Synthetic or natural peptides binding protein phosphatase 2A, identification method and uses
The present invention relates to novel synthetic or natural peptides for use in treating viral or parasitic infections or in the treatment of tumors. The peptides of the present invention are less than 30 amino acids in size, preferably less than 20 amino acids, in particular 15 to 20 amino acids, and in vitro the peptides specifically bind a type 2A protein phosphatase holoenzyme or one of its subunits. The invention also relates to a method for identifying said peptides, and to their uses.
Latest INSTITUT PASTEUR Patents:
- Method for detecting spatial coupling
- Live imaging system to visualize the retro-transcribed viral DNA genome
- Interleukin-2 variants with modified biological activity
- Imidazopyrazine derivatives, process for preparation thereof, and their uses as luciferins
- Malaria pre-erythrocytic antigens as a fusion polypeptide and their use in the elicitation of a protective immune response in a host
The invention relates to novel synthetic or natural peptides, in particular for use in treating viral or parasitic infections or in the treatment of tumors, said peptides being less than 30 amino acids in size, preferably less than 20 amino acids, in particular 15 to 20 amino acids, and characterized in that in vitro, they specifically bind a type 2A protein phosphatase holoenzyme or one of its subunits. The invention also relates to a method for identifying said peptides, and to their uses.
Given the role of the peptides of the invention in modulating the activity of cellular protein phosphatase 2A, it is important in the introduction to recall the current knowledge regarding protein phosphatase 2As, their physiological role and their interactions with certain cellular, viral or parasitic proteins.
Cell physiology is partially controlled by modulating protein phosphorylation. The phosphorylation state of cell proteins depends on the antagonist action of protein kinases which phosphorylates them and protein phosphatases which dephosphorylate them.
Protein phosphatases are divided into two principal groups: tyrosine phosphatases and serine/threonine phosphatases. Serine/threonine phosphatases are classified into two categories which depend on the specificicity of their substrate and their sensitivity to certain inhibitors, namely type 1 phosphatases (PP1) and type 2 phosphatases (PP2). Type 2 phosphatases are themselves divided into different classes, including phosphatase 2A (PP2A), phosphatase 2B or calcineurine the activity of which is regulated by calcium, and phosphatase 2C (PP2C) the activity of which is regulated by magnesium.
It is now known that type 2A phosphatases are highly conserved during evolution and are potentially involved in regulating many biological processes. PP2A enzymes have been clearly involved in regulating transcription, control of the cell cycle or viral transformation. Further, PP2As are targeted by different viral or parasitic proteins, suggesting a role for PP2As in, host-pathogen interactions.
PP2As are oligomeric complexes (holoenzymes) each comprising a catalytic subunit (C) and one or two regulating subunits (A) and (B). The structure of subunit (A) consists of 15 imperfect repeats of a conserved amino acid sequence of 38 to 40 amino acids, certain of which interact with subunits (B) and (C). Subunits (A) and (C), conserved during evolution, constitute the base structure of the enzyme and are expressed constitutively. In contrast, subunits (B) constitute a family of regulating proteins not connected via a common structure and expressed differentially (Cohen P. The structure and regulation of protein phosphatases. Annu Rev Biochem 1989; 58: 453-508). Protein phosphatase 2As exist in vivo in two classes with different forms: a dimeric form (AC) and a trimeric form (ABC). Subunits (B) regulate phosphatase activity and specificity towards the substrate. The existence of multiple forms of PP2A is correlated with the distinct and varied functions of PP2A in vivo.
Recently, different proteins synthesized by pathogens, in particular viral and parasitic proteins, have been implicated in modulating certain specific activities of protein phosphatase 2A.
Different strategies involving PP2A have been adopted by viruses to facilitate their replication and survival in a host cell. As an example, parainfluenza virus incorporates the protein PKCζ, a protein of cellular origin under the control of PP2A, into its viral particle. This can perturb the phosphoylation of host proteins and facilitate its own replication (De B P, Gupta S, Barnejee A K. Cellular protein kinase C ζ regulates human parainfluenza virus type 3 replication. Proc. Natl Acad Sci USA 1995; 92: 5204-8).
Several DNA viruses with transforming power, such as papovae or adenoviruses, as well as certain retroviruses such as the type-1 human immunodeficiency virus (HIV-1), code for proteins which interact directly with certain host PP2As. All of those viruses comprise proteins which, although structurally different, interact with certain holoenzymes and modify phosphatase activity.
In particular, it has been shown that the E4orf4 protein of adenoviruses binds to a heterotrimeric PP2A and more precisely to a regulating subunit (B), which causes a reduction in the transcription of JunB in the infected cell. That effect could play an important role during viral infection by regulating the apoptotic response of infected cells. Interestingly, it has also been shown that the interaction of E4orf4 with PP2A induces apoptosis in transformed cells in a p53-independent manner (Shtrichman R et al, Adenovirus type 5 E4 open reading frame 4 protein induces apoptosis in transformed cells. J Virol 1998; 72: 2975-82).
Tumor-generating viruses of the Papovae family, including SV40 and polyoma virus, induce cell transformation. It has been shown that PP2A interacts with the “small T” antigen of SV40 or polyoma and with the transforming “middle T” protein of polyoma. Those interactions of viral proteins with PP2A have been clearly involved in viral transformation. Finally, transcriptional regulation, a process normally carried out in the cell by different factors specifically fixing to promoter regulating sequences, probably represents the most important mechanism involved in the control of viral expression by PP2A. It has been demonstrated that PP2A is a negative regulator for numerous transcription factors involved in particular in the processes of cell growth and proliferation, including AP1/SRE, NF-κB, Sp1 and CREB (Waszinski, B E, Wheat W H, Jaspers S, Peruski L F, J R Lickteig R L, Johnson G L, and Klemm D J, Nuclear protein phosphatase 2A dephosphorylates protein kinase A-phosphorylated CREB and regulates CREB transcriptional stimulation. Mol Cell Biol 1993 13, 2822-34). Viral regulation of those transcription factors would permit modulation of viral transcription.
The viral protein of HIV-1, Vpr, interacts in vitro with PP2A and stimulates the catalytic activity of PP2A (Tung L et al, Direct activation of protein phosphatase 2A0 by HIV-1 encoded protein complex Ncp7: vpr. FEBS Lett 1997; 401: 197-201). Vpr can induce the G2 stoppage of infected cells by inhibiting the activation of the p34cdc2-cycline B complex. Further, Vpr interacts with the transcription factor Sp1 and is a weak trans-activator for transcription of Sp1 dependent HIV-1. Thus, the Vpr protein of HIV-1, which is incorporated into the virion, should be involved in vivo in the initiation of viral transcription, a step that is clearly essential for regulating the expression of the Tat transcription factor (a major regulator of transcription encoded by the HIV-1 virus).
In contrast to the well established role of protein kinases in parasitic infections, it is only during the past three years that serine/threonine phosphatases have begun to be recognized as being important potential regulators in the field of parasitology.
Initially, two serine/threonine phosphatases, Ppβ and PfPP, were identified in Plasmodium falciparum. The presence of type 1 and type 2A phosphatase activity in the parasite has been demonstrated by enzymological studies. Finally, parasitic enzymes PP2A and PP2B were purified.
Serine/threonine phosphatases have recently been studied in Theileria parva, another protozoan close to P. falciparum, a cattle parasite. Monocyte and leukocyte host cells infected by the parasite are transformed, resulting in leukemia in the animal. Purified parasites of cells infected with Theileria express a protein kinase CK2α. Now, the subunit CK2α should interact with PP2A to positively modulate its activity (Hériché H, et al, Regulation of protein phosphatase 2A by direct interaction with casein kinase 2α. Science 1997; 276-952-5). Further, modulation of PP2A via expression of the CK2α subunit could be the basis of blockage of two signal routes in the parasitised cell, that of MAP-kinases (Chaussepied M et al. Theileria transformation of bovine leukocytes: a parasite model for the study of lymphoproliferation. Res Immunol 1996; 147: 127-38) and that of protein kinase B (Akt) (M Baumgartner, M Chaussepied, M F Moreau, A Garcia, G Langsley. Constitutive PI3-K activity is essential for proliferation, but not survival, of Theileria parva—transformed B cells. Cellular Microbiol (2000) 2, 329-339).
The absence of common motifs to the series of proteins interacting with PP2A prevents the informatical identification of peptide motifs directly involved in binding those proteins with PP2A.
Given the major role of protein phosphatase 2As in virus-host interactions or parasite-host interactions as summarized above, the importance of identifying the binding sites of viral or parasitic proteins with PP2A holoenzymes or one of their subunits can be understood, so that novel therapeutic targets for those viral or parasitic pathogens can be identified.
In particular, the identification of peptides interacting with PP2A should allow novel drugs to be developed that can block, by competitive inhibition, the cell mechanisms induced by viral or parasitic proteins via their interaction with PP2A and in particular mechanisms of infection, pathogen proliferation and cell transformation.
The invention pertains to means for identifying peptides of reduced size, binding a PP2A holoenzyme or one of its subunits. In contrast to native proteins or polypeptide domains of large size, reduced size peptides have the advantage of being readily synthesized, either chemically or in cell systems, in high yields and cheaply. The peptides of the invention are also more stable and more readily transferred into the cytoplasm or into the nucleus of cells using appropriate vectors, with a view to therapeutic use.
The invention derives from the demonstration that it is possible to identify peptides with a size of less than 30 amino acids, and in particular peptides less than 20 amino acids in size, interacting with a PP2A holoenzyme or one of its subunits.
In particular, the inventors have shown that using a “SPOT synthesis” technique as described by Frank and Overwing (Methods in Molecular Biology, 1996, vol 66: 149-169, Epitope Mapping Protocols edited by: G E Morris Humana Press Inc, Totowa N.J.) allows binding sites for proteins interacting with a PP2A holoenzyme or one of its subunits to be identified.
As an example, the inventors have identified peptides less than 20 amino acids in size interacting in vitro with purified PP2A holoenzyme or one of its subunits, said peptides being derived from the Vpr protein of HIV-1 or the CK2α protein of the T parva parasite. Antagonists derived from these peptides and selected because they inhibit the interaction of viral or parasititc proteins with a particular PP2A holoenzyme could then constitute novel anti-tumoural, antiviral or antiparasitic agents.
The invention concerns a method for identifying a peptide the sequence of which is derived from a viral, parasitic or cellular protein, said peptide specifically binding a type, 2A protein phosphatase holoenzyme or one of its subunits, said method comprising the steps consisting of:
-
- a) depositing, in the form of spots onto a support, peptides the sequence of which is derived from a viral, parasitic or cellular protein, each spot corresponding to the deposit of a peptide with a defined sequence;
- b) bringing the solid support into contact with a solution containing the protein phosphatase 2A holoenzyme or on of its subunits under conditions that allow the peptides present on the support to bind the holoenzyme or one of its subunits; and
- c) identifying on the solid support the peptide to which the protein phosphatase 2A or one of its subunits is bound.
In step a), different peptides are deposited on a solid support in defined positions (“spot”), each position corresponding to a specific peptide sequence and the series then forming a two-dimensional array of peptides. Different methods for preparing such arrays have recently been described (for a review, see Figeys and Pinto, 2001, Electrophoresis 22: 208-216; Walter et al, 2000, Curr Opin Microbiol 3: 298-302). The series of these methods generally include covalently fixing the peptides on a support, in particular using chemical linkers. As an example, the skilled person could refer to the “SPOT synthesis” technique consisting of directly synthesizing peptides comprising up to 20 residues on a cellulose membrane (Frank and Overwing, Methods in Molecular Biology, 1996, vol 66: 149-169, Epitope Mapping Protocols, edited by: G E Morris, Humana Press Inc, Totowa N.J.).
In general, any method can be used provided that it can produce an array of peptides deposited on a solid support that can be used to detect specific interactions between the deposited peptides and particular compounds.
Highly preferably, the series of deposited peptide sequences covers the complete sequence of the viral, parasitic or cellular protein from which those sequences are derived. Thus, the process can test, in a single step, the complete sequence of a given protein, this being “sectioned” into a finite number of peptides with generally overlapping sequences.
In a preferred implementation, the peptides deposited in the form of a spot are less than 20 amino acids in size, and more preferably are less than 15 amino acids in size.
In another particular implementation, the peptides are deposited on a cellulose membrane.
The array obtained is brought into contact in step b) with a type 2A protein phosphatase holoenzyme or one of its subunits.
The term “type 2A protein phosphatase holoenzyme” means any purified dimeric (AC) or heterotrimeric (ABC) complex of a cellular or reconstituted extract after purifying two subunits (A) and (C) of a type 2A protein phosphatase and if necessary a subunit (B). The type 2A protein phosphatases are preferably derived from mammals.
The supports are incubated, for example, in a buffer solution comprising purified protein phosphatase or one of its purified subunits. A suitable buffer solution is TBS (TRIS BORATE) containing 5% of skimmed Regilait (milk) and 3% of BSA.
The peptide onto which the type 2A protein phosphatase holoenzyrne is bound is generally identified by direct or indirect labeling of the protein phosphatase and identifying the spots to which the labeled protein has bound. Binding of PP2A or one of its subunits to one of the peptide spots can then be revealed, in particular using antiserums, using techniques that are conventionally used for Western Blot or solid phase ELISA test, after incubating the support containing the peptide array with an antibody directed against subunits (A) or (B) or (C) or a mixture of antibodies directed against subunits (A), (B) or (C) of PP2A.
The method of the invention can be applied to identifying peptides, in particular for use in treating certain viral or parasitic infections, measuring less than 30 amino acids in size or even less than 20 amino acids, said peptides being capable of binding a type 2A protein phosphatase holoenzyme or one of its subunits in vitro.
Further, by using general knowledge in the peptide synthesis field, the skilled person can produce peptides derived from fragments of peptides identified by the method of the invention having the advantageous properties described above.
As a result, the invention provides a natural or synthetic peptide measuring less than 30 amino acids, preferably less than 20 amino acids, characterized in that in vitro, it specifically binds a type 2A protein phosphatase holoenzyme or one of its subunits (A), (B) or (C). The term “specifically binds” means that the peptide is capable of competitively inhibiting binding of a protein of viral or parasitic origin with PP2As.
In a preferred implementation of the invention, the peptide of the invention is characterized in that it is a fragment of a viral, parasitic or cellular protein, said protein binding in vitro a type 2A protein phosphatase or one of its subunits, or a sequence that is distinguished from the preceding protein fragment by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to the type 2A protein phosphatase or one of its subunits. Preferably, the number of amino acids substituted or deleted from the distinct sequence compared with the initial sequence does not exceed 20%, more preferably 10% of the amino acids number constituting the initial sequence. Preferably, only amino acids the deletion of which does not affect the in vitro binding properties of the peptide to PP2A are substituted or deleted.
In particular, one distinct sequence is a peptide sequence increasing the binding affinity to type 2A protein phosphatase or one of its subunits compared with the sequence from which it is derived. A further distinct sequence as defined above is a peptide sequence homologous with an initially identified peptide sequence. The term “homologous peptide” as used in the present invention means a sequence derived from a protein of species other than the initially identified peptide sequence, and for which the primary sequence can be aligned with the peptide sequence initially identified using a conventional optimum alignment program such as the BESTFIT program (Wisconsin Genetics Software Package, Genetics Computer Group, GCG). In particular, a sequence A will be considered to be homologous with a sequence B if said sequences A and B have at least 50% identity, preferably 75% identity after aligning the sequences using an optimum alignment program such as the BESTFIT program. Preferably again, two sequences are also considered to be homologous if the sequences are quasi-identical, with the exception of a few residues that can represent 10% to 20% variability over the whole sequence. Further, amino acids with the same chemical function (such as Arg and Lys) are considered to be equivalent. The peptides to be analyzed for their binding with a PP2A or one of its subunits are generally selected from fragments of viral, parasitic or cellular proteins, which proteins have been shown to interact in vivo or in vitro with a type 2A protein phosphatase.
In particular, such viral parasitic or cellular proteins are selected from one of the following proteins: the t antigen of SV40 or polyoma, the middle t antigen of polyoma, the type B (B, B′, B″) subunit of PP2A, CK2α, CaMIV, p70S6-kinase, Pak1/Pak3, Tap42/alpha 4, PTPA, Set/I1/I2-PP2A, E4orf4, tau, Vpr or CD28, CCXR2 (chemokine receptor).
A preferred peptide of the invention is a fragment of the CD28 protein, and in particular peptides constituted by the sequences PRRPGPTRKHY (SEQ ID No: 132) and (PRRPGPTRK)2 (SEQ ID No: 133), respectively corresponding to the peptides termed FD2 and FD3 the intracellular penetration capacity and effects on cell viability of which are described below in the experimental section. The present invention also pertains to peptide sequences that are distinguished from the preceding protein by substitution or deletion of amino acids, said distinct sequences nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits.
A particularly preferred peptide of the invention is a fragment of the Vpr protein of the HIV virus, in particular a fragment of the Vpr protein of the HIV-1 or HIV-2 virus, or a sequence that is distinguished from the preceding protein fragment by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits. The invention does not encompass the peptide, a fragment of the Vpr protein having the following sequence: LFIHFRIGCQHSRIGITRRRRVRDGSSRP* disclosed in the EMBL database, accession number P89821. In contrast, using said peptide in the context of the applications described below falls within the scope of the present invention.
Special examples of peptides derived from a protein which interacts with type 2A protein phosphatase derived from protamine that can be cited are the peptide with sequence RRRRRRRSRGRRRRTY (SEQ ID No: 140, termed FD8) or a sequence that is distinguished from SEQ ID No: 140 by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits.
Preferably again, a peptide of the invention is characterized in that it is included in one of the following sequences:
-
- a) VEALIRILQQLLFIHFRI (SEQ ID No: 1);
- b) RHSRIGIIQQRRTRNG (SEQ ID No: 2); or
- c) a sequence that is distinguished from SEQ ID No: 1 or SEQ ID No: 2 by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits.
A particularly preferred peptide of the invention is a fragment of the peptide SEQ ID No: 2, said fragment consisting of or comprising the peptide with sequence RHSRIG (SEQ ID No: 135), termed FD9, the capacity for intracellular penetration and the effect on cell viability of which are described below in the experimental section.
The invention also concerns a compound with a polypeptide framework containing a peptide of the invention as defined above, said compound having a molecular weight in the range 10 to 150 Kdaltons and having the capacity to bind protein phosphatase 2A.
The invention also concerns a polypeptide, characterized in that it is constituted by a repeat of a peptide of the invention.
Particular examples of such polypeptides are the peptide RHSRIG polymers, and in particular the dimer (RHSRIG)2 (SEQ ID No: 136) or the trimer (RHSRIG)3 (SEQ ID No: 137), respectively termed FD10 and FD11, the capacity for intracellular penetration and the effect on cell viability of which are described below in the experimental section.
Peptides with sequences that are distinguished from SEQ ID No: 1 or SEQ ID No: 2 by substitution or deletion of amino acids and falling within the scope of the invention that can in particular be cited peptides the sequence of which is included in one of the sequences for the Vpr protein of different variants of type HIV-1, HIV-2 and SIV, corresponding to homologous sequences in variants of SEQ ID No: 1 or SEQ ID No: 2.
The following sequences can be cited: VEALIRILQQLL (SEQ ID No: 6), ALIRILQQLLFI (SEQ ID No: 7), IRILQQLLFIHF (SEQ ID No: 8), ILQQLLFIHFR (SEQ ID No: 9), RHSRIGIIQQRR (SEQ ID No: 10), SRIGIIQQRRTR (SEQ ID No: 11) and IGIIQQRRTRNG (SEQ ID No: 12) corresponding to dodecapeptides identified as binding the subunit A of PP2A.
A particular sequence of the invention that is distinguished from SEQ ID No: 2 by deletion or substitution of amino acids is the sequence RHSRIGVTRQRRARNG (SEQ ID No: 139), also termed FD13 in the experimental section described below.
A preferred peptide of the invention is a peptide selected from sequences SEQ ID No: 1 and SEQ ID No: 2 and is characterized in that its administration induces apoptosis of tumour cells.
One method for selecting peptides that can induce tumour cell apoptosis can be implemented, for example, using the MTT viability test described in the experimental section.
A further preferred implementation of the invention provides a peptide characterized in that it derives from a fragment of the CK2α protein. In particular, the natural or synthetic peptide is characterized in that it derives from a fragment of the CK2α protein of the Theileria parva parasite.
More preferably, a peptide of the invention is characterized in that it is included in one of the following sequences:
-
- a) RKIGRGKFSEVFEG (SEQ ID No: 3);
- b) TVTKDCVIKILKPVKKKKIKREIKILQNL (SEQ ID No: 4);
- c) KILRLIDWGLAEFYHP (SEQ ID No: 5);
- d) a homologous sequence of SEQ ID No: 3, SEQ ID No: 4 or SEQ ID No: 5 derived from P falciparum or Leishmania; or
- e) a sequence deriving from the sequences mentioned above by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to protein phosphatase 2A or one of its subunits, and in particular the sequence TVTKDKCVIKILKPVKKKKIKEIKILQNL (SEQ ID No: 142).
Among peptides that are distinguished from sequences SEQ ID No: 3, 4 or 5 that can be cited are sequences from site 1 (RKIGRGKFSEVFEG) (SEQ ID No: 3), in particular the peptide with the sequence RKIGRGKFSEVF and the peptide with sequence IGRGKFSEVFEG or sequences from site 2 (TVTKDKCVIKILKPVKKKKIKRIKILQNL) (SEQ ID No: 4), in particular the following peptides:
and finally sequences from site 3 KILRLIDWGLAEFTHP (SEQ ID No: 5) or the peptide with sequence KILRLIDWGLAE (SEQ ID No: 23), the peptide with sequence LRLIDWGLAEFY (SEQ ID No: 24), or the peptide with sequence LIDWGLAEFYHP (SEQ ID No: 25).
One example of a peptide of the invention comprising a sequence homologous to T parva from site 3 of the CK2α protein in P falciparum is the peptide RQKRLI (SEQ ID No: 141). The invention also encompasses polymers of the peptide RQKRLI and in particular the trimer (RQKRLI)3 (SEQ ID No: 134), termed FD7 in the experimental section.
Preferably, the invention pertains to a peptide derived from the CK2α protein of the parasite Theileria parva, characterized in that its administration reduces parasitic development.
A further embodiment of the peptides of the invention is characterized in that the peptides are derived from the tau protein. The tau sequence has a motif corresponding to the binding site for the E4orf4 adenovirus protein. In the case of Alzheimer's disease, the tau protein is regulated by protein phosphatase 2A. Such peptides should thus be useful in treating Alzheimer's disease.
The peptides identified by the method of the invention are particularly useful in treating certain tumours and certain viral or parasitic infections. The skilled person can select, using binding competition tests, novel peptides derived from the sequences identified using the method of the invention, said peptides competitively inhibiting binding of the native protein from which it derives with a holoenzyme PP2A or one of its subunits.
Thus, the invention also concerns a natural or synthetic peptide as defined above, characterized in that it competitively inhibits interaction of the native protein from which it derives with a PP2A holoenzyme or one of its subunits.
In order to be effective in vivo in treating certain tumours or certain viral or parasitic infections, the peptides of the invention can be coupled to a vector that is capable of transferring said peptide into a eukaryotic cell. However, it is possible, as will be discussed below, for the peptides of the invention to themselves have the capacity to penetrate into cells, meaning that the addition of a vector is not required.
Naturally, the invention pertains to means that can synthesise the peptides of the invention. In particular, the invention pertains to a polynucleotide characterized in that its sequence consists of the sequence coding for a peptide of the invention. Preferred polynucleotides are polynucleotides the sequence of which is selected from one of the following sequences:
, respectively coding peptides NOs: 1-5.
The invention also concerns polynucleotides with sequences complementary to one of sequences SEQ ID No: 26-30 and sequences hybridizing under stringent conditions to said polynucleotides.
The term “stringent conditions” means conditions that allow specific hybridization of two single strand DNA sequences at about 65° C., for example in a solution of 6×SSC; 0.5% SDS, 5× Denhardt's, solution and 100 μg of non specific carrier DNA or any other solution with an equivalent ionic strength and after washing at 65° C., for example in a solution of at most 0.2×SSC and 0.1% SDS or any other solution with an equivalent ionic strength. The parameters defining the stringency conditions depend on the temperature at which 50% of the paired strands separate (Tm). For sequences comprising more than 30 bases, Tm is defined by the relationship: Tm=81.5+0.41 (% G+C)+16.6 log(concentration of cations)−0.63(% formamide)−(600/number of bases). For sequences less than 30 bases long, Tm is defined by the relationship: Tm=4 (G+C)+2(A+T). The stringency conditions have also been defined using protocols described by Sambrook et al, 2001 (Molecular cloning: a laboratory manual, 3rd edition, Cold Spring Harbor, Laboratory Press, Cold Spring Harbour, N.Y.).
It may be advantageous to synthesize a polypeptide comprising a repeat of the peptide motifs identified by the process of the invention. As a result, the invention pertains to a polynucleotide characterized in that it consists of a multimer of a polynucleotide coding for a peptide of the invention. The invention also pertains to a polypeptide characterized in that it is constituted by a repeat of a peptide of the invention.
The invention also pertains to a cell expression vector, characterized in that it comprises a polynucleotide as defined above and regulatory sequences allowing expression of a peptide of the invention in a host cell.
The invention also pertains to a method for preparing a peptide as defined in the invention, comprising transforming a host cell using a cellular expression vector as defined above, followed by culturing the transformed host cell, and recovering the peptide in the culture medium.
The invention further pertains to an antiserum or immunoserum or a purified polyclonal antibody or a monoclonal antibody, characterized in that said antibody or said antiserum or immunoserum is capable of specifically binding a peptide in accordance with the invention.
Antibodies specifically directed against the peptides identified by the process of the invention are obtained, for example, by immunizing an animal after injecting a peptide of the invention, and recovering the antibodies produced. A monoclonal antibody can be obtained using techniques that are known to the skilled person, such as the hybridoma method describd by Kohler and Milstein (1975).
The antibodies obtained, specifically directed against targets for protein phosphatase 2A, are of particular application in immunotherapy. As an example, they can act as antagonists for viral or parasitic proteins directed against protein phosphatase 2A to block viral or parasitic development.
Similarly, polynucleotides encoding the peptides of the invention can be directly transferred to the nucleus of target cells, if necessary using suitable vectors, to allow in vivo expression of the corresponding peptides, said peptides being susceptible of blocking by competitive inhibition a specific interaction between the protein phosphatase 2A and the viral or parasitic protein from which they derive.
The invention thus pertains to a pharmaceutical composition comprising one of the elements selected from a polynucleotide of the invention or an antibody of the invention.
The invention also concerns a pharmaceutical composition comprising one of the peptides of the invention in combination with a pharmaceutically acceptable vehicle.
The invention further concerns the use of a peptide of the invention as defined above in preparing a drug for use in treating a viral or parasitic infection.
Preferably, the invention concerns the use of a peptide the sequence of which derives from a fragment of the Vpr protein as defined above, in preparing a drug that can inhibit an HIV infection.
The peptides of the invention can advantageously be selected so as to stimulate the induction of apoptosis linked to activation of cellular protein phosphatase 2A. Thus, the invention also concerns the use of a peptide of the invention as defined above in preparing a drug that can induce apoptosis of target cells and in particular tumour cells.
In a further preferred aspect, the invention concerns the use of a peptide the sequence of which derives from a fragment of the CK2α protein in preparing a drug that can inhibit parasitic infection. More particularly, the invention concerns the use of a peptide in preparing a drug for use in treating malaria.
The viral or parasitic infection results in specific expression of proteins comprising sequences of peptides of the invention. The sequences encoding the peptides of the invention can thus be used as a probe to detect, in a specific manner from RNA extracted from a biological sample from a patient, a specific viral infection or parasitic infection.
Similarly, an antibody of the invention can be used to specifically recognize peptide sequences contained in viral or parasitic proteins expressed during infection.
Thus, the invention concerns the use of a polynucleotide of the invention or an antibody of the invention in the in vitro diagnosis of parasitic or viral diseases.
The invention also pertains to the selection and use of a peptide binding protein phosphatase 2A, and capable of penetrating into cells.
An example of such a peptide is illustrated by the peptide FD6 (SEQ ID No: 20) derived from the CK2α protein of T parva. It has been shown in the present invention that the presence of that peptide in the cell does not affect the viability of cultivated or maintained mammal cells alive.
The experimental section below illustrates an application of the method for identifying the peptides of the invention to identifying peptides from the Vpr protein of HIV-1 and of the CK2α protein from the Theileria parva parasite. The invention also pertains to the selection and use of a peptide binding protein phosphatase 2A and possibly capable of penetrating into a cell, said peptide enabling targeting of and contact with intracellular protein phosphatase 2A of a molecule capable of regulating the activity of protein phosphatase 2A.
DESCRIPTION OF FIGURES
Covering the sequence of four peptides 54-57 defines the sequence of site 2
Covering the sequence of three peptides 64 to 66 defines the sequence of site 1
Covering the sequence of two peptides defines the sequence of site 1
Covering the sequence of ten peptides 74-83 defines the sequence of site 2
Covering the sequence of three peptides defines the sequence of site 3
The viability of Hela cells (expressed as a percentage with respect to the initial population) was tested in the presence of increasing concentrations of peptides FD8 (4A), FD13/FD14 (4B) and FD11/FD12 (4C).
EXPERIMENTAL SECTION A. MATERIALS AND METHODSA.1. Purified PP2A Proteins
Trimeric PP2A1 protein was purified to homogeneity from pig brain.
A recombinant structural subunit of PP2A was expressed in E coli and purified using the protocol described by Cohen et al (Cohen P, Alemany S, Hemmings B A, Resink T J, Stralfors P, Tung H Y. Protein phosphatase-1 and protein phosphatase 2A from rabbit skeletal muscle. Methods Enzymol 1988 159, 390-408), or that described by Bosch et al (Bosch M, Cayla X, Van Hoof C, Hemmings B A, Ozon R, Merlevede W, Goris J. the PR55 and PR65 subunits of protein phosphatase 2A from Xenopus laevis. Molecular cloning and developmental regulation of expression. Eur J Biochem 1995, 230, 1037-45).
A.2. Method for Identifying HIV Vpr Binding Sites and Theileria parva (T parva) CK2α Binding Sites with PP2A
Binding peptides derived from CK2α proteins (encoded by T parva protozoa) or Vpr protein (encoded by the HIV-1 virus) with PP2A were identified using the “spot peptides” technique described above (Frank and Overwing, 1996, Meth Mol Biol 66, 149-169).
The method consisted of synthesizing dodecapeptides, in situ on a cellulose membrane, at defined positions wherein the series of the sequence covered the whole sequence of the protein of interest (Vpr or CK2α). The peptides of two consecutive spots on the membrane overlap with an overlapped by two amino acids.
Sixty-eight (68) dodecapeptides covering the whole sequence of the Vpr protein of HIV-1 and two hundred and five (205) dodecapeptides covering the sequence for the CK2α protein of Theileria were synthesized and covalently bound to cellulose membranes.
Each prepared membrane was first saturated for 1 hour at ambient temperature with TBS containing 5% skimmed Régilait (milk) and 3% BSA then incubated overnight in the same buffer in the presence of 4 μg/ml of purified protein (subunit A of PP2A or holoenzyme PP2A1). The specific interaction of each purified protein (respectively the structural subunit A or the trimeric holoenzyme PP2A1) with a peptide sequence was revealed, as in Western blot, after incubating the membrane with an antibody directed against the structural protein A (
The membranes were washed 5 times for 15 minutes with a conventional TBST buffer (TBS+TWEEN) used for incubation then incubated a further 1 hour at ambient temperature with a second antibody (coupled with peroxidase). Finally, the membranes were washed 5 times for 15 minutes with the TBST buffer and revealed.
A.3. Cell Penetration Test
1-Cells
We analyzed the Hela line, which is derived from a human cervical carcinoma.
2-Quantitative Determinations of Internalized Peptides
Lysis Buffer
0.1 M Tris buffer, pH 8 containing 0.5% NP40.
OPD Buffer
25.7 ml of 0.2 M dibasic sodium phosphate+24.3 ml of 0.1 M citric acid+50 ml distilled water; adjust to pH 5.0.
Biotinylated-Avidine Peptide Complexes
4 moles of peptides were incubated with 1 mole of avidine-peroxidase. 20 minutes at ambient temperature.
Analysis of Intracellular Penetration of Various Peptides into Hela Cell
Hela cells (104 in 100 1) were seeded into 96-well plates (flat bases) with complete DMEM medium in the presence of 2.5% penicillin/ampicillin and 10% foetal calf serum. After incubating overnight at 37° C., in a CO2 oven (5%), different dilutions of complexes (biotinylated-avidine peroxidase peptides) were added. After incubating for 4 hours the supernatant was aspirated and the cells were washed 3 times with PBS, trypsinated and taken up for counting in PBS. After counting, the cells were taken up in 300 μl of lysis buffer.
Measurement of Peroxidase Activity
50 μl of OPD buffer was incubated in a 96 well ELISA plate with 50 μl of lysis buffer or 50 μl of cell lysate (in general, different successive dilutions were carried out (to ½)). In order to reveal, 50 μl of OPD solution was added (in the dark). The reaction (about 10 min) was stopped with 100 μl of 1N HCl.
Analysis of Results
The peroxidase activity was determined by reading at 490 nm in the ELISA reader (reference filter at 620 nm) and the quantity of peroxidase in the lysates was calculated from the calibration curve then extrapolated to the same number of cells (103 or 104):
Peptide molecules=(6*1023/MW of peptide)*ng of PO*10−9.
A.4. Cell Viability Test
Hela cells (104 for 100 μl) were seeded into 96-well plates (flat bases) with complete DMEM medium containing 2.5% penicillin/ampicillin and 10% foetal calf serum. After incubating overnight at 37° C. in a CO2 oven (5%), the cells were cultivated in the presence of different peptide concentrations. After incubating for 72 h, the medium containing the peptides was aspirated and the MTT at 0.5 mg/ml (diluted in DMEM alone) was added in an amount of 100 per well. Incubation was carried out in the dark at 37° C. for 30 minutes then the MTT was aspirated off and 50 μl of DMSO was added to all wells. It was necessary to wait ten minutes for complete lysis of the cells and to agitate the lysate wells to homogenize dissolution of the reaction product in the wells. The plates were then read at 570 nm with a 690 nm reference filter.
B. RESULTS AND DISCUSSIONB.1. Identification of Peptide sequences Containing Binding Sites for Proteins Coded by Two Pathogenic Agents (HIV-1 and T parva) with PP2A (PP2A1 and Subunit A)
The results obtained after incubating membranes containing peptides covering the sequences for Vpr of HIV-1 and CK2α of T parva with purified trimeric PP2A holoenzyme allowed five sequences of Vpr and CK2α peptides to be determined that were capable of specifically binding PP2A and are shown in the table below:
More precisely, two peptide sequences containing a binding site for the Vpr of HIV-1 with the protein PP2A1 (
B.2. Importance of Using HIV-1 VPr Peptides Which Bind PP2A
The exogenic expression or expression due to proviral infection of the Vpr of HIV-1 induces apoptosis in Hela cells, T lymphoid lines and primary lymphocytes (Stewart et al, 1997 J Virol 71: 5579-9). The use of Vpr mutants initially allowed this effect to be correlated with stopping cells in phase G2 of the cell cycle. More recently, it has been shown that Vpr can also induce apoptosis independently of stopping at G2 (Nishizawa et al, 2000, Virology 27, 16-26).
It has been reported that activation of PP2A after interaction with the E4orf4 adenoviral protein induces apoptosis in transformed cells (Shtrichman R et al, 2000, Oncogene 19, 3757-3765). Analogously, expression of Vpr also induces apoptosis in transformed cells (Stewart et al, 1999, PNAS, 96, 12039-12043).
Further, an analysis of Vpr mutants known in the art indicates that the peptides identified by the process of the invention and specifically binding the PP2A protein contain sequences which correlate with those required for the pro-apoptotic effect of Vpr.
Thus, fragments of viral proteins, Vpr and E4orf4, which interact with PP2A and are identified by the process of the invention, could be useful in inducing apoptosis of tumor cells.
The identified peptides are also naturally used in inhibiting infection by HIV or other related viruses and retroviruses.
B.3. Importance of Using T parva CK2α Sequences That Bind PP2A
The use of okadaic acid and the small t antigen of SV40 has demonstrated that PP2A controls cell proliferation via a novel cascade of phosphorylations involving PI3-kinase, PKCζ (identified as a MAP-kinase-kinase-kinase or MEKK), the MEK protein and the two MAP kinases ERK-1 and ERk-2, and transcription factors NF-κB and Sp1 (Sontag E, Sontag J M, Garcia A (1997), EMBO J, 16, 5662-5671; Ayllon V, Martinez A, C, Garcia A, Cayla X and Rebollo A (2000), EMBO J 19, 1-10, A Garcia, S Cereghini, E Sontag (2000), J Biol Chem 275, 9385-9389). Further, the role of PP2A in regulating the cascade of MAP kinases has also been suggested by studies by Chambaz's team (Hériché et al, (1997), Science, 276, 952-955) which have shown that overexpression of the cellular CK2α subunit activates PP2A which dephosphorylates the MEK protein.
Studies by Ole-Moi et al (Embo J, 1993, 12, 1621-1631) have shown that transformation by Theileria induces hyperphosphorylation of host proteins. This effect is partially due to constitutive activation of cellular CK2 which should itself depend on the action of a CK2α type subunit coded by the parasite and secreted into the cytosol of the transformed cell.
As indicated below, a comparison of the sequences identified by the process of the invention corresponding to the three binding sites with PP2A allows the presence of a motif of the type: K-I-G/L-R/K, which is partially repeated in site 2, to be identified.
It is interesting to note that the binding site for the ATP of CK2α partially covers site 1 and site 2, which suggests inhibition of kinase activity after interaction of CK2α with the subunit A. Further, as will be seen from Table 2 below, the three sequences containing the binding sites for CK2α of T parva with PP2A are conserved among a number of species including P. Falciparum and Leishmania parasites.
A careful analysis of the interactions suggests that the CK2α from these different species should interact with PP2A; as an example peptide 131 from T parva CK2α described in
The presence inside the cell of these peptides, corresponding to the in vivo binding sites of proteins with PP2A, could thus interfere with the development of those parasites.
B. 4. Biological Effects of Peptide Compounds of the Invention on Cells
The various peptides listed in Table 3 were synthesized in the biotinylated form, purified by HPLC (Neosystem) and their effect on intracellular penetration and cell viability was analyzed in Hela cells. A study of the series of peptides shown in Table 1 has allowed six peptides to be determined which have the possibility of penetrating into the Hela cell (
-
- FD6: a 12AA peptide derived from a site for interaction of the A subunit of PP2A with the T parva CK2α protein;
- FD7: a 18AA peptide corresponding to three repeats of a 6AA hexa motif; this sequence, derived from P falciparum CK2α, is homologous with the T parva sequence that binds PP2A;
- FD8: a peptide derived from protamine (a known PP2A activator);
- FD11: a 18AA peptide corresponding to three repeats of a 6AA hexa motif derived from the sequence for FD14;
- FD14: FD14, which reproduces the binding site which we have characterized from HIV-1 Vpr with PP2A;
- FD13: This peptide corresponds to a HIV-1 Vpr sequence which is homologous with the FD14 peptide sequence, which represents a binding site with PP2A with another HIV-1 Vpr.
Further, viability studies carried out on the series of peptides shown in Table 1 allowed three peptides to be identified which inhibit the viability of Hela cells:
-
- FD8: affects the viability of Hela cells (
FIG. 4A ); - FD14: clearly affects the viability of Hela cells (
FIG. 4B );
- FD8: affects the viability of Hela cells (
FD12: a 18AA peptide the sequence of which derives from that of the FD11 peptide (R is mutated into A). This peptide, which is homologous with the glucosamine transferase protein of Chlamydia muridarum, affects the viability of the Hela cell (
Are peptides from certain proteins which interact with PP2As a novel anti-tumoral approach?
Our study has allowed to identify two penetrating peptides (FD8/FD14) derived from two proteins, Vpr and protamine, known to interact with PP2As. These peptides, which have in common sequences rich in arginine and lysine, could thus penetrate into the cell using a general internalization mechanism. Such a mechanism, which is common in internalizing peptides having arginine-rich sequences, has recently been proposed (Tomoki Suzuki et al, 2002, Possible existence of common interlization mechanisms among arginine-rich peptides, JBC 277, 2437-2443). In general, the presence of sequences that are rich in arginine or lysine characterize proteins binding PP2As, which suggests that other penetrating peptides could be identified in the PP2A family.
Vpr, a protein coded by the HIV-1 virus, is involved in maintaining a high viral charge and in establishing pathogenesis linked to HIV. The expression of Vpr, exogenic or due to proviral HIV-1 infection, induces apoptosis in Hela cells, in T lymphoid lines, in primary lymphocytes and in transformed cells (Stewart et al, J Virol 1997, 71, 5579-9; Stewart et al 1999, PNAS, 96, 12039-12043). Further, it has been reported that the interaction of PP2A with a further viral protein, adenovirus E4orf4 (Marcellus et al, J Virol 2000, 74, 7869-7877) can induce apoptosis in tumor cells. In total, these results suggest the hypothesis that activation of certain PP2As would be a novel means of inducing tumor apoptosis. In this regard, our results shown in
Claims
1. A peptide less than 30 amino acids in size, preferably less than 20 amino acids, characterized in that in vitro, it specifically binds a type 2A protein phosphatase holoenzyme or one of its subunits.
2. A peptide according to claim 1, characterized in that it is a fragment of a viral, parasitic or cellular protein, said protein binding a type 2A protein phosphatase in vitro, or a sequence that is distinguished from the preceding protein fragment by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to the type 2A protein phosphatase or one of its subunits.
3. A peptide according to claim 2, characterized in that said viral, parasitic or cellular protein is selected from one of the following proteins: the t antigen of SV40 or polyoma, the middle t antigen of polyoma, the type B (B, B′, B″) subunit of PP2A, CXCR2 (chemokine receptor), CK2α, CaMIV, p70S6-kinase, Pak1/Pak3, Tap42/alpha 4, PTPA, Set/I1/I2-PP2A, E4orf4, tau, CD28 or Vpr.
4. A peptide according to claim 3, characterized in that it is a fragment of the CD28 protein selected from one of the following peptide sequences:
- a) PRRPGPTRKHY (SEQ ID No: 132); or
- b) a sequence distinguished from the sequence envisaged in a) by substitution or deletion of amino acids, said sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits.
5. A peptide according to claim 3, characterized in that said viral, parasitic or cellular protein is the Vpr protein of the HIV virus.
6. A peptide according to claim 5, characterized in that said Vpr protein is derived from the HIV-1 or HIV-2 virus.
7. A peptide according to claim 6, characterized in that it is selected from one of the following peptide sequences:
- a) RRRRRRRSRGRRRRTY (SEQ ID No: 140); or
- b) a sequence distinguished from the sequence envisaged in a) by substitution or deletion of amino acids, said sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits.
8. A peptide according to claim 6, characterized in that it is included in one of the following sequences:
- a) VEALIRILQQLLFIHFRI (SEQ ID No: 1);
- b) RHSRIGIIQQRRTRNG (SEQ ID No: 2); or
- a sequence that is distinguished from SEQ ID No: 1 or SEQ ID No: 2 by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits.
9. A peptide according to claim 8, characterized in that it is the sequence RHSRIGVTRQRRARNG (SEQ ID No: 139).
10. A peptide according to claim 8, characterized in that it consists of the sequence RHSRIG (SEQ ID No: 135).
11. A peptide according to any one of claims 1 to 10, characterized in that its administration induces apoptosis of tumor cells.
12. A peptide according to claim 3, characterized in that said viral, parasitic or cellular protein is the CK2α protein.
13. A peptide according to claim 12, characterized in that said CK2α protein is derived from the Theileria parva parasite.
14. A peptide according to claim 12 or claim 13, characterized in that its administration reduces parasitic development.
15. A peptide according to any one of claims 12 to 14, characterized in that it is included in one of the following sequences:
- a) RKIGRGKFSEVFEG (SEQ ID No: 3);
- b) TVTKDCVIKILKFPVKKKKIKREIKILQNL (SEQ ID No: 4);
- c) KILRLIDWGLAEFYHP (SEQ ID No: 5); or
- d) a homologous sequence of SEQ ID No: 3, SEQ ID No: 4 or SEQ ID No: 5 derived from P falciparum or leishmania; or
- a sequence deriving from the sequences mentioned above by substitution or deletion of amino acids, said distinct sequence nevertheless conserving the properties of binding to type 2A protein phosphatase or one of its subunits, and in particular the sequence TVTKDKCVIKILKPVKKKKIIKILQNL.
16. A peptide according to claim 15, characterized in that it is the peptide RQKRLI (SEQ ID No: 141).
17. A peptide according to one of claims 1 to 16, characterized in that it competitively inhibits interaction of the native protein from which it is derived with a PP2A holoenzyme or one of its subunits.
18. A peptide according one of claims 1 to 17, characterized in that it is coupled to a vector that is capable of transferring said peptide to a eukaryotic cell.
19. A polypeptide, characterized in that it is constituted by a repeat of a peptide according to any one of claims 1 to 13.
20. A polypeptide according to claim 19, characterized in that it is selected from one of the following sequences:
- a) (RHSRIG)2 (SEQ ID No: 136);
- b) (RHSRIG)3 (SEQ ID No: 137); or
- c) (RQKRLI)3 (SEQ ID No: 134).
21. A polynucleotide characterized in that its sequence consists of the sequence encoding a peptide according to any one of claims 1 to 20.
22. A polynucleotide, characterized in that its sequence is selected from one of the following sequences: SEQ ID No: 26, 27, 28, 29 or 30.
23. A polynucleotide, characterized in that it consists of a multimer of polynucleotide according to claim 21 or claim 22.
24. A cellular expression vector, characterized in that it comprises a polynucleotide according to one of claims 21 to 23 and regulatory sequences allowing expression of a peptide according to any one of claims 1 to 20 in a host cell.
25. A purified polyclonal or monoclonal antibody, characterized in that it is capable of specifically binding anyone of the peptides according to one of claims 1 to 20.
26. A pharmaceutical composition comprising a peptide according to one of claims 1 to 20, in combination with a pharmaceutically acceptable vehicle.
27. A pharmaceutical composition comprising an element selected from a polypeptide according to one of claims 21 to 23, an expression vector according to claim 24 or an antibody according to claim 25.
28. A peptide, characterized in that it is selected from one of the following sequences:
- SEQ ID No: 137;
- SEQ ID No: 139;
- SEQ ID No: 140.
29. A peptide, characterized in that it has sequence SEQ ID No: 20.
30. Use of a peptide or polypeptide as defined in any one of claims 1 to 20, 28 or 29, in preparing a drug for treating a viral or parasitic infection.
31. Use of a peptide or polypeptide as defined in any one of claims 5 to 10, 28 or 29, in preparing a drug that can inhibit infection by HIV.
32. Use of a peptide as defined in one of claims 5 to 20 or 28, in preparing a drug that may induce apoptosis of target cells, and in particular tumor cells.
33. Use of a peptide as defined in any one of claims 12 to 16, in preparing a drug that can inhibit parasitic infection.
34. Use of a peptide as defined in any one of claims 12 to 16, in preparing a drug for use in treating malaria.
35. Use of a polynucleotide according to one of claims 21 to 23 or an antibody according to claim 25, in the in vitro diagnosis of parasitic or viral diseases.
36. A method for identifying a peptide the sequence of which is derived from a viral, parasitic or cellular protein, said peptide specifically binding a type 2A protein phosphatase holoenzyme or one of its subunits, said method comprising the steps consisting of:
- a) depositing, in the form of spots on a support, peptides the sequence of which is derived from a viral, parasitic or cellular protein, each spot corresponding to the deposit of a peptide with a defined sequence;
- b) bringing the solid support into contact with a solution containing the protein phosphatase 2A holoenzyme or one of its subunits under conditions that allow the peptides present on the support to bind the holoenzyme or one of its subunits; and
- c) identifying on the solid support the peptide to which the protein phosphatase 2A or one of its subunits is bound.
37. A method according to claim 36, characterized in that the size of the peptides deposited in the form of a spot is less than 20 amino acids, preferably less than 15 amino acids.
38. A method according to any one of claims 36 or 39, characterized in that the peptides are deposited on a cellulose membrane.
39. A method according to any one of claims 36 to 40, characterized in that the series of deposited peptide sequences covers the complete sequence of the viral, parasitic or cellular protein from which those sequences are derived.
40. A method for preparing a peptide as defined in any one of claims 1 to 20, 28 or 29, comprising transforming a host cell using a cellular expression vector as defined in claim 24, followed by culturing the transformed host cell and recovering the peptide in the culture medium.
Type: Application
Filed: Jan 26, 2004
Publication Date: Jan 19, 2006
Applicants: INSTITUT PASTEUR (Paris), Institut National de la Recherche Agronomique (Paris Cedex), CONSEJO SUPERIOR DE INVESTIGACIONES CIENTIFICAS (Madrid), Centre National De La Recherche Scient. (Paris Cedex)
Inventors: Alphonse Garcia (Montrouge), Xavier Cayla (Rochecorbon), Angelita Rebollo (Madrid), Gordon Langsley (Paris)
Application Number: 10/763,286
International Classification: A61K 38/10 (20060101); C07K 7/08 (20060101);