Abstract: A technique is provided, wherein any influence, which would be otherwise exerted on a reaction of an objective substance caused by a reagent enzyme by an interfering substance contained in a specimen, is suppressed in relation to an electrochemical sensor for measuring the objective substance contained in the specimen. A sensor comprises a substrate; a detecting unit which is provided on the substrate and which detects an objective substance; a filter which covers the detecting unit, which permits permeation of the objective substance on one hand, and which regulates permeation of an interfering substance contained in a sample on the other hand; and removing unit which removes the interfering substance adhered to the filter.

Abstract: A technique is provided, wherein any influence, which would be otherwise exerted on a reaction of an objective substance caused by a reagent enzyme by an interfering substance contained in a specimen, is suppressed in relation to an electrochemical sensor for measuring the objective substance contained in the specimen. A sensor comprises a substrate; a detecting unit which is provided on the substrate and which detects an objective substance; a filter which covers the detecting unit, which permits permeation of the objective substance on one hand, and which regulates permeation of an interfering substance contained in a sample on the other hand; and removing unit which removes the interfering substance adhered to the filter.

Abstract: An electrochemical sensor includes a base member, a conductor disposed on the base member, an insulating layer covering the conductor with a portion of the conductor exposed, a silver/silver chloride electrode formed on at least the exposed portion of the conductor, and a water-permeable organic layer covering the silver/silver chloride electrode.

Abstract: The present invention provides a probe for detecting a mutation in the ALK gene, which is at least one fluorescently labeled oligonucleotide selected from the group consisting of P1 to P4, P7 and P8 oligonucleotides; an application thereof; and an oligonucleotide for the application.

Abstract: A liquid chromatography apparatus is provided with a sample preparation unit, a column that separates components of a sample, an eluent supplier that includes a feeder for supplying eluents to the column, a flow path directional valve capable of introducing fixed amounts of the sample and the eluents to the column, an analyzer for analyzing a test solution composed of the sample components separated by the column and one of the eluents, and a controller, wherein the eluent supplier supplies the eluents to the flow path directional valve in an unmixed state. As a result of employing this configuration, analysis time is shortened and eluent consumption is reduced.

Abstract: A measuring apparatus for measuring a substrate concentration by using a sensor including an enzyme reagent layer includes a state detecting unit that applies a first voltage and a second voltage different from the first voltage to the sensor to detect a state of the enzyme reagent layer based on a difference between a first response current value obtained under application of the first voltage and a second response current value obtained under application of the second voltage.

Abstract: The present disclosure provides a novel primer reagent for detecting a plurality of variants of the ALK fusion gene.

Abstract: A method for measuring a target object in a sample by using an oxidase, wherein the influence of dissolved oxygen in the sample can be corrected, is provided. The method comprises: obtaining measurement values by causing the target object in the sample to react with the oxidase under different conditions of two or more types; and performing a correction based on the obtained two or more measurement values and a correction method preliminarily set so as to correct the influence of dissolved oxygen in the sample.

Abstract: There is provided a sensor testing method including: applying at least one of a first voltage that obtains a response caused by a substance and a second voltage that either obtains no response or substantially no response caused by the substance across a first electrode and a second electrode of a sensor; measuring current flowing between the first electrode and the second electrode; and determining whether or not there is a defect present in the sensor based on a quantity related to an amount of change per specific period of time of a current measured when the first voltage and/or the second voltage have been applied.

Abstract: A bubble reduction device, chromatography device, bubble reduction method and bubble reduction program capable of reducing bubbles in an eluent. Included are a liquid accommodation portion, a liquid supply apparatus, an air layer formation apparatus, a first channel and an evacuation portion. The liquid accommodation portion accommodates a liquid that is to elute an analysis component from a specimen adsorbed to an adsorption portion. The liquid supply apparatus, by operation of a rod pushing up and polling down, sucks and discharges the liquid through an aperture portion of a tube portion, the aperture portion being oriented upward. The air layer formation apparatus forms an air layer in the tube portion. The first channel connects the liquid supply apparatus with the liquid accommodation portion. The evacuation portion is connected to the first channel via a first switching valve and evacuates the air layer through the first channel.

Abstract: The invention relates to a measurement system MS1 provided with a plurality of loading units 10 into which a measurement tool 4 supporting a reagent is loaded. The measurement system MS1 includes reading means 2 for reading information on an analyte provider that includes identification information, and guidance means 11 for guiding the measurement tool 4 to which an analyte derived from the analyte provider has been or is to be applied, to a loading unit that is selected from the plurality of loading units 10 and individually associated with the analyte provider based on the identification information that has been read by the reading means 2. With such configuration, the measurement results obtained from the analyte derived from the analyte provider can be easily associated with the information on the analyte provider that includes the identification information.

Abstract: An object of the present invention is to provide an amplification method that inhibits amplification caused by erroneous annealing of a primer. Primers X1 and X2 are used in amplification of a target sequence including a target site showing a polymorphism. The primer X1 includes a sequence A1? and a sequence E1. The sequence A1? is complementary to a partial sequence A1 in a template nucleic acid, and has, in its 3? region, a base x1? complementary to a first base x1 at the target site in a 5? region of the sequence A1. The sequence E1 is noncomplementary to a partial sequence B1 adjacent to the 3? end of the partial sequence A1 in the template nucleic acid, and is bound to the 5? end of the partial sequence A1?. The primer X2 includes a sequence A2?. The sequence A2? is complementary to a partial sequence A2 in the template nucleic acid, and has, in its 3? region, a base x2? complementary to a second base x2 at the target site in a 5? region of the partial sequence A2.

Abstract: A method for recovering a metal, capable of recovering a metal easily without requiring the use of an organic medium, is provided. A first complex between a first chelating agent and a metal present in a sample is formed in a first mixture prepared by mixing the first chelating agent and the sample. Then, the first complex is recovered from the first mixture, and a second complex between the metal derived from the first complex and a second chelating agent is formed in a second mixture prepared by mixing the first complex and an aqueous solution of the second chelating agent. The aqueous solution is under the pH conditions where the first chelating agent can be insoluble in the aqueous solution. Then, a liquid fraction containing the second complex is recovered from the second mixture. Thus, the metal can be recovered.

Abstract: A new peptide derivative is provided.

Abstract: A technique is provided, wherein any influence, which would be otherwise exerted on a reaction of an objective substance caused by a reagent enzyme by an interfering substance contained in a specimen, is suppressed in relation to an electrochemical sensor for measuring the objective substance contained in the specimen. A sensor comprises a substrate; a detecting unit which is provided on the substrate and which detects an objective substance; a filter which covers the detecting unit, which permits permeation of the objective substance on one hand, and which regulates permeation of an interfering substance contained in a sample on the other hand; and removing unit which removes the interfering substance adhered to the filter.

Abstract: A method for measuring a target object in a sample by using an oxidase, wherein the influence of dissolved oxygen in the sample can be corrected, is provided. The method comprises: obtaining measurement values by causing the target object in the sample to react with the oxidase under different conditions of two or more types; and performing a correction based on the obtained two or more measurement values and a correction method preliminarily set so as to correct the influence of dissolved oxygen in the sample.

Abstract: A method for obtaining information about proteinuria and/or nephropathy from urine samples is provided for evaluating a urine sample that includes detecting proteins in the urine sample with two types of detection reagents that differ in reactivity to at least one urinary protein; and based on an indicator calculated using the results of the detection with the two types of detection reagents.

Abstract: The present invention provides a probe for detecting a V600 polymorphism in the BRAF gene, which is (P1) a fluorescently labeled oligonucleotide which has an identity of at least 80% to a base sequence having a length of 10 to 50 bases including the 228th to the 237th bases of the base sequence indicated in SEQ ID NO: 1, wherein the base corresponding to the 237th base is cytosine labeled with a fluorescent dye, the oligonucleotide recognizing a polymorphism in at least one of the 228th to the 230th bases of the base sequence indicated in SEQ ID NO: 1 (with the proviso that the oligonucleotide is not the one indicated in SEQ ID NO: 7 or 19).

Abstract: A measurement apparatus to measure a physical quantity related to a measurement target by use of a sensor, comprising: an apparatus enclosure; a control unit to be electrically connected to the sensor; and a moving member including a sensor holding unit to hold the sensor, the moving member being movable to protrude the sensor holding unit outwardly of the apparatus enclosure and further including a conductive member to electrically connect the sensor to the control unit.

Abstract: A molecular probe for imaging of pancreatic islets is provided. The molecular probe includes a polypeptide represented by the following formula (1), or a polypeptide that has a homology with the foregoing polypeptide. (SEQ?ID?NO.?1) Z-HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPSX-NH2?(1) Wherein “X” represents a lysine residue, an amino group of a side chain of the lysine residue being labeled with a group represented by the following chemical formula (I), wherein A represents an aromatic hydrocarbon group or an aromatic heterocyclic group; R1 represents a substituent that contains 11C, 13N, 15O, 18F, 64Cu, 67Ga, 68Ga, 75Br, 76Br, 77Br, 99mTc, 111In, 123I, 124I, 125I, or 131I; R2 represents either a hydrogen atom, or a substituent different from that represented by R1; and R3 represents any one of a bond, an alkylene group having 1 to 6 carbon atoms, and an oxyalkylene group having 1 to 6 carbon atoms.