weak Fetal Kidney strong weak proleukocytic leukemia HL-60 strong HeLa Cell S3 very strong weak Chronic myelogenous leukemia, K-562 very strong weak Lymphoblastic leukemia, MOLT-4 weak Burkitt's lymphoma Rajii moderate Colorectal adenocarcinoma SW40 very strong strong Lung carcinoma A549 strong strong Melanoma very strong weak
[0202] V. Cloning of Species Counterparts of IL-1RDs
[0203] Various strategies are used to obtain species counterparts of IL-1RD8, IL-1RD9, and IL-1RD10 preferably from other primates. One method is by cross hybridization using closely related species DNA probes. It may be useful to go into evolutionarily similar species as intermediate steps. Another method is by using specific PCR primers based on the identification of blocks of similarity or difference between genes, e.g., areas of highly conserved or nonconserved polypeptide or nucleotide sequence. In addition, gene sequence databases may be screened for related sequences from other species.
[0204] VI. Production of Mammalian IL-1RD Protein
[0205] An appropriate, e.g., GST, fusion construct is engineered for expression, e.g., in E. coli. For example, a mouse IGIF pGex plasmid is constructed and transformed into E. coli. Freshly transformed cells are grown, e.g., in LB medium containing 50 &mgr;g/ml ampicillin and induced with IPTG (Sigma, St. Louis, Mo.). After overnight induction, the bacteria are harvested and the pellets containing, e.g., the IL-1R8 polypeptide are isolated. The pellets are homogenized, e.g., in TE buffer (50 mM Tris-base pH 8.0, 10 mM EDTA and 2 mM pefabloc) in 2 liters. This material is passed through a microfluidizer (Microfluidics, Newton, Mass.) three times. The fluidized supernatant is spun down on a Sorvall GS-3 rotor for 1 h at 13,000 rpm. The resulting supernatant containing the IL-1R polypeptide is filtered and passed over a glutathione-SEPHAROSE column equilibrated in 50 mM Tris-base pH 8.0. The fractions containing the IL-1RD9-GST fusion protein are pooled and cleaved, e.g., with thrombin (Enzyme Research Laboratories, Inc., South Bend, Ind.). The cleaved pool is then passed over a Q-SEPHAROSE column equilibrated in 50 mM Tris-base. Fractions containing IL-1RD9 are pooled and diluted in cold distilled H2O, to lower the conductivity, and passed back over a fresh Q-Sepharose column, alone or in succession with an immunoaffinity antibody column. Fractions containing the IL-1RD9 polypeptide are pooled, aliquoted, and stored in the −70° C. freezer.
[0206] Comparison of the CD spectrum with IL-1R polypeptide may suggest that the protein is correctly folded. See Hazuda, et al. (1969) J. Biol. Chem. 264:1689-1693.
[0207] VII. Determining Physiological Forms of Receptors
[0208] The IL-1&agr; and IL-1&bgr; ligands bind an IL-1RD1 as the primary receptor and this complex then forms a high affinity receptor complex with the IL-1RD3. Such receptor subunits are probably shared with the receptors for the new IL-1 ligand family members. See, e.g., U.S. Ser. No. 60/044,165 and U.S. Ser. No. 60/055,111. Combination of the IL-1RD9 (&agr; subunit type, based upon sequence analysis) will combine with the IL-1RD5 (&bgr; subunit type, based upon sequence analysis) to form a heterodimer receptor. The IL-1&dgr; and IL-1&egr; ligands each probably signal through a receptor comprising the association of IL-1RD4, IL-1RD6, or IL-1RD9 (alpha components) with IL-1RD3, IL-1RD8, or IL-1RD10 (beta components).
[0209] These defined subunit combinations can be tested now with the provided reagents. In particular, appropriate constructs can be made for transformation or transfection of subunits into cells. Constructs for the alpha chains, e.g., IL-1RD1, IL-1RD4, IL-1RD6, and IL-1RD9 forms can be made. Likewise for the beta subunits IL-1RD3, IL-1RD5, IL-1RD7, and IL-1RD8. Structurally, the IL-1RD10 is most similar to the IL-1RD8, suggesting that it may also be a beta receptor subunit. Combinatorial transfections of transformations can make cells expressing defined subunits, which can be tested for response to each of the IL-1 ligands. Appropriate cell types can be used, e.g., 293 T cells, Jurkat cells, with, e.g., a nuclear kappa B (NF&kgr;b) controlled luciferase reporter construct such as described e.g., in Otieno et al., (1997) Am J Physiol 273:F136-F143.
[0210] Such combinations of various IL-1 ligands and receptors were tested to determine if a functional signaling complex had been formed using an NF&kgr;b-controlled luciferase reporter construct to indicate formation of a functional signaling complex (+) or failure to form a functional signaling complex (−). The results, presented below,
[0211] IL-1&agr;+IL-1&bgr;+IL-1RD1+IL-1RD3=+;
[0212] IL-1&agr;+IL-1&bgr;+IL-1RD1+IL-1RD5=+;
[0213] IL-1&agr;+IL-1&bgr;+IL-1RD1+IL-1RD8=+;
[0214] IL-1&agr;+IL-1&bgr;+IL-1RD1+IL-1RD10 may=+/?;
[0215] suggest that IL-1RD3, IL-1RD5, IL-1RD8, and IL-1RD10 may functionally substitute for each other when in combination with IL-1&agr;+IL-1&bgr;+IL-1RD1.
[0216] Other combinations (below) demonstrate a failure of functional substitution; suggesting the importance of contextual dependence on substitution e.g., IL-1RD3, and IL-1RD8 cannot functionally replace IL-1RD5 in the following combination: IL-1&ggr;+IL-1RD9+IL-1RD5.
[0217] IL-1&ggr;+IL-1RD9+IL-1RD5=+;
[0218] IL-1&ggr;+IL-1RD9+IL-1RD3=−;
[0219] IL-1&ggr;+IL-1RD9+IL-1RD8=−;
[0220] A further series of experiments tested the ability of mouse (m) and human (h) homologues to functionally substitute for each other. The results, shown below,
[0221] mIL-1&ggr;+mIL-1RD5+mIL-1RD9=+;
[0222] mIL-1&ggr;+mIL-1RD5+hIL-1RD9=−;
[0223] mIL-1&ggr;+hIL-1RD5+hIL-1RD9=−;
[0224] mIL-1&ggr;+hIL-1RD5+mIL-1RD9=−;
[0225] hIL-1&ggr;+mIL-1RD5+mIL-1RD9=−;
[0226] hIL-1&ggr;+mIL-1RD5+hIL-1RD9=−;
[0227] hIL-1&ggr;+hIL-1RD5+mIL-1RD9=−;
[0228] hIL-1&ggr;+hIL-1RD5+hIL-1RD9=+;
[0229] suggest that species homogeneity is required to form a functioning complex in this particular constellation of ligand and receptor units.
[0230] Biological assays will generally be directed to the ligand binding feature of the protein or to the kinase/phosphatase activity of the receptor. The activity will typically be reversible, as are many other enzyme actions that mediate phosphatase or phosphorylase activities, which activities are easily measured by standard procedures. See, e.g., Hardie, et al. (eds. 1995) The Protein Kinase FactBook vols. I and II, Academic Press, San Diego, Calif.; Hanks, et al. (1991) Meth. Enzymol. 200:38-62; Hunter, et al. (1992) Cell 70:375-388; Lewin (1990) Cell 61:743-752; Pines, et al. (1991) Cold Spring Harbor Symp. Quant. Biol. 56:449-463; and Parker, et al. (1993) Nature 363:736-738.
[0231] The family of interleukins 1 contains molecules, each of which is an important mediator of inflammatory disease. For a comprehensive review, see Dinarello (1996) “Biologic basis for interleukin-1 in disease” Blood 87:2095-2147. There are suggestions that the various IL-1 ligands may play important roles in the initiation of disease, particularly inflammatory responses. The finding of novel polypeptides related to the IL-1 family furthers the identification of molecules that provide the molecular basis for initiation of disease and allow for the development of therapeutic strategies of increased range and efficacy.
[0232] VIII. Preparation of Antibodies Specific for IL-1Rs
[0233] Inbred Balb/c mice are immunized intraperitoneally with recombinant forms of the polypeptide, e.g., purified IL-1RD8, IL-1RD9, or IL-1RD10, or stable transfected NIH-3T3 cells. Animals are boosted at appropriate time points with protein, with or without additional adjuvant, to further stimulate antibody production. Serum is collected, or hybridomas produced with harvested spleens.
[0234] Alternatively, Balb/c mice are immunized with cells transformed with the gene or fragments thereof, either endogenous or exogenous cells, or with isolated membranes enriched for expression of the antigen. Serum is collected at the appropriate time, typically after numerous further administrations. Various gene therapy techniques may be useful, e.g., in producing protein in situ, for generating an immune response.
[0235] Monoclonal antibodies may be made. For example, splenocytes are fused with an appropriate fusion partner and hybridomas are selected in growth medium by standard procedures. Hybridoma supernatants are screened for the presence of antibodies which bind to the desired IL-1R, e.g., by ELISA or other assay. Antibodies which selectively recognize specific IL-1R embodiments may also be selected or prepared.
[0236] In another method, synthetic peptides or purified protein are presented to an immune system to generate monoclonal or polyclonal antibodies. See, e.g., Coligan (1991) Current Protocols in Immunology Wiley/Greene; and Harlow and Lane (1989) Antibodies: A Laboratory Manual Cold Spring Harbor Press. In appropriate situations, the binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods. Nucleic acids may also be introduced into cells in an animal to produce the antigen, which serves to elicit an immune response. See, e.g., Wang, et al. (1993) Proc. Nat'l. Acad. Sci. 90:4156-4160; Barry, et al. (1994) BioTechniques 16:616-619; and Xiang, et al. (1995) Immunity 2:129-135.
[0237] Moreover, antibodies which may be useful to determine the combination of the IL-1RD8, IL-1RD9, or IL-1RD10 with a functional beta subunit may be generated. Thus, e.g., epitopes characteristic of a particular functional alpha/beta combination may be identified with appropriate antibodies.
[0238] IX. Production of Fusion Proteins with IL-1Rs
[0239] Various fusion constructs are made with IL-1Rs. A portion of the appropriate gene is fused to an epitope tag, e.g., a FLAG tag, or to a two hybrid system construct. See, e.g., Fields and Song (1989) Nature 340:245-246.
[0240] The epitope tag may be used in an expression cloning procedure with detection with anti-FLAG antibodies to detect a binding partner, e.g., ligand for the respective IL-1R. The two hybrid system may also be used to isolate proteins which specifically bind, e.g., to IL-1RD9.
[0241] X. Mapping of Human or Mouse Genes
[0242] Chromosome spreads are prepared. In situ hybridization is performed on chromosome preparations obtained from phytohemagglutinin-stimulated human lymphocytes cultured for 72 h. 5-bromodeoxyuridine was added for the final seven hours of culture (60 &mgr;g/ml of medium), to ensure a posthybridization chromosomal banding of good quality.
[0243] A PCR fragment, amplified with the help of primers, is cloned into an appropriate vector. The vector is labeled by nick-translation with 3H. The radiolabeled probe is hybridized to metaphase spreads at final concentration of 200 ng/ml of hybridization solution as described in Mattei, et al. (1985) Hum. Genet. 69:327-331.
[0244] After coating with nuclear track emulsion (KODAK NTB2), slides are exposed. To avoid any slipping of silver grains during the banding procedure, chromosome spreads are first stained with buffered Giemsa solution and metaphase photographed. R-banding is then performed by the fluorochrome-photolysis-Giemsa (FPG) method and metaphases rephotographed before analysis.
[0245] The IL-1RD10 has been localized to the X chromosome.
[0246] XI. Structure Activity Relationship
[0247] Information on the criticality of particular residues is determined using standard procedures and analysis. Standard mutagenesis analysis is performed, e.g., by generating many different variants at determined positions, e.g., at the positions identified above, and evaluating biological activities of the variants. This may be performed to the extent of determining positions which modify activity, or to focus on specific positions to determine the residues which can be substituted to either retain, block, or modulate biological activity.
[0248] Alternatively, analysis of natural variants can indicate what positions tolerate natural mutations. This may result from population analysis of variation among individuals, or across strains or species. Samples from selected individuals are analyzed, e.g., by PCR analysis and sequencing. This allows evaluation of population polymorphisms.
[0249] XII. Isolation of a Ligand for IL-1Rs
[0250] An IL-1R can be used as a specific binding reagent to identify its binding partner, by taking advantage of its specificity of binding, much like an antibody would be used. Typically, the binding receptor is a heterodimer of receptor subunits. A binding reagent is either labeled as described above, e.g., fluorescence or otherwise, or immobilized to a substrate for panning methods.
[0251] The binding composition is used to screen an expression library made from a cell line which expresses a binding partner, i.e., ligand, preferably membrane associated. Standard staining techniques are used to detect or sort surface expressed ligand, or surface expressing transformed cells are screened by panning. Screening of intracellular expression is performed by various staining or immunofluorescence procedures. See also McMahan, et al. (1991) EMBO J. 10:2821-2832.
[0252] For example, on day 0, precoat 2-chamber permanox slides with 1 ml per chamber of fibronectin, 10 ng/ml in PBS, for 30 min at room temperature. Rinse once with PBS. Then plate COS cells at 2-3×105 cells per chamber in 1.5 ml of growth media. Incubate overnight at 37° C.
[0253] On day 1 for each sample, prepare 0.5 ml of a solution of 66 &mgr;g/ml DEAE-dextran, 66 &mgr;M chloroquine, and 4 &mgr;g DNA in serum free DME. For each set, a positive control is prepared, e.g., of IL-1R-FLAG cDNA at 1 and 1/200 dilution, and a negative mock. Rinse cells with serum free DME. Add the DNA solution and incubate 5 h at 37° C. Remove the medium and add 0.5 ml 10% DMSO in DME for 2.5 min. Remove and wash once with DME. Add 1.5 ml growth medium and incubate overnight.
[0254] On day 2, change the medium. On days 3 or 4, the cells are fixed and stained. Rinse the cells twice with Hank's Buffered Saline Solution (HBSS) and fix in 4% paraformaldehyde (PFA)/glucose for 5 min. Wash 3× with HBSS. The slides may be stored at −80° C. after all liquid is removed. For each chamber, 0.5 ml incubations are performed as follows. Add HBSS/saponin (0.1%) with 32 &mgr;l/ml of 1 M NaN3 for 20 min. Cells are then washed with HBSS/saponin 1×. Add appropriate IL-1R or IL-1R/antibody complex to cells and incubate for 30 min. Wash cells twice with HBSS/saponin. If appropriate, add first antibody for 30 min. Add second antibody, e.g., Vector anti-mouse antibody, at 1/200 dilution, and incubate for 30 min. Prepare ELISA solution, e.g., Vector Elite ABC horseradish peroxidase solution, and preincubate for 30 min. Use, e.g., 1 drop of solution A (avidin) and 1 drop solution B (biotin) per 2.5 ml HBSS/saponin. Wash cells twice with HBSS/saponin. Add ABC HRP solution and incubate for 30 min. Wash cells twice with HBSS, second wash for 2 min, which closes cells. Then add Vector diaminobenzoic acid (DAB) for 5 to 10 min. Use 2 drops of buffer plus 4 drops DAB plus 2 drops of H2O2 per 5 ml of glass distilled water. Carefully remove chamber and rinse slide in water. Air dry for a few minutes, then add 1 drop of Crystal Mount and a cover slip. Bake for 5 min at 85-90° C.
[0255] Evaluate positive staining of pools and progressively subclone to isolation of single genes responsible for the binding.
[0256] Alternatively, IL-1R reagents are used to affinity purify or sort out cells expressing a putative ligand. See, e.g., Sambrook, et al. or Ausubel, et al.
[0257] Another strategy is to screen for a membrane bound receptor by panning. The receptor cDNA is constructed as described above. The ligand can be immobilized and used to immobilize expressing cells. Immobilization may be achieved by use of appropriate antibodies which recognize, e.g., a FLAG sequence of an IL-1R fusion construct, or by use of antibodies raised against the first antibodies. Recursive cycles of selection and amplification lead to enrichment of appropriate clones and eventual isolation of receptor expressing clones.
[0258] Phage expression libraries can be screened by mammalian IL-1Rs. Appropriate label techniques, e.g., anti-FLAG antibodies, will allow specific labeling of appropriate clones.
[0259] All citations herein are incorporated herein by reference to the same extent as if each individual publication or patent application was specifically and individually indicated to be incorporated by reference.
[0260] Many modifications and variations of this invention can be made without departing from its spirit and scope, as will be apparent to those skilled in the art. The specific embodiments described herein are offered by way of example only, and the invention is to be limited by the terms of the appended claims, along with the full scope of equivalents to which such claims are entitled; and the invention is not to be limited by the specific embodiments that have been presented herein by way of example.
Claims
1. An isolated or recombinant IL-1RD9 polypeptide:
- a) consisting of SEQ ID NO: 6, 8, 10, 12, 14, or 16;
- b) encoded by a polynucleotide comprising the open reading frame of SEQ ID NO: 5, 7, 9, 11, 13, or 15; or
- c) encoded by a naturally occurring allelic variant of a polynucleotide comprising the open reading frame of SEQ ID NO: 5, 7, 9, 11, 13, or 15.
2. The polypeptide of claim 1, encoded by a naturally occurring allelic variant of a polynucleotide comprising the open reading frame of SEQ ID NO: 5, 7, 9, 11, 13, or 15.
3. An isolated or recombinant IL-1RD9 polypeptide which:
- a) has an apparent molecular weight of approximately 68.3 kD as determined by calculation from sequence and an estimated pI of approximately 9.04; and
- b) is found on T cells;
- wherein said polypeptide has at least one of the following properties:
- i) is a heterodimer;
- iii) is an IL-1 receptor &agr; subunit type, or
- iii) when brought into contact with IL-1RD5 and IL-1&agr;, for a sufficient time, forms a functional high affinity receptor complex that activates an NF&kgr;B transcription factor reporter construct.
4. An isolated or recombinant polypeptide comprising a segment of contiguous amino acid residues selected from the following group:
- a) 15 contiguous amino acid residues of said polypeptide of claim 2;
- b) 20 contiguous amino acid residues of said polypeptide of claim 2;
- c) 25 contiguous amino acid residues of said polypeptide of claim 2;
- d) 30 contiguous amino acid residues of said polypeptide of claim 2;
- e) 35 contiguous amino acid residues of said polypeptide of claim 2; or
- f) 40 contiguous amino acid residues of said polypeptide of claim 2.
5. The polypeptide of claim 1 which is immunogenic.
6. An isolated or recombinant polypeptide comprising an immunogenic peptide of said polypeptide of claim 3.
7. An isolated or recombinant polypeptide comprising an immunogenic polypeptide of claim 4.
8. A fusion protein comprising said polypeptide of claim 4 and:
- a) a detection or purification tag selected from the group consisting of a FLAG, His6, and immunoglobulin peptide;
- b) a carrier protein selected from the group consisting of keyhole limpet hemocyanin, bovine serum albumin, and tetanus toxoid; or
- c) another peptide selected from the group consisting of luciferase, bacterial &bgr;-galactosidase, trpE, protein A, &bgr;-lactamase, alpha amylase, alcohol dehydrogenase, and yeast alpha mating factor.
9. A fusion protein comprising said polypeptide of claim 5 and:
- a) a detection or purification tag selected from the group consisting of a FLAG, His6, and immunoglobulin peptide;
- b) a carrier protein selected from the group consisting of keyhole limpet hemocyanin, bovine serum albumin, the tetanus toxoid; or
- c) another peptide selected from the group consisting of luciferase, bacterial &bgr;-galactosidase, trpE, protein A, &bgr;-lactamase, alpha amylase, alcohol dehydrogenase, and yeast alpha mating factor.
10. A composition comprising said polypeptide of claim 1, that is:
- a) in a pharmaceutically acceptable carrier;
- b) in a sterile composition;
- c) in a buffered solution;
- d) in an aqueous suspension; or
- e) in combination with IL-1RD5 and/or IL-1&agr;.
11. A composition comprising said polypeptide of claim 4, that is:
- a) in a pharmaceutically acceptable carrier;
- b) in a sterile composition;
- c) in a buffered solution; or
- d) in an aqueous suspension.
12. A polypeptide of claim 4, that is:
- a) denatured;
- b) immunopurified;
- c) attached to a solid substrate;
- d) detectably labeled; or
- e) chemically synthesized.
13. A polypeptide of claim 5, that is:
- a) denatured;
- b) immunopurified;
- c) attached to a solid substrate;
- d) detectably labeled; or
- e) chemically synthesized.
14. A kit comprising said polypeptide of claim 1, and:
- a) a compartment comprising said protein; or
- b) instructions for use or disposal of reagents in said kit.
15. A kit comprising said polypeptide of claim 4, and:
- a) a compartment comprising said protein; or
- b) instructions for use or disposal of reagents in said kit.
16. A method of raising an antibody, comprising immunizing an animal with a polypeptide of claim 5.
17. A method of producing an antibody:antigen complex, comprising contacting a polypeptide of claim 5 with an antibody which specifically binds said polypeptide, thereby forming said complex.
18. A composition of matter selected from the group consisting of:
- a) a substantially pure or recombinant IL-1RD8 polypeptide exhibiting identity over a length of at least about 12 amino acids to SEQ ID NO: 4;
- b) a natural sequence IL-1RD8 comprising SEQ ID NO: 4;
- c) a fusion polypeptide comprising IL-1RD8 sequence;
- d) a substantially pure or recombinant IL-1RD10 polypeptide exhibiting identity over a length of at least about 12 amino acids to SEQ ID NO: 35;
- e) a natural sequence IL-1RD10 comprising SEQ ID NO: 35; and
- f) a fusion protein comprising IL-1RD10 sequence.
19. A substantially pure or isolated polypeptide comprising a segment exhibiting sequence identity to a corresponding portion of an:
- a) IL-1RD8 of claim 18, wherein:
- i) said polypeptide further exhibits identity to a distinct segment of 9 amino acids;
- ii) said length of identity is at least 17 amino acids;
- iii) said length of identity is at least about 25 amino acids; or
- b) IL-1RD10 of claim 18, wherein:
- i) said polypeptide further exhibits identity to a distinct segment of 9 amino acids;
- ii) said length of identity is at least 17 amino acids;
- iii) said length of identity is at least about 25 amino acids.
20. The composition of matter of claim 18, wherein said:
- a) IL-1RD8 comprises a mature sequence of Table 1;
- b) IL-1RD10 comprises a mature sequence of Table 3; or
- c) polypeptide:
- i) is from a warm blooded animal selected from a primate, such as a human;
- ii) comprises at least one polypeptide segment of SEQ ID NO: 4 or 35;
- iii) exhibits a plurality of portions exhibiting said identity;
- iv) is a natural allelic variant of a primate or rodent IL-1RD8 or primate IL-1RD10;
- v) has a length at least about 30 amino acids;
- vi) exhibits at least two non-overlapping epitopes which are specific for a primate or rodent IL-1RD8 or primate IL-1RD10;
- vii) exhibits sequence identity over a length of at least about 20 amino acids to a primate IL-1RD8 or IL-1RD10;
- viii) has a molecular weight of at least 100 kD with natural glycosylation;
- ix) is a synthetic polypeptide;
- x) is attached to a solid substrate;
- xi) is conjugated to another chemical moiety;
- xii) is a 5-fold or less substitution from natural sequence; or
- xiii) is a deletion or insertion variant from a natural sequence.
21. A composition comprising:
- a) a sterile IL-1RD8 polypeptide of claim 18;
- b) said IL-1RD8 polypeptide of claim 18 and a carrier, wherein said carrier is:
- i) an aqueous compound, including water, saline, and/or buffer; and/or
- ii) formulated for oral, rectal, nasal, topical, or parenteral administration;
- c) a sterile IL-1RD10 polypeptide of claim 18; or
- d) said IL-1RD10 polypeptide of claim 18 and a carrier, wherein said carrier is:
- i) an aqueous compound, including water, saline, and/or buffer; and/or
- ii) formulated for oral, rectal, nasal, topical, or parenteral administration.
22. A fusion protein of claim 18, comprising:
- a) mature protein sequence of Table 1 or 3;
- b) a detection or purification tag, including a FLAG, His6, or Ig sequence; or
- c) sequence of another receptor protein.
23. A kit comprising a polypeptide of claim 18, and:
- a) a compartment comprising said polypeptide; and/or
- b) instructions for use or disposal of reagents in said kit.
24. A binding compound comprising an antigen binding site from an antibody, which specifically binds to a natural:
- A) IL-1RD8 polypeptide of claim 18, wherein:
- a) said polypeptide is a primate or rodent protein;
- b) said binding compound is an Fv, Fab, or Fab2 fragment;
- c) said binding compound is conjugated to another chemical moiety; or
- d) said antibody:
- i) is raised against a polypeptide sequence of a mature polypeptide of Table 1;
- ii) is raised against a mature primate or rodent IL-1RD8;
- iii) is raised to a purified human IL-1RD8;
- iv) is raised to a purified mouse IL-1RD8;
- v) is immunoselected;
- vi) is a polyclonal antibody;
- vii) binds to a denatured IL-1RD8;
- viii) exhibits a Kd to antigen of at least 30 &mgr;M;
- ix) is attached to a solid substrate, including a bead or plastic membrane;
- x) is in a sterile composition; or
- xi) is detectably labeled, including a radioactive or fluorescent label; or
- B) IL-1RD10 polypeptide of claim 18, wherein:
- a) said polypeptide is a primate polypeptide;
- b) said binding compound is an Fv, Fab, or Fab2 fragment;
- c) said binding compound is conjugated to another chemical moiety;
- d) said polypeptide is associated with an IL-1 receptor alpha type subunit; or
- e) said antibody:
- i) is raised against a peptide sequence of a mature polypeptide of Table 3;
- ii) is raised against a mature primate IL-1RD10;
- iii) is raised to a purified human IL-1RD10;
- iv) is immunoselected;
- v) is a polyclonal antibody;
- vi) binds to a denatured IL-1RD10;
- vii) exhibits a Kd to antigen of at least 30 &mgr;M;
- viii) is attached to a solid substrate, including a bead or plastic membrane;
- ix) is in a sterile composition; or
- x) is detectably labeled, including a radioactive or fluorescent label
25. A kit comprising said binding compound of claim 24, and:
- a) a compartment comprising said binding compound; and/or
- b) instructions for use or disposal of reagents in said kit.
26. A method of:
- A) making an antibody of claim 23, comprising immunizing an immune system with an immunogenic amount of:
- a) a primate IL-1RD8 polypeptide; or
- b) a primate IL-1RD10 polypeptide;
- thereby causing said antibody to be produced; or
- B) producing an antigen:antibody complex, comprising contacting:
- a) a primate IL-1RD8 polypeptide with an antibody of claim 23A; or
- b) a primate IL-1RD10 polypeptide with an antibody of claim 23B;
- thereby allowing said complex to form.
27. A composition comprising:
- a) a sterile binding compound of claim 23, or
- b) said binding compound of claim 23 and a carrier, wherein said carrier is:
- i) an aqueous compound, including water, saline, and/or buffer; and/or
- ii) formulated for oral, rectal, nasal, topical, or parenteral administration.
28. An isolated or recombinant nucleic acid encoding a protein or peptide or fusion protein of claim 18, wherein:
- a) said IL-1RD8 or IL-1RD10 is from a mammal; or
- b) said nucleic acid:
- i) encodes an antigenic polypeptide sequence of Table 1 or 3;
- ii) encodes a plurality of antigenic polypeptide sequences of Table 1 or 3;
- iii) exhibits identity to a natural cDNA encoding said segment;
- iv) is an expression vector;
- v) further comprises an origin of replication;
- vi) is from a natural source;
- vii) comprises a detectable label;
- viii) comprises synthetic nucleotide sequence;
- ix) is less than 6 kb, preferably less than 3 kb;
- x) is from a mammal, including a primate, such as a human;
- xi) comprises a natural full length coding sequence;
- xii) is a hybridization probe for a gene encoding said IL-1RD8 or IL-1RD10;
- xiii) comprises a plurality of nonoverlapping segments of at least 15 nucleotides from Table 1 or 3; or
- xiv) is a PCR primer, PCR product, or mutagenesis primer.
29. A cell transfected or transformed with a recombinant nucleic acid of claim 28.
30. The cell of claim 29, wherein said cell is:
- a) a prokaryotic cell;
- b) a eukaryotic cell;
- c) a bacterial cell;
- d) a yeast cell;
- e) an insect cell;
- f) a mammalian cell;
- g) a mouse cell;
- h) a primate cell; or
- i) a human cell.
31. A kit comprising said nucleic acid of claim 28, and:
- a) a compartment comprising said nucleic acid;
- b) a compartment further comprising a primate or rodent IL-1RD8 or primate IL-1RD10 polypeptide; and/or
- c) instructions for use or disposal of reagents in said kit.
32. A method of:
- A) making a polypeptide, comprising expressing said nucleic acid of claim 28, thereby producing said polypeptide; or
- B) making a duplex nucleic acid, comprising contacting said nucleic acid of claim 28 with a hybridizing nucleic acid, thereby allowing said duplex to form.
33. A nucleic acid which:
- a) hybridizes under wash conditions of 40° C. and less than 2M salt to SEQ ID NO: 3, 19, or 34; or
- b) exhibits identity over a stretch of at least about 30 nucleotides to a primate IL-1RD8 or IL-1RD10.
34. The nucleic acid of claim 33, wherein:
- a) said wash conditions are at 55° C. and/or 500 mM salt; or
- b) said stretch is at least 55 nucleotides.
35. The nucleic acid of claim 34, wherein:
- a) said wash conditions are at 65° C. and/or 150 mM salt; or
- b) said stretch is at least 75 nucleotides.
36. A method of modulating physiology or development of a cell or tissue culture cells comprising contacting said cell with an agonist or antagonist of a primate IL-1RD8 or IL-1RD10.
37. The method of claim 36, wherein said cell is transformed with a nucleic acid encoding either an IL-1RD8 or IL-1RD10, and another IL-1R.
Type: Application
Filed: Oct 22, 2001
Publication Date: Mar 20, 2003
Inventors: Jacqueline C. Timans (Mountain View, CA), Johannes Eduard Maria Antonius Debets (Mountain View, CA), Theodore R. Sana (East Palo Alto, CA), J. Fernando Bazan (Menlo Park, CA), Robert A. Kastelein (Redwood City, CA)
Application Number: 10011548
International Classification: C07K014/715; C07H021/04; C12P021/02; C12N005/06;